<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"
        xmlns:video="http://www.google.com/schemas/sitemap-video/1.1">
  <url>
    <loc>https://www.febspot.com/video/3476069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Super Mulher 🤣🤣</video:title>
      <video:description>Rir faz bem. #Filme #comédia #rir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476069/3476069_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T19:17:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Snap and Style: Watching the Ultimate Fashion Transition</video:title>
      <video:description>From casual lounging to stepping out in style! Watch this seamless outfit transition as she changes her look in a blink of an eye. There is nothing better than finding the perfect match that boosts your confidence instantly. Which look did you like best? #FashionTransition #OutfitChange #GRWM #GetReadyWithMe #OOTDInspiration #GlowUpTransition #StyleInspo #AestheticFashion #ChicLook #CasualStyle #TrendTransition #FashionReels #TikTokFashion #WomensFashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476068/3476068_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-21T19:17:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Burger nusantara</video:title>
      <video:description>Ini adalah burger buat sendiri,dan rutinitas sarapan pagi.yang berisi sosis NuGet sayur tomat,dan mentimun sangat mudah untuk membuatnya #burgerresepkueburgerisi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476067/3476067_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T19:17:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neurosains di Balik Hawa Nafsu vs Logika</video:title>
      <video:description>neuroscience education behind lust vs logic #education #learning #scientificfacts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476066/3476066_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T19:17:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Satipith Kalighat S01E21</video:title>
      <video:description>Satipith Kalighat S01E21 #SatipithKalighat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476065/3476065_720p.mp4</video:content_loc>
      <video:duration>1870</video:duration>
      <video:publication_date>2026-09-21T19:16:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 133</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476064/3476064_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:16:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 132</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476063/3476063_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:16:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 131</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476062/3476062_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:15:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bro Wanted to look Strong</video:title>
      <video:description>Bro Wanted to look srong #Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476061/3476061_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T19:15:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semaranf city</video:title>
      <video:description>#Semarang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476060/3476060_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T19:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 130</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476059/3476059_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:15:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 129</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476058/3476058_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:15:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Szszto</video:title>
      <video:description>#Tribunal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476057/3476057_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T19:15:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 128</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476056/3476056_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:14:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 127</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476055/3476055_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:14:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 126</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476054/3476054_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:14:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 125</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476053/3476053_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:13:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chat Morocco Beautiful girls</video:title>
      <video:description>Email: att.t.shopping374@gmail.com Signal: +18567189027</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476052/3476052_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T19:13:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Este Deu passo maior que a perna😱 🤣🤣</video:title>
      <video:description>🤣🤣🤣🤣🤣 #Filme #comédia #rir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476051/3476051_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T19:13:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar Mendapatkan Gaji 30 Juta Per Bulan !!!!!!!!!!!!!!!!!!</video:title>
      <video:description>#Clipper</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476050/3476050_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T19:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 124</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476049/3476049_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:11:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 123</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476048/3476048_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:11:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SkakiraAcrostico</video:title>
      <video:description>Música</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476047/3476047_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T19:11:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 122</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476046/3476046_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:10:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemasangan yang sejuk</video:title>
      <video:description>Melihat pemandangan yang sejuk dan indah di pandang mata #newzayland</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476045/3476045_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T19:10:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>message with honey</video:title>
      <video:description>message with honey #messagehome</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476044/3476044_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T19:10:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 121</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476043/3476043_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:10:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MiliBritez 2</video:title>
      <video:description>Música</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476042/3476042_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T19:10:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 120</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476041/3476041_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Talented little kid singing</video:title>
      <video:description>#Music #viral #kidsinging</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476040/3476040_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T19:10:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 119</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476039/3476039_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:09:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Homem de fé 2</video:title>
      <video:description>Pediu e foi atendido #Religioso</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476038/3476038_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T19:09:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 118</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476037/3476037_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:09:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Morocco Sexy Girl</video:title>
      <video:description>Signal : +18567189027 Chat up single girls from Morocco #Travel #France #Morocco</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476036/3476036_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T19:09:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiktok game filters</video:title>
      <video:description>Try playing the game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476035/3476035_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T19:09:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 117</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476034/3476034_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:09:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>अपने प्यार की खुशी के लिए, वो भीगने को भी तैयार है!</video:title>
      <video:description>प्यार में प्रयास और त्याग बहुत मायने रखता है। देखिए कैसे यह लड़की अपने साथी के चेहरे पर मुस्कान लाने के लिए भीगने से भी पीछे नहीं हटी। जब आपका जीवनसाथी मुस्कुराता है, तो सारी मुश्किलें आसान हो जाती हैं। यह सच्चा प्यार है! #PremKatha #PyarKaPehlaNaam #RomanceInRain #TrueLove #RomanticMoments #LoveStory #Humsafar #DilSe #CuteCouple #PyarGhar #Mohabbat #SacchaPyar #CoupleGoals #AnmolRishta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476032/3476032_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T19:09:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 116</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476031/3476031_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:09:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita seksi 6</video:title>
      <video:description>#Seksi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476030/3476030_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T19:08:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comfort is the enemy of progress. Push your limits every single day</video:title>
      <video:description>Comfort is the enemy of progress. Push your limits every single day #SuccessMindsetGrindHardSelfImprovementMindsetShiftKeepGoing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476029/3476029_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T19:08:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gundam gandul</video:title>
      <video:description>#Bergoyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476028/3476028_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T19:08:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jhoome jo pathan 2</video:title>
      <video:description>🔥 Jhoome Jo Pathaan 🔥 Feel the energy, rhythm, and powerful vibe of “Jhoome Jo Pathaan”! 🎶✨ This energetic Bollywood song brings an exciting combination of music, dance, and unforgettable moments. Enjoy the music and let the rhythm make you move! 💃🕺 #JhoomeJoPathaan #JhoomeJoPathaansong #Pathaansong #Pathaanmovie #Bollywoodsongs #Bollywoodmusic #Hindisongs #Hindimusic #Indiansongs #Indianmusic #ShahRukhKhan #DeepikaPadukone #Bollywooddance #dancesongs #trendingBollywoodsongs #popularHindisongs #Bollywoodhits #JhoomeJoPathaanstatus #Bollywoodshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476027/3476027_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T19:08:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menikmati pejalanan</video:title>
      <video:description>#Perjalanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476026/3476026_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T19:08:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral Trumpet</video:title>
      <video:description>#Music #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476025/3476025_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T19:07:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 115</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476024/3476024_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:07:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pocong lucu 2</video:title>
      <video:description>#Pocong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476023/3476023_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T19:07:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 114</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476022/3476022_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:07:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rir a dobrar</video:title>
      <video:description>Pura comédia #Filme #comédia #rir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476021/3476021_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T19:07:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bergoyang goyang</video:title>
      <video:description>#Goyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476020/3476020_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T19:07:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 113</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476019/3476019_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:07:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The secrets to building a house</video:title>
      <video:description>This video shows what it&apos;s like to build a house on a cliff. #building #house #construction #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476018/3476018_720p.mp4</video:content_loc>
      <video:duration>89</video:duration>
      <video:publication_date>2026-09-21T19:07:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rotina da manhã cuidando do nosso almoço.</video:title>
      <video:description>Cuidando do nosso almoço fiz feijão, arroz, carne de panela. #Donadecasa #almoçosimples #comidacaseira</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476017/3476017_720p.mp4</video:content_loc>
      <video:duration>288</video:duration>
      <video:publication_date>2026-09-21T19:07:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Make Your Food Look Amazing in Just Minutes! 🍽️✨ | The Secret Before Every Meal</video:title>
      <video:description>Before taking the first bite, the way food is presented can make the whole meal feel more enjoyable. 🍽️✨ With just a few simple touches and a little creativity, you can transform an ordinary meal into something beautiful and inviting—in only a few minutes! No expensive items needed. Just a little imagination, neat arrangement, and attention to detail. 🌿🥗 #foodpresentation #fooddecoration #easyfoodpresentation #quickfooddecoration #foodstyling #beautifulfood #creativefoodideas #simplefooddecoration #easykitchenideas #mealpresentation #foodplating #platingideas #attractivefood #homemadefood #foodlovers #kitchencreativity #easydecorationideas #quickfoodideas #satisfyingfood #foodaesthetic #creativekitchenideas #simplefoodstyling #beautifulplating #dinnerpresentation #lunchpresentation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476016/3476016_720p.mp4</video:content_loc>
      <video:duration>118</video:duration>
      <video:publication_date>2026-09-21T19:07:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476015</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476015/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Panahan</video:title>
      <video:description>#Panahan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476015/3476015_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T19:07:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing Sing Music</video:title>
      <video:description>#Music #video #short #Amazing #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476014/3476014_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-21T19:07:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 112</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476013/3476013_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:06:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berendam</video:title>
      <video:description>#Berendam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476012/3476012_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T19:06:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 111</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476011/3476011_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:06:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buat sarapan pagi</video:title>
      <video:description>#Sarapan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476010/3476010_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T19:06:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 110</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476009/3476009_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:06:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Making Him Smile: When She Goes Extra Mile for Love</video:title>
      <video:description>Nothing beats the feeling of making the person you love happy! Watch this sweet blonde girl put all her effort into bringing a smile to her boyfriend&apos;s face. From cute surprises to thoughtful little gestures, it is the simple things that make a relationship so special. #CuteCouple #BlondeGirl #RelationshipGoals #LoveStory #MakingHimSmile #CuteMoments #CouplesOfTikTok #HealthyRelationship #BoyfriendAndGirlfriend #SweetGestures #LoveInTheAir #PositiveVibes #HappyCouple #DailyVlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476008/3476008_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T19:05:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 109</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476007/3476007_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:05:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🪁 Flying High in the Sky | Beautiful Kite Song ☁️🎵</video:title>
      <video:description>Watch a beautiful kite flying high in the blue sky and soaring up toward the clouds! 🪁☁️ Enjoy this fun and relaxing kite song with colorful skies, flying dreams, and happy moments. Perfect for viewers who love kite flying, relaxing music, sky videos, and fun songs. #kiteflying #flyingkite #kiteinthesky #kiteflyinghigh #kiteintheclouds #flyakite #colorfulkite #beautifulkite #kitesong #flyinghigh #upintheclouds #soaringinthesky #skyadventure #flyinginthesky #kiteflyinghighinthesky #colorfulkiteflyingintheclouds #beautifulkiteflyinghigh #kitesongforkids #funkiteflyingsong #kitesoaringhighintothesky</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476006/3476006_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T19:05:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naziya khan</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476005/3476005_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T19:05:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 108</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476004/3476004_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:05:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SI DELIXE</video:title>
      <video:description>Motor good #Motor #good</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476003/3476003_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T19:05:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 107</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476002/3476002_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:05:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Aura Men</video:title>
      <video:description>#Aura #video #viral #auramen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476001/3476001_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T19:04:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3476000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3476000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Classmates build him a robotic hand ✋🏻</video:title>
      <video:description>Classmates build him a robotic hand by Zack D Films #Classmates #robot #hand #kid #zackdfilms #us #usa #true #story #build #friends #new #highschool</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3476000/3476000_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T19:04:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 106</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475999/3475999_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:04:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 105</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475998/3475998_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:04:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Written in the Stars: Their Aesthetic Romance</video:title>
      <video:description>Feeling the deep emotional connection between these two lovers. Every soft touch and lingering glance tells a story of a profound love that overcomes everything. A visually breathtaking scene from your favorite Chinese drama. #CDramaLovers #RomanticScene #EmotionalLove #AestheticRomance #DramaShorts #ChineseActor #CoupleGoals #DeepLove #TrueRomance #DramaVibes #CinematicLove #MustWatchCDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475997/3475997_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T19:04:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teach Me How to Scream!</video:title>
      <video:description>Check out this hilarious and energetic short animation featuring two cute characters dancing and shouting to &quot;Teach Me How to Scream&quot;! A fun and quirky clip that will definitely make you smile #AnimationMeme #TeachMeHowtoScream #FunnyAnimation #CuteCharacters #2DShort #CartoonDance #ViralAnimation #ShortComedySkit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475996/3475996_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T19:04:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mom cat</video:title>
      <video:description>mom cat #cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475995/3475995_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T19:04:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 104</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475994/3475994_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:03:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Epic moment Zoro x Rob Lucci</video:title>
      <video:description>#Onepiece #Anime #Animelovers #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475993/3475993_720p.mp4</video:content_loc>
      <video:duration>397</video:duration>
      <video:publication_date>2026-09-21T19:03:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 103</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475992/3475992_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:03:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mind-Blowing Stop-Motion: Building a Cat Portrait from Natural Twigs</video:title>
      <video:description>A captivating overhead hyper-lapse showing the step-by-step creation of a detailed Cat portrait. Watch how raw textured bark, mossy wood, and sharp pine needles transform into beautiful feline art. #catart #petportrait #satisfyingcreation #hyper-lapsevideo #stopmotionart #organicdesign #woodcraft #textures #artistichands #slowart</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475991/3475991_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T19:03:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 102</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475990/3475990_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:03:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 101</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475989/3475989_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:03:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Plunged into lava</video:title>
      <video:description>Experiment of throwing a cat into lava #Lava #experiments #Cats #Cuteanimals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475988/3475988_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T19:02:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 100</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475987/3475987_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:02:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinta modeladora 3</video:title>
      <video:description>Cinta modeladora #Cintamodeladora</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475986/3475986_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T19:02:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 99</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475985/3475985_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:02:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cat sleep</video:title>
      <video:description>cat sleep #cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475984/3475984_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T19:02:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475983</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475983/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 98</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475983/3475983_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:02:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 97</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475982/3475982_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:01:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funy moment 8</video:title>
      <video:description>#Short #vidios #funy #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475981/3475981_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T19:01:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 96</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475980/3475980_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T19:01:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pure Romance: When True Love Finds Its Way</video:title>
      <video:description>Lost in each other&apos;s eyes! Watching this beautiful CDrama couple share a tender, romantic moment as they deeply express their love for one another. Their chemistry is so natural it will make your heart skip a beat. #CDrama #ChineseDrama #RomanticCDrama #DramaCouples #LoveStory #CDramaEdit #RomanticMoments #Heartwarming #SweetLove #DramaClips #CutenessOverload #LoveInTheAir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475979/3475979_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T19:01:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinta modeladora feminina</video:title>
      <video:description>Cinta modeladora feminina. #Cintamodeladorafeminina</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475978/3475978_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T19:01:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nongkrong sama teman</video:title>
      <video:description>#ParisPerancis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475977/3475977_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T19:00:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kagura amazing</video:title>
      <video:description>#Mlbb #Game #viral #kaguraoutplay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475976/3475976_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T19:00:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Revealing My Favorite Drawing Brush!</video:title>
      <video:description>Someone asked, &quot;Wow, your draw is beautiful, what brush did you use?&quot; Watch this quick speedpaint video to find out the exact brush settings and tools used to create this cute digital artwork! #ibisPaintXSpeedpaintDigitalArtDrawingBrushArtTutorialCuteDrawingSketchingProcessArtTips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475975/3475975_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T19:00:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>04 BRASINHA RM UMA QUSTÃO DE CHIFRES #comics #gibi #quadrinhos #historieta #fumetti #bandadesenhada</video:title>
      <video:description>MAIS UMA AVENTURA DO BRASINHA #comics #gibi #quadrinhos #historieta #fumetti #bandadesenhada #comics #gibi #quadrinhos #historieta #fumetti #bandadesenhada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475974/3475974_720p.mp4</video:content_loc>
      <video:duration>250</video:duration>
      <video:publication_date>2026-09-21T18:59:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sad to be alone</video:title>
      <video:description>This video shows someone who is sad, staying in their room. #Sad #room #music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475973/3475973_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T18:58:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Above the clouds at sunset: pilot POV 🥹</video:title>
      <video:description>The view pilots get every day. ✈️🌅 Takeoff, a sea of clouds at sunset and touchdown, all in under 40 seconds. 😳 Would you become a pilot for this view? Comment below 👇 Tag someone who loves planes. #pilotview #cockpitview #pilotPOV #takeoffandlanding #abovetheclouds #sunsetflight #airplanecockpit #aviation #avgeek #pilotlife #flying #airplanelanding #cockpitfootage #cloudsfromabove #aviationshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475972/3475972_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T18:58:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Santai di taman</video:title>
      <video:description>#Taman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475971/3475971_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T18:58:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sense of caring</video:title>
      <video:description>Strong feelings #Animals #Care #touching #family #jungle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475970/3475970_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T18:57:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar naik. Kuda</video:title>
      <video:description>#Naikkuda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475969/3475969_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:57:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jatuh cinta lagi</video:title>
      <video:description>#Jatuhcinta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475968/3475968_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T18:57:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475967</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475967/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemanasan</video:title>
      <video:description>#Pemanasan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475967/3475967_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T18:56:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Wanna See You Dance!</video:title>
      <video:description>Check out this adorable and high-energy animated short featuring a cute character dancing to &quot;I Wanna See You Dance&quot;! 💃🎶 Created with love and frame-by-frame animation, this fun clip is sure to brighten up your day #DanceShort</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475966/3475966_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T18:56:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gunung yang indah 2</video:title>
      <video:description>#Keindahan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475965/3475965_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T18:56:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AMAZING RED SAUCE PASTA RECIPE!!</video:title>
      <video:description>250g Pasta (Penne, Fusilli, or Rigatoni)2 tbsp Extra virgin olive oil4-5 cloves Garlic, finely minced1 small Yellow onion, finely chopped4 large Fresh tomatoes (blanched &amp; pureed) OR 1 can (400g) crushed tomatoes1 tsp Dried oregano1 tsp Red chili flakes1/2 tsp Black pepper, freshly ground1/2 tsp Sugar (to balance tomato acidity)Salt to tasteFresh basil leaves &amp; grated Parmesan cheese for garnish1.Boil the pasta:Save 1/2 cup of pasta water before draining.Bring a large pot of heavily salted water to a boil. Add pasta and cook until al dente (usually 1-2 minutes less than package instructions). Reserve 1/2 cup of pasta water, then drain the rest.2.Sauté the aromatics:Heat olive oil in a wide skillet over medium heat. Add minced garlic and sauté for 30 seconds until fragrant (do not let it brown). Add chopped onions and cook for 3–4 minutes until soft and translucent.3.Simmer the tomato sauce:Pour in the tomato puree or crushed tomatoes. Stir in oregano, red chili flakes, black pepper, sugar, and salt. Reduce heat to low, cover, and let simmer for 10–12 minutes until the oil starts to separate on top.4.Toss pasta and emulsify:Add the cooked pasta directly into the sauce. Pour in 2–3 tablespoons of the reserved starchy pasta water to bind the sauce seamlessly to the noodles. Toss well over low heat for 1–2 minutes.5.Garnish and serve:Remove from heat. Turn in fresh basil leaves and sprinkle generously with grated Parmesan cheese before serving hot. #REDSAUCE #PASTA #RECIPE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475964/3475964_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T18:56:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Don&apos;t Bleed on People Who Didn&apos;t Cut You | Healing &amp; Heartbreak</video:title>
      <video:description>If you don&apos;t heal from what hurt you, you end up hurting the wrong people. Relationship pain and heartbreak can&apos;t be avoided or worked around—the only way to heal is to face it head-on and walk through it. A powerful reminder to do the inner work before moving forward. #healing #relationshipadvice #personalgrowth #heartbreak #emotionalhealing #motivation #self-improvement</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475963/3475963_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T18:56:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meraba raba</video:title>
      <video:description>#Raba</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475962/3475962_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T18:56:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kupas jagung</video:title>
      <video:description>#Jagung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475961/3475961_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T18:55:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Peru: Machu Picchu, Cusco e sabores inesquecíveis.</video:title>
      <video:description>Machu Picchu: um amanhecer a dois. Entre a névoa das montanhas, a catedral de Cusco, as alpacas, a Montanha Arco-Íris e um bom ceviche, o Peru é um destino perfeito para uma viagem romântica. Guarda este vídeo para o teu próximo destino de sonho! Mais roteiros no blog: descobrindoomundoviagem.blogspot.com</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475960/3475960_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T18:55:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Olahraga 20</video:title>
      <video:description>#Olahraga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475959/3475959_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:55:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terjun payung</video:title>
      <video:description>#Terjunpayung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475958/3475958_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T18:54:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#islamicvideo 7</video:title>
      <video:description>Allah sara kew nai 💝</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475957/3475957_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T18:54:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 95</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475956/3475956_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:54:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mengukur lebar gunung</video:title>
      <video:description>#Mengukur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475955/3475955_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T18:54:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 94</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475954/3475954_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:54:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The blue wishper 15</video:title>
      <video:description>She get</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475953/3475953_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-21T18:54:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 93</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475952/3475952_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:54:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 92</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475951/3475951_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:53:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 91</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475950/3475950_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:53:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 90</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475949/3475949_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:53:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours ep 4 Hindi dubbed</video:title>
      <video:description>A love other than yours episode 4 Hindi dubbed K-drama (ongoing drama) #Childhoodfriends #lovers #Newdrama #hindidubbed #childhoodfriendstolovers #trending #2k26</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475948/3475948_720p.mp4</video:content_loc>
      <video:duration>3882</video:duration>
      <video:publication_date>2026-09-21T18:53:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 89</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475947/3475947_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:53:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of Duty: Modern Warfare 4 Multiplayer Gameplay</video:title>
      <video:description>This is Call of Duty: Modern Warfare 4 (MW4) Multiplayer Gameplay in 4K 60FPS on PC — Powered by RTX 5090 (Max Settings • No Commentary). I upload entire Call of Duty: Modern Warfare 4 matches regularly. Having been active in Call of Duty since the OG days, I showcase complete, uncut gameplay to deliver the most immersive viewing experience possible. 🎮 Game Title: Call of Duty: Modern Warfare 4 🖥️ Platform: PC 🔄 Game Mode: Multiplayer 🕹️ Input Device: Controller 💻 PC SPECS: • GPU: NVIDIA GeForce RTX 5090 SUPRIM SOC • CPU: AMD Ryzen 7 9800X3D • RAM: 64GB DDR5 • Monitor: ASUS ROG Swift OLED (240 Hz) #callofduty #cod #modernwarfare #modernwarfare4 #codmw4 #activision #infinityward #multiplayer #warzone #gaming #first-personshooter #tacticalshooter #campaignmode #videogames #esports #callofdutygames #cod4 #calofduty #modrenwarfare #mw4 #codmw4campaign #calofdutty #modrnwarfare</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475946/3475946_720p.mp4</video:content_loc>
      <video:duration>1439</video:duration>
      <video:publication_date>2026-09-21T18:53:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian rocket</video:title>
      <video:description>Indian rocket 🚀🚀🚀🚀🚀🌱🌱🌱🚀 king 👑 is Bling 👑👑👑👑💖👑😍😍🥰😍😍🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475945/3475945_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T18:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalanan panjang 2</video:title>
      <video:description>Jalanan panjang yang menyenangkan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475944/3475944_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T18:52:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Making green bamboo jelly</video:title>
      <video:description>Food from bamboo #Food #Animal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475943/3475943_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-09-21T18:52:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 88</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475942/3475942_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:52:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🚗Assembling the Ferrari F40 Miniature</video:title>
      <video:description>Assembling the Ferrari F40 Miniature #MiniBrandsUnboxingUnboxingMiniBrandsMiniToyUnboxingUnboxingASMRToyUnboxingRelaxingUnboxingUnboxingToysBarbieUnboxingUnboxingCompilationMiniaturaMiniatureCookingMiniaturesMiniatureASMRMiniatureTherapyMiniatureVlogMiniatureFridgeMiniatureKitchenUnboxingVideoMakeAPinkMiniatureHouseMiniatureFurnitureWorkingMiniaturesDollhouseMiniatureBratzMiniMiniBratzBratzMinisFlashbackMiniBratz</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475941/3475941_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:52:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onimusha_ Way of the Sword 87</video:title>
      <video:description>Onimusha_ Way of the Sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475940/3475940_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T18:52:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menetaskan Telur Raksasa Experiment</video:title>
      <video:description>Menetaskan Telur Raksasa Experiment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475939/3475939_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T18:51:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The last bamboo</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑💖💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475938/3475938_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-21T18:51:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My journey in the gym</video:title>
      <video:description>• Your Body Hears Everything Your Mind Says #WomenworkoutGlutesgirlsbody</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475937/3475937_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T18:51:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reborn and this time she&apos;s NOT letting them win 💪</video:title>
      <video:description>They took everything from her. Then she got a second chance. 😭🔥 Rural life, family betrayal and a rebirth that changes everything. Watch till the end. 👀 Would you forgive them or make them pay? Comment below 👇 #rebirthstory #rebornrevenge #animateddrama #Chineseruraldrama #familybetrayalstory #underdogstory #secondchancestory #animatedshortdrama #rebornheroine #rebirth1970s #poorgirlsuccessstory #storytimeanimation #farmlifedrama #Chineseanimation #revengeandredemption</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475936/3475936_720p.mp4</video:content_loc>
      <video:duration>273</video:duration>
      <video:publication_date>2026-09-21T18:50:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pov. Class</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑💖👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475935/3475935_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T18:50:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Suara Ancaman Seram dari Pet Axolotl Baru!</video:title>
      <video:description>Suara Ancaman Seram dari Pet Axolotl Baru! #game #roblox</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475934/3475934_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T18:50:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ranking fastest</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑💖💖💖💖✨💖✨🙏🏻</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475933/3475933_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T18:49:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masakan indonesia yang bikin betah</video:title>
      <video:description>Hallo salam kenal dan slamat datang di chenel ini y,vidio ini hanya menu makan,yang saya rasa baik untuk mood makan kita.semoga vidionya bisa di trima y.trimakasih #makananrumahfoodnusantararesepmasakanmukbang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475932/3475932_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T18:48:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khalid Mohamed</video:title>
      <video:description>This video song the enjoy #Englishlanguage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475931/3475931_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T18:48:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mechanical generator toy 2</video:title>
      <video:description>Transition mechanical generator toy #Mechanical #generator #toy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475930/3475930_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T18:48:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aesthetic 30</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑💖💖✨🙏🏻💖💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475929/3475929_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:48:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dropping a Yo Yo from a skyscraper 😯</video:title>
      <video:description>Dropping a Yo Yo from a skyscraper by Zack D Films #Impossible #skyscraper #yoyo #game #play #science #physics #zackdfilms #us #usa #new #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475928/3475928_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T18:47:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dad got jealous of his baby</video:title>
      <video:description>So beautiful video cute baby laughing ❣️❣️😍❣️😍😍🥰🥰😍😍😍🥰🥰🥰🥰😍 #Europe🌍country❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475927/3475927_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T18:47:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ellie Elen in White: Elegant Charm with a Cute Twist</video:title>
      <video:description>Who says you can&apos;t be elegant and playful at the same time? Watching Ellie Elen pose gracefully in her stunning white dress while showing off her favorite toy. The perfect blend of timeless beauty and adorable vibes! #EllieElen #WhiteDress #ElegantStyle #CuteTwist #ToyCollector #PoseInspiration #AestheticMoments #PlayfulVibes #ClassyLook #ModelPose #OOTDWhite #GracefulVibes #BeautyInWhite #DreamyVibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475926/3475926_720p.mp4</video:content_loc>
      <video:duration>473</video:duration>
      <video:publication_date>2026-09-21T18:47:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Heart 18</video:title>
      <video:description>Not for love #LoveFeeling</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475925/3475925_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T18:47:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mechanical generator toy Jaguar</video:title>
      <video:description>Transition mechanical generator toy #Mechanical #generator #toy #jaguar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475924/3475924_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:47:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The poor girl who fed the whole village 🥹🔥</video:title>
      <video:description>She had nothing. But one pan, one recipe and a big heart changed everything. 🥞😭 Ancient village, tough times, and one girl who refused to give up. Watch till the end for the twist. 👀 Would you have taken the chance? Comment below 👇 #ancientChinadrama #Chinesehistoricaldrama #cdrama #shortdrama #ancientChinesefood #pancakerecipestory #poorgirlsuccessstory #underdogstory #villagelife #ancientcooking #Chinesestreetfood #historicalromance #cdramaedit #feelgooddrama #cookingdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475923/3475923_720p.mp4</video:content_loc>
      <video:duration>447</video:duration>
      <video:publication_date>2026-09-21T18:46:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EVANGELHO DO DIA SEGUNDO MATEUS 9,9-13</video:title>
      <video:description>EVANGELHO DO DIA SEGUNDO MATEUS 9,9-13 #Evangelho</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475922/3475922_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-21T18:46:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VEM NO PIQUE(SLOWED)</video:title>
      <video:description>#abdodata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475921/3475921_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T18:46:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mechanical generator toy</video:title>
      <video:description>Transition generator toy #Mechanical #generator #toy #Transition</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475920/3475920_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:45:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Satisfying Nature Art: Creating a Detailed Lion Portrait with Raw Wood</video:title>
      <video:description>Watch this satisfying top-down hyper-lapse as two hands craft an intricate, highly detailed portrait of a Lion using only raw natural materials like twigs, tree bark, and pine needles on a clean white background. #natureart #lionportrait #hyper-lapseart #satisfyingvideo #stopmotion #woodart #naturalmaterials #artisticcreation #creativedesign #textures</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475919/3475919_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:44:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#fypage #foryourpage #fyyyyyyyyyyyyyyyy</video:title>
      <video:description>#fypage #foryourpage #fyyyyyyyyyyyyyyyy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475918/3475918_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:44:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Finisher</video:title>
      <video:description>How to do handwork for umbhoqo #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475917/3475917_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T18:44:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Your Friend Pretends to Be Dead as a Prank! 💀😂 | Gacha Club Skit</video:title>
      <video:description>Watch what happens when a dramatic prank goes completely wrong! In this short Gacha Club skit, a character tells their friend to pretend to be dead, leading to a hilarious and unexpected reaction. Don&apos;t forget to like, subscribe, and leave a comment if this made you laugh! #gacha</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475916/3475916_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T18:44:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>chess clash</video:title>
      <video:description>chess match #chessmatch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475915/3475915_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-21T18:44:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>From far far away - Top Long-Distance Goals...</video:title>
      <video:description>Enjoy #football #soccer #longdistance #fyp #fyi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475914/3475914_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T18:44:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>THIS Is HOW MUCH Facebook Paid Me for My First 3 Months</video:title>
      <video:description>💰 THIS Is HOW MUCH Facebook Paid Me for My First 3 Months! Curious about how Facebook content monetization works and how much creators can potentially earn from their content? In this video, I break down my first 3 months of Facebook earnings, the content strategy behind the results, and the technology tools I used to create and grow my content. You&apos;ll learn about Facebook Content Monetization, Reels, creator tools, AI-powered content creation, audience growth, video performance, and monetization strategies that creators can explore. This is an educational breakdown of the process—not a guarantee of future earnings, since Facebook revenue can vary based on content, audience, views, eligibility, and other factors. #FacebookMonetization #FacebookContentMonetization #FacebookEarnings #FacebookReels #MakeMoneyOnFacebook #FacebookCreator #CreatorEconomy #ContentCreator #DigitalCreator #AICreator #AIContent #AITools #AIVideo #Technology #TechTips #ContentCreation #FacebookGrowth #ReelsGrowth #YouTubeGrowth</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475913/3475913_720p.mp4</video:content_loc>
      <video:duration>420</video:duration>
      <video:publication_date>2026-09-21T18:43:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mechanical Generator Toy</video:title>
      <video:description>#Mechanical #generator #toy #fish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475912/3475912_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T18:42:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prabu Anglingdarma II – Pemberontakan | Film Kolosal Indonesia</video:title>
      <video:description>Saksikan Prabu Anglingdarma II – Pemberontakan, kisah penuh petualangan, pertarungan, dan konflik kerajaan dalam film kolosal Indonesia. ⚔️ Saksikan sampai selesai dan ikuti kisah perjuangan Prabu Anglingdarma menghadapi berbagai rintangan. ❤️ Jangan lupa Follow untuk mendapatkan lebih banyak film lawas, film kolosal, dan film Indonesia lainnya. 🇬🇧 English Description Enjoy Prabu Anglingdarma II – Pemberontakan, an Indonesian historical-fantasy adventure filled with battles, royal conflicts, and dramatic action. ⚔️ Watch until the end and follow the journey of Prabu Anglingdarma through challenging conflicts. ❤️ Follow for more classic Indonesian movies, historical adventures, and action films. #PrabuAnglingdarma #PrabuAnglingdarmaII #Pemberontakan #PrabuAnglingdarmaPemberontakan #PrabuAnglingdarma2 #FilmPrabuAnglingdarma</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475911/3475911_720p.mp4</video:content_loc>
      <video:duration>3973</video:duration>
      <video:publication_date>2026-09-21T18:42:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju hello kitty</video:title>
      <video:description>#Bajubaru</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475910/3475910_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T18:42:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mandi di siring</video:title>
      <video:description>#Mandi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475909/3475909_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T18:41:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Classy Fashion Review: Becoming the Best Version of Myself</video:title>
      <video:description>Dressing up isn&apos;t just about the outfit; it&apos;s about the confidence and grace you carry within. Today’s fashion review is all about elegance and poise—refining myself inside and out to welcome the right one in the future. True beauty shines brightest when you value your own worth. #FashionReview #ElegantStyle #ClassyOutfit #SelfImprovement #ModestFashion #OOTDInspiration #ConfidenceGoals #FutureWifeVibes #GlowUpJourney #AestheticLook #GracefulLiving #ChicStyle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475908/3475908_720p.mp4</video:content_loc>
      <video:duration>936</video:duration>
      <video:publication_date>2026-09-21T18:41:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Small 4</video:title>
      <video:description>#smallfilm</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475907/3475907_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T18:41:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menyusui sapi</video:title>
      <video:description>#Sapimeyusui</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475906/3475906_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T18:41:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita serba hitam</video:title>
      <video:description>#Balckwoman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475905/3475905_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:40:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio jalanan</video:title>
      <video:description>Jalan raya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475904/3475904_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-21T18:40:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju biru mempesona</video:title>
      <video:description>#Bajubiru</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475903/3475903_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:40:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam jago yang menawan</video:title>
      <video:description>#Ayamjago</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475902/3475902_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T18:39:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como os Incas construíram pontes suspensas de corda sobre abismos andinos com tecnologia da antiga</video:title>
      <video:description>Descubra o segredo por trás da engenharia monumental dos Incas e como eles cruzavam abismos mortais séculos antes da invenção do aço. Este vídeo explora a fascinante construção das pontes de corda Qeswachaka, feitas inteiramente de fibras vegetais e reconstruídas à mão anualmente. Analisamos a engenharia têxtil ancestral, a coragem dos métodos de instalação e como a cooperação comunitária garantia a união de um vasto império montanhoso sem o uso de metais. #EngenhariaInca #TecnologiaAntiga #MistériosDaHistória #PovosAncestrais #EngenhariaIncaTecnologiaAntigaMistériosDaHistóriaPovosAncestraisInovaçõesPerdidas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475901/3475901_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-09-21T18:38:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan 42</video:title>
      <video:description>Sangat nikmat ketika berada di pedesaan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475900/3475900_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T18:37:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ellie Elen in Motion: When Every Eye is on Her</video:title>
      <video:description>Feeling the rhythm and letting the music take over! Watch Ellie Elen sway gracefully to the beat, bringing a vibe so captivating that you just can&apos;t look away. Truly a moment where all eyes are locked on her effortless charm. #EllieElen #DancingQueen #AllEyesOnHer #GracefulMovement #FeelTheBeat #AestheticDance #ConfidenceBoost #CaptivatingVibes #DanceReels #TikTokDance #TrendingSong #ElegantDance #MusicLovers #GlowUp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475899/3475899_720p.mp4</video:content_loc>
      <video:duration>428</video:duration>
      <video:publication_date>2026-09-21T18:36:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Papsel Style - Pandang Pertama</video:title>
      <video:description>Thank you for watching and listening to songs from Eastern Indonesia. Don&apos;t forget to keep supporting us and subscribing to our music. Greetings from us, the people of the East. We love you all. #musichip-hop #music-rap #music-slow #music-jazz #music-reggae #music-indonesia #music-rnb #music-pop</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475898/3475898_720p.mp4</video:content_loc>
      <video:duration>202</video:duration>
      <video:publication_date>2026-09-21T18:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Beautiful Bird 2</video:title>
      <video:description>#birdbirdphotographyviralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475897/3475897_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:35:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 16 Hindi dubbed K-drama last episode</video:title>
      <video:description>Lawless lawyer episode 16 Hindi dubbed K-drama season 1 last episode #Lawlesslawyer #episode16 #action #thrill #comedy #Hindidubbed #Lastepisode</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475896/3475896_720p.mp4</video:content_loc>
      <video:duration>3980</video:duration>
      <video:publication_date>2026-09-21T18:35:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>7 GLORIFICANDO O SANTO NOME-MEIMEI</video:title>
      <video:description>mensagem de meimei #espirita #meimei #chicoxavier #mensagem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475895/3475895_720p.mp4</video:content_loc>
      <video:duration>113</video:duration>
      <video:publication_date>2026-09-21T18:34:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The-Lost-World--Jurassic-Park-(1997)</video:title>
      <video:description>The-Lost-World--Jurassic-Park-(1997) hindi dubbed full movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475894/3475894_720p.mp4</video:content_loc>
      <video:duration>7720</video:duration>
      <video:publication_date>2026-09-21T18:34:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Travel 76</video:title>
      <video:description>Travel story to Java in Indonesian #Traveling</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475893/3475893_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T18:33:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tarzan Raja Rimba (1989) | Film Lawas Indonesia | Nostalgia</video:title>
      <video:description>Nikmati kembali “Tarzan Raja Rimba” (1989), film lawas penuh petualangan dan aksi yang membawa suasana khas film Indonesia era 80-an. 🎬 Saksikan sampai selesai dan rasakan kembali nostalgia film klasik Indonesia. ❤️ Jangan lupa Follow untuk mendapatkan lebih banyak film lawas dan film nostalgia lainnya. 🇬🇧 English Description Enjoy “Tarzan Raja Rimba” (1989), a classic Indonesian adventure and action movie with the nostalgic atmosphere of Indonesian cinema from the 1980s. 🎬 Watch until the end and enjoy the classic Indonesian movie experience. ❤️ Follow for more classic Indonesian films and nostalgic movies. #TarzanRajaRimba #TarzanRajaRimba1989 #TarzanRajaRimbaFullMovie #FilmTarzanRajaRimba #FilmLawasIndonesia #FilmIndonesia1989 #FilmIndonesiaKlasik #FilmNostalgia #FilmTahun80an #FilmPetualanganIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475892/3475892_720p.mp4</video:content_loc>
      <video:duration>3978</video:duration>
      <video:publication_date>2026-09-21T18:32:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden bora Rachel matar esses bruxos</video:title>
      <video:description>Ninja Gaiden bora Rachel matar esses bruxos, sofrendo pra caramba #Ninja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475891/3475891_720p.mp4</video:content_loc>
      <video:duration>241</video:duration>
      <video:publication_date>2026-09-21T18:32:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Feed Rescue Cat on Times eating</video:title>
      <video:description>Feed Rescue Cat on Times eating #Cat #rescuecat #eatcat #feedcat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475890/3475890_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:32:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Baby Moments with Daddy 💖👶 | Sweet Family Love Video</video:title>
      <video:description>An adorable baby sharing a happy moment while being held lovingly by her father. This heartwarming family video captures pure joy, innocence, and the beautiful bond between parent and child. Perfect for baby lovers and wholesome content fans. ✨ #cutebaby #babygirl #daddyanddaughter #fatherdaughterbond #familylove #adorablebaby #sweetbabymoments #babysmile #happybaby #cutechild #familyvideo #babyreels #viralbabyvideo #wholesomecontent #littleprincess #parentingmoments #babyshorts #cutefamily #trendingvideo #mashallahbaby</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475889/3475889_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T18:31:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keno Shopno Venge Jay  হৃদয়ছোঁয়া বাংলা বিচ্ছেদের গান | |</video:title>
      <video:description>কেন স্বপ্ন ভেঙে যায়? — একটি হৃদয়ছোঁয়া বাংলা বিচ্ছেদের গান, যেখানে হারিয়ে যাওয়া ভালোবাসা, পুরোনো স্মৃতি, একাকীত্ব এবং ফিরে পাওয়ার আকাঙ্ক্ষার গল্প উঠে এসেছে। কখনো কিছু স্বপ্ন পূরণ হয় না, কিছু মানুষ দূরে চলে যায়, কিন্তু তাদের স্মৃতি থেকে যায় হৃদয়ের গভীরে। এই গানটি সেই হারিয়ে যাওয়া ভালোবাসার অনুভূতি, নীরব অপেক্ষা এবং স্মৃতির পাতায় আটকে থাকা এক সম্পর্কের গল্প। 🎵 Song: কেন স্বপ্ন ভেঙে যায়? 💔 Genre: Bengali Sad Song / Romantic Song 🎧 Mood: Emotional, Melancholic, Heart Touching গানটি ভালো লাগলে Like, Comment, Share এবং Subscribe করতে ভুলবেন না। ❤️ আপনার জীবনে এমন কোনো স্মৃতি আছে, যা আজও ভুলতে পারেননি? কমেন্টে জানাতে পারেন। ধন্যবাদ গানটি শোনার জন্য। ❤️ #কেনস্বপ্নভেঙেযায় #KenoShopnoVengeJay #বাংলাগান #বাংলাস্যাডগান #বাংলাবিচ্ছেদেরগান #বাংলারোমান্টিকগান #sadsongbangla #banglasadsong #bengalisadsong #bengaliromanticsong #banglabreakupsong #banglaemotionalsong #hearttouchingbanglasong #emotionalbanglasong #newbanglasong #newbengalisong #banglalovesong #bengalilovesong #breakupsong #sadromanticsong #emotionalsong #heartbreaksong #banglamusic #bengalimusic #banglasong2026 #স্মৃতিরপাতায় #ভালোবাসারগান #বিরহেরগান #কষ্টেরগান #প্রেমেরগান</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475888/3475888_720p.mp4</video:content_loc>
      <video:duration>294</video:duration>
      <video:publication_date>2026-09-21T18:31:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>girls queen</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475887/3475887_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T18:30:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comedy Brother Bernard</video:title>
      <video:description>Comedy #Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475886/3475886_720p.mp4</video:content_loc>
      <video:duration>184</video:duration>
      <video:publication_date>2026-09-21T18:30:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cozy Bed Vibes &amp; Perfect Nails</video:title>
      <video:description>There is nothing better than a lazy day in bed, especially when your nails look this good! Taking some time to appreciate the little things, like a fresh manicure and a soft blanket. Pure relaxation mode is officially turned on. #NailArt #ManicureGoals #CozyVibes #BedRest #LazyDay #NailInspo #SelfCareRoutine #AestheticMoments #MeTime #FreshNails #BeautifulNails #RelaxingTime #WeekendVibes #GirlThings</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475885/3475885_720p.mp4</video:content_loc>
      <video:duration>206</video:duration>
      <video:publication_date>2026-09-21T18:30:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Can&apos;t Wait for School to End</video:title>
      <video:description>This Gacha Life short video features a pink-haired character who can&apos;t wait to go home from school so they can chat online with their friends. #gachalifeschoollife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475884/3475884_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T18:30:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Baby Girl in Pink Dress 💖 | Mashallah Baby Video</video:title>
      <video:description>A heartwarming video of an adorable baby girl wearing a beautiful pink dress. Her innocent expression and sweet smile make this moment truly special. Perfect for baby lovers and wholesome content fans. ✨👶💕 #babygirl #cutebaby #adorablebaby #mashallahbaby #babysmile #pinkdressbaby #sweetbabyvideo #innocentbaby #viralbabyvideo #cutechild #babyreels #tiktokbaby #babylove #littleprincess #beautifulbaby #newbornbaby #babyshorts #cutemoments #familyvideo #trendingbabyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475883/3475883_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T18:30:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The train runs through the city center</video:title>
      <video:description>Seeing the train #Train #City #Rain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475882/3475882_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:29:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Darah Perjaka (1985) | Full HD | Film Indonesia Klasik</video:title>
      <video:description>Nikmati kembali film Indonesia klasik “Darah Perjaka” (1985) dalam kualitas Full HD. Film lawas dengan nuansa aksi dan drama yang cocok bagi pecinta film Indonesia era 80-an. 🎬 Saksikan sampai selesai dan nikmati nostalgia film Indonesia klasik. ❤️ Jangan lupa Follow untuk mendapatkan lebih banyak film lawas dan film klasik Indonesia. 🇬🇧 English Description Enjoy the classic Indonesian film “Darah Perjaka” (1985) in Full HD. A nostalgic Indonesian movie from the 1980s, perfect for fans of classic Indonesian cinema. 🎬 Watch until the end and enjoy the atmosphere of classic Indonesian movies. ❤️ Follow for more classic Indonesian films and nostalgic movies. #DarahPerjaka #DarahPerjaka1985 #DarahPerjakaFullHD #DarahPerjakaFullMovie #FilmDarahPerjaka #FilmIndonesia1985 #FilmIndonesiaLawas #FilmIndonesiaKlasik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475881/3475881_720p.mp4</video:content_loc>
      <video:duration>5395</video:duration>
      <video:publication_date>2026-09-21T18:29:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagal 2</video:title>
      <video:description>Hiburan #Prancis #Jerman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475880/3475880_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T18:28:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hujan di sore hari 2</video:title>
      <video:description>Suara hujan yang menenangkan di sore #hujan #hujanderas #suarahujan #hujansorehari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475879/3475879_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-09-21T18:28:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>negenm</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475878/3475878_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T18:28:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kembang yang indah</video:title>
      <video:description>#Kembang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475877/3475877_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-21T18:27:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden Rachel ta sofrendo...</video:title>
      <video:description>Ninja Gaiden Rachel ta sofrendo..., para matar esse bruxos #Ninja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475876/3475876_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-21T18:27:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kiyara memon</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475875/3475875_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T18:27:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Golden Eyes Makeup</video:title>
      <video:description>Trendy Party Makeover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475874/3475874_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T18:26:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 14 Hindi dubbed</video:title>
      <video:description>Lawless lawyer episode 14 Hindi dubbed K-drama season 1 #Lawlesslawyer #episode14 #action #thrill #comedy #Hindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475873/3475873_720p.mp4</video:content_loc>
      <video:duration>3879</video:duration>
      <video:publication_date>2026-09-21T18:26:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>90s Super Hit Look</video:title>
      <video:description>Beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475872/3475872_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T18:25:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buat tato</video:title>
      <video:description>#Tato</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475871/3475871_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T18:25:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden morri com Rachel</video:title>
      <video:description>Ninja Gaiden morri com Rachel, ela e braba, mais mesmo assim morri #Ninja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475870/3475870_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-21T18:25:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tapi sapi</video:title>
      <video:description>#Trapisapi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475869/3475869_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T18:25:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tentara wanita seksi</video:title>
      <video:description>#Tetanra</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475868/3475868_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T18:25:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Unwinding After Shift: Spilling the Indomaret Girl&apos;s Energy!</video:title>
      <video:description>Tired of standing all day at the store? It is time to reset the energy with a fun, cheerful dance on my favorite chair! Behind the Indomaret uniform, there is always time to have fun and spread positive vibes. Keep up the spirit, fellow crew and hard workers! #Indomaret #IndomaretGirl #IndomaretCrew #ChairDance #FunDance #IndomaretHits #AfterWorkChill #WorkingGirl #PositiveVibes #TikTokDance #TrendingDance #HappyVibes #RelaxingTime #CuteDance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475867/3475867_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-09-21T18:24:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Betadine Test SCAM? Herbal Cigarette Trick Explained in 30 Seconds!</video:title>
      <video:description>The viral Betadine Pristine water cigarette test is FAKE science! 🤯 They claim it proves the cigarette removes poison, but it&apos;s just a simple chemical reaction anyone can do with Vitamin C. Have you seen this trick before? 👇 Comment what you think! #shortsbetadinetestbetadinepristinewaterrokokliongrokokherbalscamfakemedicalexperimentiodinescienceexperimentviralindonesiafyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475866/3475866_720p.mp4</video:content_loc>
      <video:duration>125</video:duration>
      <video:publication_date>2026-09-21T18:24:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nasi kuning</video:title>
      <video:description>#Nasikuning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475865/3475865_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T18:23:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Makan di tengah sawah</video:title>
      <video:description>#Sawah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475864/3475864_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T18:23:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animo 3</video:title>
      <video:description>Gameplay #Jogos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475863/3475863_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T18:23:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nowshera Peshawar</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475862/3475862_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T18:22:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 15Hindi dubbed K-drama</video:title>
      <video:description>Lawless lawyer episode 15 Hindi dubbed K-drama season 1 #Lawlesslawyer #episode15 #action #thrill #comedy #Hindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475861/3475861_720p.mp4</video:content_loc>
      <video:duration>3912</video:duration>
      <video:publication_date>2026-09-21T18:22:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Song Yogyakarta middle java indonesia country</video:title>
      <video:description>#singsong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475860/3475860_720p.mp4</video:content_loc>
      <video:duration>377</video:duration>
      <video:publication_date>2026-09-21T18:22:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Girl&apos;s Refreshing Time: Unwinding After a Busy Work Shift</video:title>
      <video:description>Taking a short break from the daily grind! Behind her Indomaret uniform, there is always time to express herself with some graceful dance moves on the balcony. Enjoying the cool evening breeze while gathering positive energy for tomorrow. Keep up the spirit, fellow Indomaret crew and hard workers! #Indomaret #IndomaretGirl #CasualDance #HomeBalcony #UnwindingTime #HardWorker #GracefulMovement #PositiveVibes #IndomaretHits #KasirIndomaret #DanceReels #TikTokDance #TrendingDance #BalconyVibes #EveningRoutine #AfterWorkChill #WorkingGirl #PejuangRupiah #AnakIndomaret #AestheticDance #HappyVibes #DailyRoutine #RelaxingTime #CuteDance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475859/3475859_720p.mp4</video:content_loc>
      <video:duration>140</video:duration>
      <video:publication_date>2026-09-21T18:22:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TioFidelHumor</video:title>
      <video:description>Humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475858/3475858_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-09-21T18:22:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Panen terong. Bbuk</video:title>
      <video:description>#Terongungu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475857/3475857_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T18:22:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animo 2</video:title>
      <video:description>#Gameplay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475856/3475856_720p.mp4</video:content_loc>
      <video:duration>166</video:duration>
      <video:publication_date>2026-09-21T18:22:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 30</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475855/3475855_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T18:21:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ice Cream Man 2026 720p WEB-DL ESub</video:title>
      <video:description>An idyllic summer town descends into madness when an ice cream man serves kids sweet delights with horrifying results. Follow and share to show support on this channel so I can upload more movies. #Comedy #Horror #Thriller</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475854/3475854_720p.mp4</video:content_loc>
      <video:duration>5203</video:duration>
      <video:publication_date>2026-09-21T18:21:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Volleyball, tarkam, tarkam cetet</video:title>
      <video:description>Lomba tarkam, volleyball #Tarkam #volleyball #tarkamgayeng</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475853/3475853_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:21:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menyiram sayur mayur</video:title>
      <video:description>#Sayur-sayuran</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475852/3475852_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:21:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kakek jatuh cinta</video:title>
      <video:description>#Kasmaran</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475851/3475851_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-21T18:20:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Danau belembeng mengering</video:title>
      <video:description>Peristiwa mengejutkan tiba tiba danau belembeng mengering dan wargapun tersentak kaget dengan penonena ini. Karena baru kali ini penomena ini terjadi. #Keringnyadanaubelembeng #peristiwadanaubelembeng #ikankekeringan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475850/3475850_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-21T18:20:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Celana robek</video:title>
      <video:description>#Celanarobek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475849/3475849_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T18:19:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Emilykans Style Transformation: Elegant Hijab vs. Stunning Hairstyle</video:title>
      <video:description>One beautiful soul, two completely different vibes from Emilykans! From the pure elegance of her hijab look to the fresh, casual charm of her latest haircut. Which version of Emilykans completely caught your attention? Let me know your favorite in the comments! #Emilykans #GlowUpTransition #HijabStyle #NewHaircut #CasualVibes #OOTDInspiration #StyleTransformation #AestheticMoments</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475848/3475848_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T18:19:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 13 Hindi dubbed K-drama</video:title>
      <video:description>Law less lawyer episode 13 Hindi dubbed K-drama season 1 #Lawlesslawyer #episode13 #action #thrill #comedy #Hindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475847/3475847_720p.mp4</video:content_loc>
      <video:duration>3863</video:duration>
      <video:publication_date>2026-09-21T18:19:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Stray Dog Joins the BBQ Party 😂🐕🔥</video:title>
      <video:description>‎A funny and unexpected moment at an outdoor BBQ! 😂 While everyone is enjoying their food and drinks, this adorable dog suddenly joins the party and casually hangs around the table. 🐕🍢🍻 ‎Sometimes the uninvited guest becomes the most entertaining one! 😆 ‎ #‎FunnyDogDogLifeBBQPartyFunnyAnimalsUnexpectedGuestCuteDogDogLoversViralVideoFunnyMomentAnimalLoversBBQStreetFoodFunnyVideoDogVideoGoodVibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475846/3475846_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T18:19:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anak. Kuda yang lucu</video:title>
      <video:description>#AnakKuda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475845/3475845_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T18:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Susu kambing</video:title>
      <video:description>#Susukambing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475844/3475844_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T18:18:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mrtotka</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475842/3475842_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T18:18:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Memandikan sapi</video:title>
      <video:description>#Sapimandi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475841/3475841_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:18:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just konten, mlbb</video:title>
      <video:description>Video jedagjedug mlbb #jjmlbb #mobilelegedsbang-bang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475840/3475840_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:18:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pawang buaya</video:title>
      <video:description>#Buaya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475839/3475839_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-21T18:17:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hetty Sonjaya - Aku Bukan Hidangan | Lagu Nostalgia Indonesia</video:title>
      <video:description>Nikmati lagu “Aku Bukan Hidangan” yang dibawakan oleh Hetty Sonjaya, sebuah lagu Indonesia bernuansa nostalgia yang cocok untuk para pecinta musik lawas dan lagu-lagu kenangan. 🎧 Dengarkan sampai selesai dan nikmati suasana musik nostalgia Indonesia. ❤️ Jangan lupa Follow untuk mendapatkan lebih banyak lagu lawas, lagu nostalgia, dan musik Indonesia lainnya. 🇬🇧 English Description Enjoy “Aku Bukan Hidangan” performed by Hetty Sonjaya, a nostalgic Indonesian song for lovers of classic Indonesian music and memorable songs. 🎧 Listen until the end and enjoy the nostalgic atmosphere of Indonesian music. ❤️ Follow for more classic songs, nostalgic music, and Indonesian music. #HettySonjaya #AkuBukanHidangan #HettySonjayaAkuBukanHidangan #AkuBukanHidanganHettySonjaya #laguHettySonjaya #musikHettySonjaya #laguIndonesia #musikIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475838/3475838_720p.mp4</video:content_loc>
      <video:duration>344</video:duration>
      <video:publication_date>2026-09-21T18:16:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>halo semuanyah...</video:title>
      <video:description>jangan lupa di like &amp; polow #videovlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475837/3475837_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:16:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hewan yang lucu</video:title>
      <video:description>#Hewanlucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475836/3475836_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T18:16:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You don,t even need to look for the ball....Messi will put it rig</video:title>
      <video:description>You don’t even need to look for the ball… Messi will put it right where you need it. 🤯🐐⚽ Lionel Messi’s incredible vision and passing ability make this assist look effortless. 🎯🔥 The timing, accuracy and awareness are exactly why Messi is considered one of the greatest playmakers in football history. Pure football intelligence. Pure Messi magic. 🪄🐐 🔥 Watch till the end and appreciate this unbelievable pass! 👇 Rate Messi’s vision from 1–10. #Messi #LionelMessi #MessiAssist #MessiPassing #MessiVision #MessiSkills #Football #Soccer #FootballSkills #FootballReels #SoccerReels #FootballFans #GOAT #ViralFootball #FYP</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475835/3475835_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T18:16:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Game, mobalegends</video:title>
      <video:description>push season, akhir season #pushrank #awalmusim</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475834/3475834_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um dia seremos lembrados</video:title>
      <video:description>Viva o kuduro, Angola 🇦🇴 #Viagem #parís #França #Portugal #Inglaterra #Moçambique</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475833/3475833_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-21T18:15:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ocean Shadow Was MUCH Bigger Than Expected 😳🌊</video:title>
      <video:description>A mysterious shadow appears during an underwater dive… then a giant manta ray suddenly comes into view. A realistic ocean encounter captured from the diver’s perspective. 🤿🌊 #mantaray #underwater #oceanwildlife #marinelife #scubadiving #diving #oceanexploration #giantmantaray #wildlifeencounter #underwaterfootage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475832/3475832_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:15:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How I Built AI Agents That Communicate</video:title>
      <video:description>This is a glimpse into how AI agents can collaborate—and what the future of intelligent systems might look like. #AIAgent</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475831/3475831_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-09-21T18:15:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>queen tiktok 2</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475830/3475830_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T18:14:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nature tells everything 😉</video:title>
      <video:description>Feel everything in your life ❤️ #Refreshing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475829/3475829_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T18:14:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rio as moscas</video:title>
      <video:description>Criminosos do luladrao , O Sósia . #RJ #cidade #rio #ladrões #bagunça #destruição</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475828/3475828_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T18:14:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trump is SICK AND TIRED of HEGSETH !</video:title>
      <video:description>Trump is SICK AND TIRED of HEGSETH !Trump #TrumpisSICKANDTIREDofHEGSETH</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475827/3475827_720p.mp4</video:content_loc>
      <video:duration>802</video:duration>
      <video:publication_date>2026-09-21T18:14:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JANJI - Nurtita Fadilah | Rita Sugiarto Cover | Akustik Version</video:title>
      <video:description>Nikmati lagu “Janji” yang dibawakan oleh Nurtita Fadilah dalam versi cover akustik, dengan lagu yang dikenal dari Rita Sugiarto. Aransemen akustik memberikan nuansa sederhana, hangat, dan cocok untuk menemani waktu santai maupun mengenang lagu-lagu dangdut Indonesia. 🎧 Dengarkan sampai selesai dan nikmati alunan musiknya. ❤️ Jangan lupa Follow untuk mendapatkan lebih banyak lagu cover, musik akustik, lagu nostalgia, dan musik Indonesia lainnya. 🇬🇧 English Description Enjoy “Janji” performed by Nurtita Fadilah in an acoustic cover version, inspired by the well-known song associated with Rita Sugiarto. Relax and enjoy this simple and warm acoustic performance. ❤️ Follow for more Indonesian music, acoustic covers, nostalgic songs, and classic dangdut music. #Janji #NurtitaFadilah #RitaSugiarto #NurtitaFadilahJanji #JanjiNurtitaFadilah #JanjiRitaSugiarto #RitaSugiartoCover #NurtitaFadilahCover #JanjiAcoustic #JanjiAkustik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475826/3475826_720p.mp4</video:content_loc>
      <video:duration>296</video:duration>
      <video:publication_date>2026-09-21T18:13:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to Create This Viral 11:11 Photo Edit</video:title>
      <video:description>How to Create This Viral 11:11 Photo Edit? 👀✨ Full A–Z AI photo editing tutorial is in this reel! 🤯 Watch till the end &amp; create your own 11:11 aesthetic edit ❤️ Comment&quot; 11 aesthetic&quot; 💾 Save it • 🔄 Share it • Follow for more AI edits! #ChatGPT #ChatGPTPrompt #AestheticPhoto #AIPhoto #AIPhotoEditing #AIPrompt #SecretPrompt #CinematicPhoto #PhotoEditing #AITools #AITricks #ViralAI #InstagramTrend #InstagramTips #PhotoTips #ChatGPTTips #radtechimam ChatGPT aesthetic photo prompt, ChatGPT secret prompt, viral aesthetic photo, AI photo editing, ChatGPT photo editing, cinematic photo prompt, AI image prompt, aesthetic photo editing, Instagram viral photo, ChatGPT image generation, AI photo transformation, viral AI tools, ChatGPT tricks, secret AI prompt, cinematic portrait prompt #ChatGPTaestheticphotoprompt #ChatGPTsecretprompt #viralaestheticphoto #AIphotoediting #ChatGPTphotoediting #cinematicphotoprompt #AIimageprompt #aestheticphotoediting #Instagramviralphoto #ChatGPTimagegeneration #AIphototransformation #viralAItools #ChatGPTtricks #secretAIprompt #cinematicportraitprompt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475825/3475825_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T18:13:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>makah shareef 2</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475824/3475824_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T18:13:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 60</video:title>
      <video:description>Compositora Bruna Rafaela de França #CompositoraBrunaRafaeladeFrança</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475823/3475823_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-21T18:12:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jamal Mirdad - Cinta Anak Kampung | Remastered Audio</video:title>
      <video:description>Nikmati lagu “Cinta Anak Kampung” dari Jamal Mirdad dalam versi Remastered Audio. Lagu bernuansa nostalgia yang menghadirkan suasana khas musik Indonesia dan cocok untuk para penggemar lagu-lagu lawas. Mari bernostalgia bersama Jamal Mirdad dan menikmati kembali lagu yang penuh kenangan ini. 🎶❤️ Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu nostalgia, musik Indonesia, lagu lawas, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Cinta Anak Kampung” by Jamal Mirdad in this Remastered Audio version. A nostalgic Indonesian song that brings back the atmosphere of classic Indonesian music. Take a nostalgic journey with Jamal Mirdad and enjoy this memorable Indonesian song. 🎵❤️ Don&apos;t forget to Follow for more classic songs, Indonesian music, nostalgic hits, and entertainment. #JamalMirdad #CintaAnakKampung #JamalMirdadCintaAnakKampung #CintaAnakKampungJamalMirdad #RemasteredAudio #JamalMirdadSongs #laguJamalMirdad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475822/3475822_720p.mp4</video:content_loc>
      <video:duration>266</video:duration>
      <video:publication_date>2026-09-21T18:10:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Please watch the dishes while washing the dishes</video:title>
      <video:description>While washing, suddenly the husband came and immediately turned on the gas. #Travel #washingdishes #women #men #mothers #noisy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475821/3475821_720p.mp4</video:content_loc>
      <video:duration>211</video:duration>
      <video:publication_date>2026-09-21T18:10:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemanasan, volleyball</video:title>
      <video:description>Latian smash, voli tarkam, voli indonesia #Voley #olahraga #tarkam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475820/3475820_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T18:10:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AKHE HE NAM MERI</video:title>
      <video:description>AKHE HE NAM MERI #AKHEHENAMMERI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475819/3475819_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T18:10:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NAME HAI TERA TERA.</video:title>
      <video:description>NAME HAI TERA TERA. #NAMEHAITERATERA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475818/3475818_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T18:09:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bljr bersama</video:title>
      <video:description>#anakfrineds</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475817/3475817_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:08:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Itje Trisnawati - Duh Engkang | Lagu Dangdut Nostalgia</video:title>
      <video:description>Nikmati lagu “Duh Engkang” yang dibawakan oleh Itje Trisnawati, salah satu penyanyi yang dikenal dalam dunia musik dangdut Indonesia. Lagu ini menghadirkan nuansa dangdut nostalgia yang cocok untuk para penggemar musik Indonesia dan lagu-lagu lawas. Yuk bernostalgia bersama Itje Trisnawati dan nikmati alunan musik dangdut yang khas. 🎶❤️ Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu dangdut, lagu nostalgia, musik Indonesia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Duh Engkang” performed by Itje Trisnawati, a nostalgic Indonesian dangdut song perfect for fans of classic Indonesian music. Take a nostalgic journey with Itje Trisnawati and enjoy the distinctive sound of Indonesian dangdut music. 🎵❤️ Don&apos;t forget to Follow for more Indonesian songs, classic dangdut music, nostalgic songs, and entertainment. #ItjeTrisnawati #DuhEngkang #ItjeTrisnawatiDuhEngkang #DuhEngkangItjeTrisnawati #laguItjeTrisnawati #musikItjeTrisnawati #lagudangdut #musikdangdut #dangdutnostalgia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475816/3475816_720p.mp4</video:content_loc>
      <video:duration>345</video:duration>
      <video:publication_date>2026-09-21T18:08:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 12 Hindi dubbed</video:title>
      <video:description>Lawless lawyer episode 12 Hindi dubbed K-drama season 1 #Action #Crime #Romance #Legal #K-dramaHindidubbed #lawlesslawyer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475815/3475815_720p.mp4</video:content_loc>
      <video:duration>3874</video:duration>
      <video:publication_date>2026-09-21T18:08:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Game mobalegeds</video:title>
      <video:description>Game online mobalegends #Game #ml #socialmedia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475814/3475814_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T18:08:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BUKTI KEBENARAN AL-QUR&apos;AN YANG  AKAN MUNCUL DI TAHUN INI DAN  DI TAHUN YANG AKAN DATANG.   ALLAHU A&apos;</video:title>
      <video:description>assalamu&apos;alaikum warahmatullahi wabarakatuh BUKTI KEBENARAN AL-QUR&apos;AN YANG AKAN MUNCUL DI TAHUN INI DAN DI TAHUN YANG AKAN DATANG. ALLAHU A&apos;LAM Surah Sad ayat 86–88 merupakan penutup yang sangat berkesan dari surah ini. Bagian ini mengabadikan ketegasan, ketulusan, serta pesan abadi Nabi Muhammad SAW kepada umat manusia setelah menyampaikan berbagai kisah para nabi dan peringatan akhirat. ​Teks dan Terjemahan Ayat ​قُلْ مَآ أَسْـَٔلُكُمْ عَلَيْهِ مِنْ أَجْرٍ وَمَآ أَنَا۠ مِنَ ٱلْمُتَكَلِّفِينَ &quot;Katakanlah (wahai Muhammad), &apos;Aku tidak meminta imbalan apa pun kepadamu atas seruan ini dan aku bukanlah termasuk orang-orang yang mengada-ada.&apos;&quot; (QS. Sad: 86) ​إِنْ هُوَ إِلَّا ذِكْرٌ لِّلْعَٰلَمِينَ &quot;Al-Qur&apos;an ini tidak lain hanyalah peringatan bagi seluruh alam.&quot; (QS. Sad: 87) ​وَلَتَعْلَمُنَّ نَبَأَهُۥ بَعْدَ حِينٍۭ &quot;Dan sungguh, kamu akan mengetahui (kebenaran) beritanya setelah beberapa waktu lagi.&quot; (QS. Sad: 88) ​Makna Mendalam dan Sisi Emosional Ayat. ​1. Ketulusan Tanpa Beban dari Seorang Utusan. Di ayat 86, terlukis ketulusan jiwa yang amat bersih dari Nabi Muhammad SAW. Beliau berjuang siang dan malam, dimusuhi, dihina, dan ditolak, namun beliau menegaskan tidak pernah meminta imbalan materi, takhta, atau penghormatan sedikit pun. Beliau juga menegaskan bahwa wahyu ini bukan rekaan yang dipaksakan. Ada kepasrahan dan kejujuran yang begitu menyentuh: seorang penyeru kebaikan yang hanya peduli pada keselamatan kaumnya tanpa mengharapkan keuntungan pribadi sama sekali. ​2. Pelukan Kasih Sayang untuk Seluruh Alam. Ayat 87 mengingatkan kita bahwa pesan Al-Qur&apos;an tidak hadir untuk menyusahkan atau membatasi manusia, melainkan sebagai dzikr—sebuah peringatan dan penawar dahaga bagi jiwa yang bingung. Al-Qur&apos;an ditujukan untuk al-&apos;alamin (seluruh alam), tanpa memandang stat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475813/3475813_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T18:07:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice song 245</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475812/3475812_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T18:07:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A degree hotter</video:title>
      <video:description>My elder sister just signed out of the university and she made us so proud #Graduate</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475811/3475811_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T18:07:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MOTIVASI LUCU: JANGAN TAKUT GAGAL, YANG PENTING JANGAN GAGAL BANGUN! 😂🔥</video:title>
      <video:description>MOTIVASI LUCU: JANGAN TAKUT GAGAL, YANG PENTING JANGAN GAGAL BANGUN! 😂🔥 Kadang hidup memang penuh tantangan, tapi jangan terlalu serius… yang penting tetap semangat dan terus melangkah! 😹💪 Semoga video ini bisa bikin kamu tersenyum sekaligus termotivasi. 👉 Jangan lupa Like, Subscribe, dan bagikan ke temanmu! ❤️ #Motivasi #motivasilucu #katakatabijak #motivasihidup #aividio #animasikucing #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475810/3475810_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T18:07:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AMALAN DOA AGAR DI SEMBUHKAN  DARI SEGALA MACAM PENYAKIT.   DOA NABI AYYUB AS.</video:title>
      <video:description>assalamu&apos;alaikum warahmatullahi wabarakatuh AMALAN DOA AGAR DI SEMBUHKAN DARI SEGALA MACAM PENYAKIT. DOA NABI AYYUB AS. Surah Sad ayat 41–42 mengabadikan momen paling mengharukan dalam hidup Nabi Ayyub &apos;alaihissalam, sebuah titik balik ketika jeritan kesabaran bertahun-tahun akhirnya dijawab langsung oleh Allah SWT. ​Teks dan Terjemahan Ayat ​وَٱذْكُرْ عَبْدَنَآ أَيُّوبَ إِذْ نَادَىٰ رَبَّهُۥٓ أَنِّى مَسَّنِىَ ٱلشَّيْطَٰنُ بِنُصْبٍ وَعَذَابٍ &quot;Dan ingatlah akan hamba Kami Ayyub ketika dia menyeru Tuhannya, &apos;Sesungguhnya aku diganggu setan dengan penderitaan dan siksaan.&apos;&quot; (QS. Sad: 41) ​ٱرْكُضْ بِرِجْلِكَ ۖ هَٰذَا مُغْتَسَلٌۢ بَارِدٌ وَشَرَابٌ &quot;(Allah berfirman), &apos;Hentakkanlah kakimu; inilah air yang sejuk untuk mandi dan untuk minum.&apos;&quot; (QS. Sad: 42) ​Makna Mendalam dan Sisi Emosional Ayat ​1. Kelembutan Bahasa seorang Hamba yang Terluka Bayangkan seseorang yang kehilangan seluruh harta bendanya, ditinggalkan oleh orang-orang terdekatnya, dan didera penyakit berat selama bertahun-tahun. Namun, ketika Nabi Ayyub berdoa, beliau tidak mengeluhkan takdir Allah. Beliau tidak menyalahkan Sang Pencipta atas rasa sakitnya. Dengan kelembutan dan adab yang begitu tinggi, beliau hanya mengadu bahwa bisikan dan cobaan itu terasa begitu berat. Ada kepasrahan yang luar biasa dalam kalimat kepasrahannya: sebuah pengakuan betapa rapuhnya manusia di hadapan ujian, namun tetap memegang teguh prasangka baik kepada Allah. ​2. Jawaban Allah yang Begitu Sederhana namun Penuh Kasih. Setelah masa-masa panjang penuh air mata dan rasa sakit yang seolah tak ada ujungnya, Allah tidak memberikan perintah yang rumit. Pertolongan Allah datang lewat firman yang sangat menenangkan: &quot;Hentakkanlah kakimu...&quot; ​Seketika itu juga, dari pijakan kaki yang lemah, muncul mata air yang sejuk. Air itu menjadi pen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475809/3475809_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T18:07:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nothing else love is you</video:title>
      <video:description>jazzy music #songsing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475808/3475808_720p.mp4</video:content_loc>
      <video:duration>308</video:duration>
      <video:publication_date>2026-09-21T18:06:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The blue wishper 14</video:title>
      <video:description>✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475807/3475807_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T18:06:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ikhlas - Nurtita Fadilah | Akustik Version | Rita Sugiarto Cover</video:title>
      <video:description>Nikmati lagu “Ikhlas” yang dikenal melalui Rita Sugiarto, dibawakan dalam versi akustik oleh Nurtita Fadilah. Aransemen akustik memberikan nuansa yang lebih sederhana, lembut, dan penuh perasaan. Cocok untuk menemani waktu santai, bernostalgia, dan menikmati lagu Indonesia dengan sentuhan musik akustik. 🎶❤️ Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu, cover akustik, video musik, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Ikhlas”, a song associated with Rita Sugiarto, performed by Nurtita Fadilah in an acoustic version. The acoustic arrangement creates a warm, simple, and heartfelt atmosphere. Perfect for relaxing, reminiscing, and enjoying Indonesian music with an acoustic touch. 🎵❤️ Don&apos;t forget to Follow for more songs, acoustic covers, music videos, and entertainment. #Ikhlas #NurtitaFadilah #RitaSugiarto #NurtitaFadilahIkhlas #IkhlasRitaSugiarto #RitaSugiartoCover #NurtitaFadilahCover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475806/3475806_720p.mp4</video:content_loc>
      <video:duration>314</video:duration>
      <video:publication_date>2026-09-21T18:06:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wonderful indonesia cinematic</video:title>
      <video:description>Amazing 🫶🏻 #Fyp #cinematic #indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475804/3475804_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T18:06:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TWO STRANGERS, One CURIOUS ENCOUNTER”</video:title>
      <video:description>Two adorable dogs meet on a quiet park walkway at night, sharing a curious and playful moment under the palm trees and evening lights. A simple, heartwarming encounter that shows how dogs can make friends anywhere. 🐾❤️ #‎DogsCuteDogsDogFriendsDogMeetingDogLoversFunnyDogsAdorableDogsDogLifePetLoversAnimalLoversCuteAnimalsDogVideoViralDogsDogsOfInstagramPuppyLove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475803/3475803_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T18:05:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful green nature🌿🌴 #beautiful  #Nature #Cold</video:title>
      <video:description>MERDU di iringi lagu music Khas sumsel #Sumsel #pemandanganalam #sawah #gunung #nature #relaxing #suasanaalam #healing #calmmusic #natureview #pedesaan #pemandanganalamsawahgunungnaturerelaxingsuasanaalamhealingcalmmusicnatureviewpedesaanalamindahrelaxpeacefulgreenlandscapeindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475802/3475802_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T18:05:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Candidatos no São paulo para presidência</video:title>
      <video:description>🔴⚪⚫ GIOVANI GIAMPAOLI TRICOLOR | SÃO PAULO FC Aqui você acompanha notícias, informações, bastidores, análises e tudo sobre o São Paulo Futebol Clube! 🇾🇪 ⚽ São Paulo FC 🔥 Notícias e bastidores 🏆 Jogos e competições 📢 Opinião e análises 🎙️ Reações e comentários sobre o Tricolor 👉 Siga o perfil e acompanhe os próximos vídeos! #SãoPauloFC #SãoPaulo #SPFC #TricolorPaulista #SãoPauloFutebolClube #notíciasdoSãoPaulo #notíciasSPFC #SãoPaulohoje #SãoPaulonotícias #torcidadoSãoPaulo #torcedorsão-paulino #futebolbrasileiro #futebol #CampeonatoBrasileiro #Brasileirão #CopaSul-Americana #Morumbi #GiovaniGiampaoliTricolor #GiovaniGiampaoli #Tricolor #bastidoresdoSãoPaulo #mercadodabolaSãoPaulo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475801/3475801_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T18:05:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eclipse mitsubisi</video:title>
      <video:description>Sinematic sport car #JDM #SPORTCAR #SINEMATIC</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475800/3475800_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T18:05:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WarrrrGiant Fantasy Snail 🐌 Watching Over a Glowing City at Sunset</video:title>
      <video:description>Experience a surreal and peaceful fantasy world where a giant snail watches over a glowing city at sunset. 🐌🌇 The warm golden sky, flying birds, and calm atmosphere create a relaxing and dreamlike scene perfect for unwinding and enjoying nature-inspired visuals. 🌅 Beautiful sunset colors 🐦 Peaceful flying birds 🌇 Calm and magical city lights Sit back, relax, and enjoy this unique fantasy moment. Don’t forget to like, share, and subscribe for more relaxing visuals.#fantasy #giantsnail #sunset #citylights #relaxing #surreal #landscape #aesthetic #peaceful #nature #fantasygiantsnailsunsetcitylightsrelaxingsurreallandscapeaestheticpeacefulnaturedreamscapeambientbeautifulviewviralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475799/3475799_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T18:04:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lonely and emptyness</video:title>
      <video:description>Song for the single fighter in love 😂 never works #US #CA #UK #BR #EUROPE #FR #RU #ASIA #CN #ID #INA #MAS #LATINAMERICA #SA #AFRICA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475798/3475798_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-21T18:04:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>বাজারে সৌন্দর্য আলো</video:title>
      <video:description>বাজারে সৌন্দর্য আলো</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475797/3475797_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T18:03:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Sunrise Over Mountain Peaks Above a Sea of Clouds</video:title>
      <video:description>Cinematic sunrise over majestic mountain peaks surrounded by a sea of clouds and mist, with warm golden sunlight illuminating the landscape. Peaceful natural scenery suitable for travel, nature, landscape, background, and inspirational content. #sunrise #mountain #mountains #seaofclouds #clouds #mist #fog #mountainpeaks #landscape #nature #goldensunrise #morning #dawn #sunriselandscape #scenic #beautifulnature #mountainlandscape #sky #sunlight #goldenlight #peaceful #tranquil #majestic #wilderness #outdoor #travel #adventure #panorama #scenery #atmospheric #horizon #valley #highland #serene #naturalbackground #cinematic #dramaticsky #tourism #environment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475796/3475796_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T18:03:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>If you were asked to choose, which one would you choose?</video:title>
      <video:description>If you had to choose, which one would you pick? 👀 Right or left? Let us know your choice in the comments. 🔥 Don&apos;t forget to subscribe for more trending videos and top picks! #ShortsTrendingViralChooseOne</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475794/3475794_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T18:02:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinematic sunset in balikpapan</video:title>
      <video:description>Sunset in kalimantan #Cinematic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475793/3475793_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T18:02:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dream League Soccer 2026 Gameplay ⚽ | Hull FC vs MTN FC – Division 4 Match</video:title>
      <video:description>Enjoy an exciting football match in Dream League Soccer! ⚽🔥 Watch Hull FC take on MTN FC in this Division 4 gameplay. Experience the action, passing, attacking moves, and thrilling moments as both teams battle for victory on the pitch. If you enjoy football games and mobile soccer gameplay, don&apos;t forget to LIKE 👍, SHARE 📲, and FOLLOW for more exciting gaming videos! 🎮 Game: Dream League Soccer (DLS) ⚽ Match: Hull FC vs MTN FC 🏆 Division: 4 📱 Platform: Mobile Gameplay Thanks for watching! #dreamleaguesoccer #dreamleaguesoccer2026 #DLS2026gameplay #DLSgameplay #HullFCvsMTNFC #footballgameplay #soccergameplay #mobilefootballgame #mobilegaming #DLSdivision4 #footballmobilegame #soccergame2026 #DreamLeagueSoccermatch #Androidfootballgame #Febspotgaming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475792/3475792_720p.mp4</video:content_loc>
      <video:duration>344</video:duration>
      <video:publication_date>2026-09-21T18:02:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Permainan anak anak</video:title>
      <video:description>Bermain di didalam ruangan anak anak #Bermainhiburanbersama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475791/3475791_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T18:02:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Silet Open Up</video:title>
      <video:description>#singsong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475790/3475790_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-09-21T18:02:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The U.p.risin.g 2026</video:title>
      <video:description>The Uprising 2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475789/3475789_720p.mp4</video:content_loc>
      <video:duration>7440</video:duration>
      <video:publication_date>2026-09-21T18:01:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Har Dil Jo Pyar Karega | Salman Khan &amp; Rani Mukerji | Udit Narayan &amp; Alka Yagnik</video:title>
      <video:description>Nikmati lagu romantis “Har Dil Jo Pyar Karega” dari film Bollywood Har Dil Jo Pyar Karega (2000), yang dibintangi Salman Khan dan Rani Mukerji. Lagu ini menghadirkan nuansa romantis khas Bollywood dengan vokal Udit Narayan dan Alka Yagnik. ❤️🎶 Cocok untuk para penggemar Salman Khan, Rani Mukerji, lagu Hindi, musik Bollywood, dan lagu-lagu nostalgia era 90-an hingga awal 2000-an. Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu Bollywood, lagu Hindi, musik nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy the romantic Bollywood song “Har Dil Jo Pyar Karega” from the movie Har Dil Jo Pyar Karega (2000), featuring Salman Khan and Rani Mukerji. The song features beautiful vocals by Udit Narayan and Alka Yagnik, bringing the classic Bollywood romantic atmosphere to life. ❤️🎵 Perfect for fans of Salman Khan, Rani Mukerji, Bollywood music, Hindi songs, and nostalgic hits from the 1990s and early 2000s. Don&apos;t forget to Follow for more Bollywood songs, Hindi music, nostalgic hits, and entertainment. #HarDilJoPyarKarega #HarDilJoPyarKaregaSong #SalmanKhan #RaniMukerji #UditNarayan #AlkaYagnik #BollywoodSongs #HindiSongs #BollywoodMusic #HindiMovieSongs #RomanticBollywood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475788/3475788_720p.mp4</video:content_loc>
      <video:duration>333</video:duration>
      <video:publication_date>2026-09-21T18:01:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pretty woman 5</video:title>
      <video:description>Pretty woman singing and dancing #Singing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475787/3475787_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T18:01:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 114</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475786/3475786_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-09-21T18:00:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Giant Fantasy Snail 🐌 Watching Over a Glowing City at Sunset</video:title>
      <video:description>#KidsCartoonKidsVideoLearningForKidsFunForKidsCuteCartoonFamilyFriendlyKidsContentChildrenVideosCartoonForKidsHappyKids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475785/3475785_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T17:59:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 113</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475784/3475784_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-09-21T17:59:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 112</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475783/3475783_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-21T17:59:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MERDU di iringi lagu music Khas sumsel #Sumsel</video:title>
      <video:description>Beautiful Rice Field &amp; Mountain View 🌤️ Relaxing Nature Scenery #nature #relaxing #natureview #landscape #peaceful #countryside #mountains #greenery #relaxation #calm #naturelovers #scenery #beautifulnature #ambient #healing#fantasy #giantsnail #sunset #citylights #relaxing #surreal #landscape #aesthetic #peaceful #nature #fantasygiantsnailsunsetcitylightsrelaxingsurreallandscapeaestheticpeacefulnaturedreamscapeambientbeautifulviewviralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475782/3475782_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T17:59:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475781</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475781/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 111</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475781/3475781_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-21T17:59:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475780</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475780/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 110</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475780/3475780_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-21T17:58:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Too Late</video:title>
      <video:description>#makassarindonesiacountry</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475779/3475779_720p.mp4</video:content_loc>
      <video:duration>746</video:duration>
      <video:publication_date>2026-09-21T17:58:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MSNBC gives Trump the TERRIBLE NEWS he DESERVES !?</video:title>
      <video:description>MSNBC gives Trump the TERRIBLE NEWS he DESERVES !? #MSNBCgivesTrumptheTERRIBLENEWSheDESERVES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475778/3475778_720p.mp4</video:content_loc>
      <video:duration>836</video:duration>
      <video:publication_date>2026-09-21T17:58:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 109</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475777/3475777_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-21T17:58:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novidades no loja</video:title>
      <video:description>Tudo na loja, comprei já 🇧🇷🇧🇷👇👇https://collshp.com/ofertasdescontao?view=storefront #Loja #roupas #blusas #eletrônicos #novidades #cama #mesa #banho #vestuário</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475776/3475776_720p.mp4</video:content_loc>
      <video:duration>398</video:duration>
      <video:publication_date>2026-09-21T17:58:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 108</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475775/3475775_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-21T17:58:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 107</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475774/3475774_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-21T17:57:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 106</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475773/3475773_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-21T17:57:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dil To Pagal Hai | Shah Rukh Khan, Madhuri Dixit &amp; Karisma Kapoor | Lata Mangeshkar, Udit Narayan</video:title>
      <video:description>Nikmati lagu “Dil To Pagal Hai” dari film Bollywood Dil To Pagal Hai yang dibintangi Shah Rukh Khan, Madhuri Dixit, dan Karisma Kapoor. Lagu ini menghadirkan nuansa romantis khas Bollywood dengan vokal Lata Mangeshkar dan Udit Narayan. ❤️🎶 Salah satu lagu yang cocok untuk para penggemar Shah Rukh Khan, Madhuri Dixit, Karisma Kapoor, musik Hindi, dan nostalgia film Bollywood. Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu Bollywood, lagu Hindi, musik nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy the classic Bollywood song “Dil To Pagal Hai” featuring Shah Rukh Khan, Madhuri Dixit, and Karisma Kapoor, with vocals by Lata Mangeshkar and Udit Narayan. A romantic Hindi song with the timeless atmosphere of Bollywood cinema. ❤️🎵 Perfect for fans of Shah Rukh Khan, Madhuri Dixit, Karisma Kapoor, Hindi music, and classic Bollywood nostalgia. Don&apos;t forget to Follow for more Bollywood songs, Hindi music, nostalgic hits, and entertainment. #DilToPagalHai #DilToPagalHaiSong #ShahRukhKhan #MadhuriDixit #KarismaKapoor #AkshayKumar #LataMangeshkar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475772/3475772_720p.mp4</video:content_loc>
      <video:duration>347</video:duration>
      <video:publication_date>2026-09-21T17:57:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475771</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475771/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 105</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475771/3475771_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-21T17:57:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stadion gelora bung Karno</video:title>
      <video:description>Menonton pertandingan timnas indonesia vs Cambodia piala aff #Olahragasepakbollastadion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475770/3475770_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T17:56:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 104</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475769/3475769_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-21T17:56:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 103</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475767/3475767_720p.mp4</video:content_loc>
      <video:duration>135</video:duration>
      <video:publication_date>2026-09-21T17:56:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Voice of Baceprot</video:title>
      <video:description>#TransMusicalesdeRennes2021Rockers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475766/3475766_720p.mp4</video:content_loc>
      <video:duration>315</video:duration>
      <video:publication_date>2026-09-21T17:56:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 102</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475764/3475764_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-21T17:55:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>In 2009, Bitcoin First Appeared, Created By A Figure Named Satoshi Nakamoto</video:title>
      <video:description>Bitcoin Was Launched Not To Replace Fiat, But Against Global Inflation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475763/3475763_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T17:55:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 101</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475762/3475762_720p.mp4</video:content_loc>
      <video:duration>114</video:duration>
      <video:publication_date>2026-09-21T17:55:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 100</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475761/3475761_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-09-21T17:54:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 99</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475759/3475759_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-21T17:54:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dil Laga Liya Maine - Dil Hai Tumhaara (2002) | Bollywood Hits</video:title>
      <video:description>Nikmati lagu romantis “Dil Laga Liya Maine” dari film Bollywood Dil Hai Tumhaara (2002). Lagu ini menghadirkan suasana cinta yang indah dengan melodi khas Bollywood dan menjadi salah satu lagu romantis yang dikenang dari era film Hindi awal 2000-an. ❤️🎶 Cocok untuk para penggemar Bollywood, lagu Hindi, musik romantis, dan nostalgia film India. Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu Bollywood, lagu India, musik nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy the romantic Bollywood song “Dil Laga Liya Maine” from the movie Dil Hai Tumhaara (2002). Featuring a beautiful melody and classic Bollywood romantic atmosphere, this song brings back the nostalgic feeling of early 2000s Hindi cinema. ❤️🎵 Perfect for fans of Bollywood songs, Hindi music, romantic songs, and Indian movie nostalgia. Don&apos;t forget to Follow for more Bollywood songs, Hindi music, nostalgic hits, and entertainment. #DilLagaLiyaMaine #DilLagaLiya #DilHaiTumhaara #DilHaiTumhaara2002 #DilLagaLiyaMaineTumsePyaarKarke</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475758/3475758_720p.mp4</video:content_loc>
      <video:duration>255</video:duration>
      <video:publication_date>2026-09-21T17:54:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 98</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475757/3475757_720p.mp4</video:content_loc>
      <video:duration>89</video:duration>
      <video:publication_date>2026-09-21T17:53:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skin disease at Puncak Jaya Mulia Papua</video:title>
      <video:description>Please provide assistance to cure this skin disease in the Papua region, especially in Puncak Jaya, Indonesia. #Disease #skin #people #suffering #help</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475756/3475756_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T17:53:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pão Caseiro Fofinho e Rico em Fibras</video:title>
      <video:description>Sem Salvar a Dieta!Pão incrivelmente fofinho, leve e cheio de sabor sem fugir da dieta? Esta receita é perfeita para incluir na sua rotina diária! Feito no liquidificador com farelo de aveia, iogurte e um toque especial de chimichurri, este pão vai conquistar o seu pequeno-almoço ou lanche da tarde. #Southkorea #taiwan #vietnam #brazil #italy #china #unitedstates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475755/3475755_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-21T17:53:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 97</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475754/3475754_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-21T17:53:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Use this flyer and create and introduction video and make it look great. use all the wording and the</video:title>
      <video:description>Use this flyer and create and introduction video and make it look great. use all the wording and the image. Use #UsethisflyerandcreateandintroductionvideoandmakeitlookgreatuseallthewordingandtheimageUse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475753/3475753_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T17:53:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 11 Hindi dubbed K-drama</video:title>
      <video:description>Lawless lawyer episode 11 Hindi dubbed K-drama season 1 #Action #Crime #Romance #Legal #K-dramaHindidubbed #lawlesslawyer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475752/3475752_720p.mp4</video:content_loc>
      <video:duration>3956</video:duration>
      <video:publication_date>2026-09-21T17:53:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Traditional Sundanese Cooking in The Rice Field - Simple But So Delicious!</video:title>
      <video:description>This is authentic Sundanese village food! Cooking fresh vegetables, fried fish, and sambal right next to the rice paddy where the ingredients come from. Cooked on a traditional tungku with firewood, inside a small hut called &quot;saung sawah&quot;. This is the original farm-to-table experience. What dish do you want me to cook next? #sundanesefoodindonesianstreetfoodmakanandesamasakdisawahsaungsawahauthenticfoodvillagefood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475751/3475751_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T17:53:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 96</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475750/3475750_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-21T17:53:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>She is my favorite. 🖤🏍️🔥</video:title>
      <video:description>There’s something special about the sound, the style, and the feeling of riding a Yamaha superbike. Pure adrenaline, freedom, and biker life! 🏁🖤 Would you choose this one for your next ride? 👀🔥 #yamaha #yamahamotorcycle #yamahasuperbike #motorcycle #biker #superbike #bikerlife #bikersoftiktok #sportbike #motorcyclelife #bikelife #bikergirl #motorcyclerider #motorcyclelovers #moto #motos #riding #rider #bikevibes #motovibes #supermoto #streetbike #racingbike #performancebike #motorcyclevideo #bikevideo #viral #trending #fyp #tiktok #mototiktok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475749/3475749_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:52:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 95</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475748/3475748_720p.mp4</video:content_loc>
      <video:duration>466</video:duration>
      <video:publication_date>2026-09-21T17:52:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Can you make a video of this girl doing a tik Tok dance to Michael Jackson’s song Beat It Use [img1]</video:title>
      <video:description>Can you make a video of this girl doing a tik Tok dance to Michael Jackson’s song Beat It Use [img1], #CanyoumakeavideoofthisgirldoingatikTokdancetoMichaelJackson’ssongBeatItUseimg1</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475747/3475747_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T17:52:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 94</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475746/3475746_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-21T17:52:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Douche .</video:title>
      <video:description>Meilleure fason de ce doucher .</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475745/3475745_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:52:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 93</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475744/3475744_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T17:51:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UMA PISA</video:title>
      <video:description>UMA PISA #UMAPISA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475743/3475743_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T17:51:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deewana Hai Ye Mann - Chori Chori Chupke Chupke (2001) | Salman Khan &amp; Rani Mukerji</video:title>
      <video:description>Nikmati lagu “Deewana Hai Ye Mann” dari film Bollywood Chori Chori Chupke Chupke (2001), yang dibintangi Salman Khan dan Rani Mukerji. Lagu romantis dengan nuansa khas film Bollywood yang membawa kembali kenangan indah dari era film Hindi awal 2000-an. ❤️🎶 Cocok untuk para penggemar Bollywood, Salman Khan, Rani Mukerji, dan lagu-lagu film India klasik. Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu Bollywood, film India, lagu nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Deewana Hai Ye Mann” from the Bollywood movie Chori Chori Chupke Chupke (2001), starring Salman Khan and Rani Mukerji. A romantic Hindi film song that brings back the nostalgic atmosphere of early 2000s Bollywood. Perfect for fans of Bollywood music, Salman Khan, Rani Mukerji, and classic Hindi movie songs. ❤️🎵 Don&apos;t forget to Follow for more Bollywood songs, Indian movies, nostalgic music, and entertainment. #DeewanaHaiYeMann #ChoriChoriChupkeChupke #SalmanKhan #RaniMukerji #BollywoodSongs #HindiSongs #IndianSongs #BollywoodMusic #HindiMovieSongs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475742/3475742_720p.mp4</video:content_loc>
      <video:duration>251</video:duration>
      <video:publication_date>2026-09-21T17:51:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 92</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475741/3475741_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-21T17:51:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boxing wanita</video:title>
      <video:description>#Boxing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475740/3475740_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T17:51:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The song &quot;Wish You Were Here&quot; by Neck Deep</video:title>
      <video:description>The song was written by vocalist Ben Barlow and bassist Fil Thorpe-Evans. In an interview with *Kerrang!*, they revealed that the track stemmed from a shared experience of loss. Fil Thorpe-Evans recounted that he had recently lost his father. While still grieving, he received news that a childhood friend had also passed away in an accident. This series of events led him into a &quot;strange phase of reflection,&quot; which is where the writing of the song began. While Ben Barlow wrote the chorus, Fil worked on the music and the verses. Both understood that sense of loss and poured it into something deeply personal. #WishYouWereHerebyNeckDeep</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475739/3475739_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-09-21T17:51:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 91</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475738/3475738_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T17:51:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atten and Why</video:title>
      <video:description>#Cartoon</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475737/3475737_720p.mp4</video:content_loc>
      <video:duration>1226</video:duration>
      <video:publication_date>2026-09-21T17:50:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DEUS TI AMA MUITO</video:title>
      <video:description>DEUS TI AMA MUITO #DEUSTIAMAMUITO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475736/3475736_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T17:50:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Susu sapi muncrat</video:title>
      <video:description>#Sususapi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475735/3475735_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T17:50:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 90</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475734/3475734_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-21T17:50:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anime gojo satoru</video:title>
      <video:description>Jjk #jjkanime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475733/3475733_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T17:50:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The sunset was definitely a paid actor! 😮‍💨🔥</video:title>
      <video:description>Perfect bike, perfect road, and a sunset that looks straight out of a movie. 🎬✨ Ride, freedom, and pure biker vibes all in one shot! 🏁🤘 #biker #gsxr1000 #biketok #motorcyclesoftiktok #bikelife #motorcycle #suzuki #gsxr #gsxr1000life #bikerlife #motorcyclerider #motorcyclelife #sportbike #superbike #bikers #rider #rideout #motorcyclelover #sunset #sunsetride #roadtrip #bikervibes #motorcyclevibes #motovlog #bikevideo #viral #trending #fyp #tiktok #motorcycletiktok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475732/3475732_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T17:50:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tambal ban</video:title>
      <video:description>#Tambalban</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475731/3475731_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T17:50:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 89</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475730/3475730_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-21T17:50:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Putih mempesona 3</video:title>
      <video:description>#Mempesona</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475729/3475729_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T17:50:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LINDA 2</video:title>
      <video:description>LINDA #LINDA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475728/3475728_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:49:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story Gus idam</video:title>
      <video:description>Motivssi hidup #Paris #prancis #inggril #sepanyol</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475727/3475727_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T17:49:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 88</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475726/3475726_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-21T17:49:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pamer ketek 2</video:title>
      <video:description>#Ketek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475725/3475725_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T17:49:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 87</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475724/3475724_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-21T17:49:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475723</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475723/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dadali - Disaat Aku Mencintaimu | Official Music Video</video:title>
      <video:description>Nikmati lagu “Disaat Aku Mencintaimu” dari Dadali, sebuah lagu penuh perasaan tentang cinta, kerinduan, dan perjalanan hati. Melodi yang menyentuh membuat lagu ini cocok untuk menemani waktu santai sekaligus bernostalgia dengan musik Indonesia. Bagi para penggemar Dadali dan lagu-lagu romantis Indonesia, jangan lewatkan lagu ini. ❤️🎶 Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu, video musik, lagu nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Disaat Aku Mencintaimu” by Dadali, a heartfelt Indonesian song about love, longing, and emotions. Its touching melody makes it perfect for relaxing and reminiscing about Indonesian music. For fans of Dadali and romantic Indonesian songs, enjoy this memorable track. ❤️🎵 Don&apos;t forget to Follow for more songs, music videos, nostalgic music, and entertainment. #Dadali #DisaatAkuMencintaimu #DadaliDisaatAkuMencintaimu #DisaatAkuMencintaimuDadali #LaguDadali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475723/3475723_720p.mp4</video:content_loc>
      <video:duration>239</video:duration>
      <video:publication_date>2026-09-21T17:49:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jajan cilok</video:title>
      <video:description>#Cilok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475722/3475722_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:49:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 86</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475721/3475721_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-21T17:48:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gembala sapi</video:title>
      <video:description>#Sapi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475720/3475720_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T17:48:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wish You Were Here - Neck Deep 3</video:title>
      <video:description>This song was written by vocalist Ben Barlow and bassist Fil Thorpe-Evans. In an interview with *Kerrang!*, they revealed that the track stemmed from a shared experience of loss. Fil Thorpe-Evans explained that he had recently lost his father at the time. While still grieving, he received news that a childhood best friend had also passed away in an accident. This series of events led him into a &quot;strange phase of reflection,&quot; which is where the writing of the song began. While Ben Barlow wrote the chorus, Fil worked on the music and the verses. Both understood that sense of loss and channeled it into something deeply personal. #WishYouWereHere-NeckDeep</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475719/3475719_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-09-21T17:48:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 85</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475718/3475718_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-21T17:48:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menari di tengah sawah</video:title>
      <video:description>#Menari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475717/3475717_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T17:48:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lubber Pandhu New South Hindi Dubbed Full HD Movie</video:title>
      <video:description>#Lubberpandhulubberpandhuhindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475716/3475716_720p.mp4</video:content_loc>
      <video:duration>8766</video:duration>
      <video:publication_date>2026-09-21T17:48:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 84</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475715/3475715_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T17:48:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motor hitam manis</video:title>
      <video:description>#Motor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475714/3475714_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T17:48:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Museum relics came to life at night (रात में जिंदा हो उठे संग्रहालय के अवशेष)</video:title>
      <video:description>एक शव-सज्जाकार ऊँची तनख्वाह के लालच में निजी ‘नंबर 9’ संग्रहालय में रात की सुरक्षा ड्यूटी स्वीकार करता है। पहली ही रात उसे पता चलता है—यहाँ के अधूरे अवशेष स्थिर नहीं, जीवंत हैं: टूटे हुए हाथों वाली आठ-भुजा प्रतिमा, सिर-विहीन कांस्य योद्धा और एक रहस्यमय कांस्य सिर, जो अपनी मर्जी से हलचल पैदा करता है। उसके पास एक अनोखी क्षमता है—टूटे हिस्सों को ठीक कर देना। वह एक-एक कर इन अवशेषों को जोड़ता-सँवारता है, और अनजाने में उस ‘एस-स्तर’ के कांस्य सिर की उथल-पुथल को शांत कर देता है। पर हर मरम्मत के साथ सवाल गहरा होता जाता है: यह संग्रहालय इन अधूरे अवशेषों को क्यों छिपाए हुए है? और सधे कदमों वाली सचिव किसके निर्देश पर काम कर रही है? रात दर रात, वह कैमरों, बंद तिजोरियों और बंदिशों से भरे गलियारों में सुराग जोड़ता है—एक ऐसे गुप्त प्राधिकरण तक पहुँचने के लिए जो इन घटनाओं पर नजर रखता है। लेकिन जैसे-जैसे वह सच्चाई के करीब आता है, उसे महसूस होता है कि उसकी ‘मरम्मत’ केवल वस्तुओं की नहीं, घटनाओं की दिशा भी बदल रही है। क्या वह इस संग्रहालय के रहस्य को सुरक्षित खोल पाएगा—या खुद ही किसी बड़ी व्यवस्था का हिस्सा बन रहा है? #ChineseDrama #ChineseDramaHindiDubbed #Cdrama #CdramaHindiDubbed #HistoricalCdrama #FantasyCdrama #RomanticCdrama #Xianxia #ChineseFantasyDrama #CostumeDrama #HistoricalDrama #FantasyRomance #LoveStory #ImmortalLove #DemonGodDevilGod #TimeTravel #Reincarnation #SecondChanceLove #EnemiesToLovers #ForbiddenLove #Magic #Cultivation #HindiDubbedDrama #DramaInHindi #HindiDrama #TrendingCdrama #BestCdrama #AsianDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475713/3475713_720p.mp4</video:content_loc>
      <video:duration>5606</video:duration>
      <video:publication_date>2026-09-21T17:48:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Di cium bapak bapak</video:title>
      <video:description>#Kiss</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475712/3475712_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T17:47:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 83</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475711/3475711_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-09-21T17:47:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinta dan Air Mata - Bunga Citra | Cover Akustik</video:title>
      <video:description>Nikmati lagu “Cinta dan Air Mata” dalam versi Cover Akustik oleh Bunga Citra. Aransemen akustik menghadirkan suasana yang lembut, sederhana, dan penuh perasaan, cocok untuk menemani waktu santai dan menikmati musik Indonesia. Bagi kamu yang menyukai lagu romantis, lagu nostalgia, dan musik akustik, semoga video ini bisa menjadi teman untuk menikmati waktu luang. 🎶❤️ Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu, cover akustik, video musik, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Cinta dan Air Mata” performed by Bunga Citra in this Acoustic Cover. The acoustic arrangement creates a soft, simple, and heartfelt atmosphere, perfect for relaxing and enjoying Indonesian music. If you enjoy romantic songs, nostalgic music, and acoustic covers, we hope you enjoy this performance. 🎵❤️ Don&apos;t forget to Follow for more songs, acoustic covers, music videos, and entertainment. #CintadanAirMata #BungaCitra #BungaCitraCover #CintadanAirMataCover #CintadanAirMataAcoustic #CintadanAirMataAkustik #CoverAkustik #AcousticCover #LaguIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475710/3475710_720p.mp4</video:content_loc>
      <video:duration>412</video:duration>
      <video:publication_date>2026-09-21T17:47:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475709</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475709/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Foldable water container for travel</video:title>
      <video:description>Foldable water container for travel #foldablewatercontainer #useful #gadget #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475709/3475709_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:47:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menangkap ikan 2</video:title>
      <video:description>#Ikan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475708/3475708_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T17:47:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;When the Wind Whispers: Princess of the Wind&quot;</video:title>
      <video:description>In the breath of the wind, there is a story that never reaches its end. Her hair dances wildly, carrying her longing to an unreachable horizon. She stands between time and dust, beautiful in her eternal solitude...🥀</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475707/3475707_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T17:46:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475706</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475706/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Roubo do INSS</video:title>
      <video:description>Ladrões planejando como esconder o dinheiro roubado dos velhinhos #STF #INSS #roubo #dinheiro #idosos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475706/3475706_720p.mp4</video:content_loc>
      <video:duration>349</video:duration>
      <video:publication_date>2026-09-21T17:46:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ibn al-Haytham: The Pioneer Who Transformed the Science of Light</video:title>
      <video:description>Long before modern laboratories, Ibn al-Haytham used observation and experiments to investigate how light and vision work. His studies of optics helped explain how light travels, how images are formed, and how vision occurs. His experimental approach became an important part of the history of scientific inquiry. Discover the story of Ibn al-Haytham and his groundbreaking work in optics. #IbnalHaytham #Alhazen #historyofoptics #Islamicgoldenage #opticshistory #sciencehistory #historyofscience #experimentaloptics #lightandvision #cameraobscura #cameraobscuraexperiment #howvisionworks #lightexperiments #ancientscience #medievalscience #Islamicscience #opticalscience #pioneersofscience #scientificmethod #historyoflight #physicshistory #sciencedocumentary #famousscientists #inventionofcameraobscura #opticsexperiment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475705/3475705_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-21T17:46:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BASTA</video:title>
      <video:description>BASTA #BASTA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475704/3475704_720p.mp4</video:content_loc>
      <video:duration>178</video:duration>
      <video:publication_date>2026-09-21T17:46:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Life is a game. Play to win 🎮🥊</video:title>
      <video:description>Learn to play it with a calm mind. You won’t control every challenge, every setback, or every situation that comes #Thailand #muaythai #America #sports</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475703/3475703_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T17:46:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Braisl</video:title>
      <video:description>BRASIL #BRASIL</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475702/3475702_720p.mp4</video:content_loc>
      <video:duration>147</video:duration>
      <video:publication_date>2026-09-21T17:45:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gojo satoru 8</video:title>
      <video:description>#animejjkgojo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475701/3475701_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T17:45:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bukan Tak Mampu - Nurtita Fadilah | Akustik Version | Mirnawati Cover</video:title>
      <video:description>Nikmati lagu “Bukan Tak Mampu” yang dipopulerkan oleh Nurtita Fadilah, dibawakan dalam versi akustik oleh Mirnawati. Aransemen akustik menghadirkan suasana yang lebih sederhana, lembut, dan penuh perasaan. Cocok untuk menemani waktu santai, bernostalgia, dan menikmati lagu-lagu Indonesia dengan nuansa akustik. 🎶❤️ Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu, cover, video musik, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Bukan Tak Mampu”, a song popularized by Nurtita Fadilah, performed by Mirnawati in an acoustic version. The acoustic arrangement creates a simple, warm, and heartfelt atmosphere. Perfect for relaxing, reminiscing, and enjoying Indonesian songs with an acoustic touch. 🎵❤️ Don&apos;t forget to Follow for more songs, cover performances, music videos, and entertainment. #BukanTakMampu #NurtitaFadilah #Mirnawati #MirnawatiCover #BukanTakMampuCover #BukanTakMampuAcoustic #BukanTakMampuAkustik #AkustikVersion #AcousticVersion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475700/3475700_720p.mp4</video:content_loc>
      <video:duration>405</video:duration>
      <video:publication_date>2026-09-21T17:45:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Volleyball match 2</video:title>
      <video:description>A volleyball match featuring a group of mothers. Please watch... #Volleyball #match #inter-village #crowded #dancing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475699/3475699_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T17:45:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to Create AI Videos in the YouTube App for Free (2026)</video:title>
      <video:description>Learn how to create AI videos in the YouTube app for free, step by step. This beginner-friendly mobile tutorial shows you how to get started without paid editing software. In this video: • Create AI videos from your phone • Use YouTube AI tools • Make engaging videos without advanced editing Subscribe to MBB Tech for practical AI and smartphone tutorials. #TrainAIEarn #AIAIVideosYouTubeTips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475698/3475698_720p.mp4</video:content_loc>
      <video:duration>541</video:duration>
      <video:publication_date>2026-09-21T17:45:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🍓😂 Boquenilce e o bebê Boquenilda estão aprontando mais uma aventura divertida! 💕👶✨</video:title>
      <video:description>Um vídeo cheio de diversão, personagens fofos e muita imaginação! 🌈🍎🍌 Prepare-se para rir e acompanhar essa historinha animada do começo ao fim! 😍🎬 #boquenilce #boquenilda #bebeboquenilda #novelinhas #frutas #animation #animacao #desenhoanimado #historinha #videoinfantil #conteudoinfantil #personagensfofos #bebefofo #frutasanimadas #aventurainfantil #humorinfantil #videosengraçados #diversão #entretenimento #cartoon #animatedvideo #kidsanimation #kidsvideo #funnyanimation #viral #fyp #shorts #youtubeshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475697/3475697_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T17:44:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 Nobody Expected This! Hilarious Unexpected Moments</video:title>
      <video:description>You never know what will happen next! 😂 Enjoy these hilarious and unexpected moments that will leave you laughing. Watch until the end! #unexpectedmoments #funnymoments #funnyvideo #hilarious #comedy #funnyclips #surprisingmoments #viralvideo #humor #laugh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475696/3475696_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T17:44:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MURAI Sound Loud</video:title>
      <video:description>#BIRDS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475695/3475695_720p.mp4</video:content_loc>
      <video:duration>1708</video:duration>
      <video:publication_date>2026-09-21T17:43:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bagwork 💥🥊 There is a moment in training</video:title>
      <video:description>where technique disappears. The punch, the elbow, the knee, the kick… They stop feeling like separate movements. #Thailand #muaythai #all</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475694/3475694_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T17:43:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Camelia - Nurtita Fadilah | Acoustic Version</video:title>
      <video:description>Nikmati “Camelia” yang dibawakan oleh Nurtita Fadilah dalam versi Acoustic Version. Aransemen akustik memberikan nuansa yang lebih sederhana, hangat, dan santai, cocok untuk menemani waktu istirahat maupun menikmati musik Indonesia. Bagi kamu yang menyukai lagu bernuansa romantis dan musik akustik, semoga penampilan ini bisa menjadi teman santai. 🎶❤️ Jangan lupa Follow akun ini untuk mendapatkan lebih banyak lagu, video musik, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Camelia” performed by Nurtita Fadilah in this Acoustic Version. The acoustic arrangement brings a warm, simple, and relaxing atmosphere, perfect for unwinding and enjoying Indonesian music. If you enjoy romantic songs and acoustic music, we hope this performance becomes a pleasant companion for your relaxing moments. 🎵❤️ Don&apos;t forget to Follow for more songs, music videos, and entertainment. #Camelia #NurtitaFadilah #NurtitaFadilahCamelia #CameliaAcousticVersion #NurtitaFadilahAcoustic #CameliaAcoustic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475693/3475693_720p.mp4</video:content_loc>
      <video:duration>277</video:duration>
      <video:publication_date>2026-09-21T17:43:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Bitter Truth: When Presence Becomes an Absence 💔</video:title>
      <video:description>Forgive me, brother, but your wife keeps sending me these videos for a reason. It is only because you were never truly there for her when she was down and feeling lonely. When a home feels empty, a hurting heart will always look for a place to lean on. #Heartbreak #SadReality #RelationshipQuotes #LonelyHeart #EmotionalPoetry #BrokenHome #SadVibesOnly #DeepThoughts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475692/3475692_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-21T17:42:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gadis cantik yg teraniaya part 3</video:title>
      <video:description>Gadis cantik yg teraniaya #Gadiscantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475691/3475691_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T17:42:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Watch out,,, please watch</video:title>
      <video:description>Snow baseball game. A favorite in snowy countries. Please watch and subscribe! #Travel #snow #people #throw #cold</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475690/3475690_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:41:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video 🤣 4</video:title>
      <video:description>When you are sick this is how it feels #relatable</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475689/3475689_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:41:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ESTOU NAS URNAS, MAS SEM VOZ PARA FAZER CAMPANHA</video:title>
      <video:description>ESTOU NAS URNAS, MAS SEM VOZ PARA FAZER CAMPANHA Acontecendo no Brasil. Deltan Dallagnol 🗳️ Candidato ao Senado pelo Paraná - 3️⃣0️⃣0️⃣ #ESTOU #NASURNAS #VOZ #CAMPANHA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475688/3475688_720p.mp4</video:content_loc>
      <video:duration>147</video:duration>
      <video:publication_date>2026-09-21T17:41:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 Funniest Moments That Will Make You Laugh Out Loud!</video:title>
      <video:description>Get ready to laugh! 😂 Enjoy these hilarious and unexpected moments that will definitely put a smile on your face. Watch until the end and share the fun with your friends! #funnyvideo #funnymoments #hilarious #comedy #funnyclips #trynottolaugh #viralvideo #humor #entertainment #funnycompilation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475687/3475687_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T17:41:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475686</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475686/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak 21st September 2026 Episode 439</video:title>
      <video:description>Tum Se Tum Tak 21st September 2026 Episode 439 1. &quot;A love story wrapped in sorrow&quot; 2. &quot;A tale of love and heartbreak&quot; 3. &quot;A painful journey of love&quot; 4. &quot;A love that ended in tears&quot; 5. &quot;A doomed love story&quot; 6. &quot;A love story that broke hearts&quot; 7. &quot;A romance filled with sadness&quot; 8. &quot;A bittersweet love story&quot; 9. &quot;A love story lost to fate&quot; 10.&quot;A tragic romance&quot; 11.&quot;A Tum Se Tum Tak All Episode #TumSeTumTak21stSeptember2026Episode439</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475686/3475686_720p.mp4</video:content_loc>
      <video:duration>1348</video:duration>
      <video:publication_date>2026-09-21T17:40:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 10 Hindi dubbed</video:title>
      <video:description>Lawless lawyer episode 10 Hindi dubbed K-drama season 1 #Action #Crime #Romance #Legal #K-dramaHindidubbed #lawlesslawyer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475685/3475685_720p.mp4</video:content_loc>
      <video:duration>3751</video:duration>
      <video:publication_date>2026-09-21T17:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VEJA AS FALAS DO MORAES NO DIA QUE ELE VOOU NO JATINHO DO VORCARO</video:title>
      <video:description>VEJA AS FALAS DO MORAES NO DIA QUE ELE VOOU NO JATINHO DO VORCARO Acontecendo no Brasil. #VEJA #FALASDOMORAES #VOOU #NOJATINHO #DOVORCARO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475684/3475684_720p.mp4</video:content_loc>
      <video:duration>411</video:duration>
      <video:publication_date>2026-09-21T17:40:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quando percebo que estou sendo gravado… 😳😂 Aí o comportamento muda completamente! 🎥🤣</video:title>
      <video:description>Quem nunca tentou disfarçar quando percebeu a câmera? 👀😂 Assista até o final e marque aquele amigo que faz exatamente isso! #humor #comedia #quandopercebo #sendogravado #videoengracado #videosengraçados #memes #meme #funny #funnyvideo #viral #fyp #paravoce #tiktokbrasil #situaçõesengraçadas #momentosengraçados #câmera #sendofilmado #reaçãoengraçada #reação #pegadinha #risadas #diversão #entretenimento #videosvirais</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475683/3475683_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T17:39:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎵 ALE DENG BETA</video:title>
      <video:description>Lagu Ambon original dari NovaMusicDunia dengan nuansa romantis, hangat, dan penuh rasa. Nikmati musik original dari NovaMusicDunia — tempat berbagai genre, budaya, dan vibe bertemu dalam satu dunia musik. 🌎 NOVAMUSICDUNIA ORIGINAL MUSIC • ALL GENRES • ALL VIBES 🎧 Dengarkan dan nikmati sampai selesai. 👍 Like jika kamu suka lagunya 💬 Tulis pendapat kamu di komentar 🔔 Subscribe untuk lagu-lagu original berikutnya. © NovaMusicDunia All rights reserved. #AleDengBeta #OriginalMusic #LaguTerbaru #MusikIndonesia #LaguIndonesia #NovaMusicDunia #MusikAmbon #LaguAmbon #fyp #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475682/3475682_720p.mp4</video:content_loc>
      <video:duration>268</video:duration>
      <video:publication_date>2026-09-21T17:39:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Si balik gubuk</video:title>
      <video:description>#Gubuk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475681/3475681_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T17:38:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A massage after playing padel is highly effective</video:title>
      <video:description>A massage after playing padel is highly effective, as the sport involves numerous lateral movements, body rotations, and overhead shots that place repetitive strain on muscles and joints. Massage helps accelerate recovery, reduce muscle soreness, and prevent injuries #Amassageafterplayingpadelishighlyeffective</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475680/3475680_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-21T17:38:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ridho Rhoma &amp; Sonet 2 Band - Menunggu | Official Music Video</video:title>
      <video:description>Nikmati lagu “Menunggu” dari Ridho Rhoma &amp; Sonet 2 Band dalam Official Music Video. Lagu dengan nuansa romantis yang menggambarkan rasa setia, rindu, dan harapan ketika seseorang masih menantikan orang yang dicintainya. Cocok untuk menemani waktu santai, bernostalgia, dan menikmati musik dangdut Indonesia. ❤️🎶 Jangan lupa Follow akun ini untuk mendapatkan lebih banyak video musik, lagu nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Menunggu” by Ridho Rhoma &amp; Sonet 2 Band in this Official Music Video. A romantic Indonesian song about love, longing, patience, and waiting for someone special. Perfect for relaxing, reminiscing, and enjoying Indonesian dangdut music. ❤️🎵 Don&apos;t forget to Follow for more music videos, nostalgic songs, and Indonesian entertainment. #RidhoRhoma #Sonet2Band #Menunggu #RidhoRhomaMenunggu #MenungguRidhoRhoma #RidhoRhomaSonet2 #OfficialMusicVideo #LaguDangdut #MusikDangdut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475679/3475679_720p.mp4</video:content_loc>
      <video:duration>308</video:duration>
      <video:publication_date>2026-09-21T17:38:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Susu banteng</video:title>
      <video:description>#Susu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475678/3475678_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:38:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aerobik 5</video:title>
      <video:description>#Aerobik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475677/3475677_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T17:37:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tukang jahit mengukur</video:title>
      <video:description>#Jahit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475676/3475676_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:37:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Manjat pohon kelapa</video:title>
      <video:description>#Pohonkelapa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475675/3475675_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T17:37:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio santai</video:title>
      <video:description>Saat santai malam #Santaidiwaktumalam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475674/3475674_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-21T17:37:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>পাগলা লিডার</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475673/3475673_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T17:37:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Made the Cutest Anime Cat Ever! 🐱🔥</video:title>
      <video:description>Watch what happens when AI transforms a cute cat into an amazing anime character! ✨ ​If you love cats and anime art, hit that Like and Subscribe button for more AI-generated content! 🐾💖 ​Let me know in the comments which style you want to see next! 👇 #AICatAnimeCatAICatArtCatShortsAnimeShortsShortsViralCuteCatsAIAnimationAIArtViralShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475672/3475672_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T17:37:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AGORA ACABOU MESMO Surge mais vídeos de Moraes, Gonet e Andrei com Vorcaro</video:title>
      <video:description>AGORA ACABOU MESMO Surge mais vídeos de Moraes, Gonet e Andrei com Vorcaro Acontecendo no Brasil. Gustavo Gayer. Deputado Federal e CANDIDATO AO SENADO por Goiás – 222 #brasil #AGORA #ACABOU #Surge #vídeos #Moraes #Gonet #Andrei #Vorcaro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475671/3475671_720p.mp4</video:content_loc>
      <video:duration>368</video:duration>
      <video:publication_date>2026-09-21T17:37:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>honeykhan</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475670/3475670_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:36:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gara gara uang jajan gak sesuai</video:title>
      <video:description>Vidio tentang comedy #comedy #lucu #ngakak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475669/3475669_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T17:36:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Marc, please… please be World Champion! 🏆🔥</video:title>
      <video:description>The comeback, the speed, the determination — Marc Márquez is ready to fight until the very end! 🏍️💨 Every race brings more emotion, more pressure and another chapter in this incredible journey. Will Marc Márquez become World Champion in 2026? 👀🏆 #motogp #motogp2026 #marcmarquez #marcmárquez #worldchampion #motogpchampion #comeback #motogpcomeback #motorcycleracing #motorcycle #motogprace #motogpfans #racing #motorsport #grandprix #motogpedit #motogphighlights #marcmarquezcomeback #marcmarquez2026 #fyp #viral #trending #racingfans #motoracing #champion #worldchampionship</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475668/3475668_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T17:36:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475667</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475667/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Voli pantai</video:title>
      <video:description>#Volipantai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475667/3475667_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:36:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sorry I Can’t, It’s Hockey Season Hoodie</video:title>
      <video:description>Sorry I Can’t, It’s Hockey Season Hoodie https://teechip.com/sorry-i-cant-hs-hockey-season?retailProductCode=24390940EEB4B2-554AC653F287-GS0-TC4-WHT Sorry, I can’t—it&apos;s hockey season! This funny hockey hoodie is perfect for passionate hockey fans who would rather be watching the game, cheering for their team, or spending time at the rink. A great choice for hockey players, hockey moms, hockey dads, and anyone who loves the excitement of hockey season. Perfect for game day and everyday hockey life! #hockeydad #proudhockeydad #hockeyfather #besthockeydad #icehockeydad #hockeydadgift #hockeyfan #hockeyfamily #hockeygame #hockeyseason #hockeylife #proudsportsdad #hockeyparents #dadlife #icehockeyfan #hockeylover #hockeyteamdad #funnyhockeydad #hockeygiftsfordad #fathersdaygift #sportsdad #gamedayhockey #hockeyshirt #hockeydesign #bestdadever</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475666/3475666_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T17:36:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dance dog 2</video:title>
      <video:description>#Danca #cachorro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475665/3475665_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T17:36:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>rider 3</video:title>
      <video:description>rider woman #rider</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475664/3475664_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T17:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ridho Rhoma &amp; Sonet 2 Band - Kerinduan | Official Music Video</video:title>
      <video:description>Nikmati lagu “Kerinduan” dari Ridho Rhoma &amp; Sonet 2 Band dalam Official Music Video. Lagu bernuansa romantis yang menggambarkan rasa rindu dan perasaan mendalam kepada seseorang yang begitu berarti. Cocok untuk menemani waktu santai, bernostalgia, dan menikmati alunan musik dangdut Indonesia. ❤️🎵 Jangan lupa Follow akun ini untuk mendapatkan lebih banyak video musik, lagu nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Kerinduan” by Ridho Rhoma &amp; Sonet 2 Band in this Official Music Video. A romantic Indonesian song expressing longing and deep feelings for someone special. Perfect for relaxing, reminiscing, and enjoying Indonesian dangdut music. ❤️🎶 Don&apos;t forget to Follow for more music videos, nostalgic songs, and Indonesian entertainment. #RidhoRhoma #Sonet2Band #Kerinduan #RidhoRhomaKerinduan #KerinduanRidhoRhoma #RidhoRhomaSonet2</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475663/3475663_720p.mp4</video:content_loc>
      <video:duration>343</video:duration>
      <video:publication_date>2026-09-21T17:36:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita lagi menjahit</video:title>
      <video:description>#Menjahit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475662/3475662_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:36:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny videos of drunk people</video:title>
      <video:description>After coming home, I was shaking my own feet because my eyes were not good. #Travel #drunkpeople #dizzy #bridge #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475661/3475661_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T17:36:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nangkap belut</video:title>
      <video:description>#Belut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475660/3475660_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T17:35:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vaping 2</video:title>
      <video:description>#vaping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475659/3475659_720p.mp4</video:content_loc>
      <video:duration>140</video:duration>
      <video:publication_date>2026-09-21T17:35:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muffins Proteicos de Frango e Espinafre.</video:title>
      <video:description>Aprenda a fazer estes muffins salgados fofinhos, nutritivos e repletos de sabor, ideais para o café da tarde ou para levar para o trabalho. #Southkorea #taiwan #vietnam #brazil #italy #china #unitedstates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475658/3475658_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-21T17:35:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita hamil berjoget</video:title>
      <video:description>#Joget</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475657/3475657_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:35:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What Kids See Is What They Copy</video:title>
      <video:description>They’re watching us more than we realize. The way we speak, love, react, and treat others becomes the lesson they carry with them. **Children may forget what we say, but they remember what we show them.** What kids see is what they copy. #ParentingTipsKids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475656/3475656_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T17:34:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan pagi di sawah</video:title>
      <video:description>#Jalanpagi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475655/3475655_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:34:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You Won&apos;t Believe This AI Anime Cat! 😻</video:title>
      <video:description>Watch what happens when AI transforms a cute cat into an amazing anime character! ✨ If you love cats and anime art, hit that Like and Subscribe button for more AI-generated content! 🐾💖 Let me know in the comments which style you want to see next! 👇 #AICatAnimeCatAICatArtCatShortsAnimeShortsShortsViralCuteCatsAIAnimationAIArtViralShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475654/3475654_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T17:34:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ridho Rhoma &amp; Sonet 2 Band - Kata Pujangga | Official Music Video</video:title>
      <video:description>Nikmati lagu “Kata Pujangga” dari Ridho Rhoma &amp; Sonet 2 Band dalam Official Music Video. Lagu dengan nuansa khas musik dangdut yang menghadirkan melodi dan lirik penuh makna tentang cinta dan kehidupan. Cocok untuk menemani waktu santai, bernostalgia, dan menikmati karya musik Indonesia dari Ridho Rhoma &amp; Sonet 2 Band. 🎶 Jangan lupa Follow akun ini untuk mendapatkan lebih banyak video musik, lagu nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Kata Pujangga” by Ridho Rhoma &amp; Sonet 2 Band in this Official Music Video. A classic Indonesian dangdut song featuring meaningful lyrics, beautiful melodies, and themes of love and life. Perfect for relaxing, reminiscing, and enjoying Indonesian music from Ridho Rhoma &amp; Sonet 2 Band. 🎵 Don&apos;t forget to Follow for more music videos, nostalgic songs, and Indonesian entertainment. #RidhoRhoma #Sonet2Band #KataPujangga #RidhoRhomaKataPujangga #KataPujanggaRidhoRhoma #RidhoRhomaSonet2 #OfficialMusicVideo #LaguDangdut #MusikDangdut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475653/3475653_720p.mp4</video:content_loc>
      <video:duration>242</video:duration>
      <video:publication_date>2026-09-21T17:34:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 360</video:title>
      <video:description>Too lazy to walk.... Became a chonky legend anyway #lazycat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475652/3475652_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:33:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita morroco</video:title>
      <video:description>#Morroco</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475651/3475651_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:33:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gas pool pokoknya</video:title>
      <video:description>Jnagan kasih kendir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475650/3475650_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T17:33:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PAPSEL STYLE - MNM (my nona manis)</video:title>
      <video:description>Thank you for watching and listening to songs from Eastern Indonesia. Don&apos;t forget to keep supporting us and subscribing to our music. Greetings from us, the people of the East. We love you all. #musichip-hop #music-rap #music-slow #music-jazz #music-reggae #music-indonesia #music-rnb #music-pop</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475649/3475649_720p.mp4</video:content_loc>
      <video:duration>251</video:duration>
      <video:publication_date>2026-09-21T17:32:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Destinasi Wisata Temanggung</video:title>
      <video:description>Tempat-tempat wisata Temanggung yang sejuk dan danai #Travel #Wisata #Temanggung #indah #sejuk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475648/3475648_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-21T17:32:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ridho Rhoma &amp; Sonet 2 Band - Dawai Asmara | Official Music Video</video:title>
      <video:description>Nikmati lagu “Dawai Asmara” dari Ridho Rhoma &amp; Sonet 2 Band dalam Official Music Video. Lagu dengan nuansa romantis dan melodi yang indah, menghadirkan suasana penuh cinta yang cocok untuk menemani waktu santai dan bernostalgia. Bagi penggemar Ridho Rhoma, Sonet 2 Band, musik dangdut, dan lagu Indonesia, jangan lewatkan penampilan ini. 🎶❤️ Jangan lupa Follow akun ini untuk mendapatkan lebih banyak video musik, lagu nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Dawai Asmara” by Ridho Rhoma &amp; Sonet 2 Band in this Official Music Video. A romantic Indonesian song with a beautiful melody and a heartfelt atmosphere, perfect for relaxing and enjoying nostalgic music. For fans of Ridho Rhoma, Sonet 2 Band, Indonesian dangdut, and Indonesian music, enjoy this music video. 🎵❤️ Don&apos;t forget to Follow for more music videos, nostalgic songs, and Indonesian entertainment. #RidhoRhoma #Sonet2Band #DawaiAsmara #RidhoRhomaDawaiAsmara #DawaiAsmaraRidhoRhoma #RidhoRhomaSonet2 #OfficialMusicVideo #LaguDangdut #MusikDangdut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475647/3475647_720p.mp4</video:content_loc>
      <video:duration>358</video:duration>
      <video:publication_date>2026-09-21T17:31:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amati</video:title>
      <video:description>Bergerakkk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475646/3475646_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-21T17:30:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quick Mirror Check: Radiating Positive Energy</video:title>
      <video:description>Just a simple moment in front of the mirror to appreciate the vibe before starting the day. Embracing a comfortable, casual look and a natural smile because true beauty begins with self-confidence. Let’s make today amazing! #MirrorCheck #CasualStyle #ConfidenceBoost #NaturalBeauty #ComfyLook #PositiveVibes #SelfAppreciation #AestheticMoments</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475645/3475645_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T17:30:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boxing Styles Tier List 🥊🥊</video:title>
      <video:description>Boxing styles from around the world #Paris #America #Japan #Philippines #Indonesia #allovertheworld</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475644/3475644_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-21T17:30:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Kajal Soni Dance</video:title>
      <video:description>Indian Girl Kajal Soni Dance #danceindia #bollywooddance #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475643/3475643_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T17:30:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DEUS MANDOU JACÓ VOLTAR PARA CASA! 😱🔥 | Gênesis 31</video:title>
      <video:description>🔥 Depois de muitos anos trabalhando para Labão, chegou o momento de Jacó partir. Em Gênesis 31, Jacó percebe que a relação com Labão havia mudado. Seus cunhados estavam descontentes, e até o próprio Labão já não o tratava como antes. Então Deus falou com Jacó e disse: 📖 “Volta para a terra de teus pais e para a tua parentela, e eu serei contigo.” — Gênesis 31:3 Jacó reuniu sua família e seus bens e partiu. Labão foi atrás dele, mas Deus interveio e o advertiu durante um sonho. Depois de anos de trabalho e dificuldades, Jacó declarou: **“Deus viu a minha aflição e o trabalho das minhas mãos.”** 🙏 ❤️ Talvez ninguém esteja vendo todo o seu esforço, mas Deus vê! #Gênesis31 #Gênesis31completo #Gênesis313 #Gênesis3142 #JacóeLabão #JacófogedeLabão #JacódeixaLabão #históriadeJacó #LabãoeJacó #DeusfaloucomJacó #DeusviuaafliçãodeJacó #Deusestácontigo #promessadeDeus #históriabíblica #históriasdaBíblia #personagensbíblicos #Bíblianarrada #estudobíblico #reflexãobíblica #mensagembíblica #palavradeDeus #Deusvêsualuta #Deusvêseuesforço #féemDeus #BíbliaparaShorts #ShortsBíblia #ShortsGospel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475642/3475642_720p.mp4</video:content_loc>
      <video:duration>172</video:duration>
      <video:publication_date>2026-09-21T17:29:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ridho Rhoma &amp; Sonet 2 Band - Cuma Kamu | Official Music Video</video:title>
      <video:description>Nikmati lagu “Cuma Kamu” dari Ridho Rhoma &amp; Sonet 2 Band dalam Official Music Video. Lagu romantis dengan nuansa khas dangdut yang menggambarkan rasa cinta dan ketulusan kepada seseorang yang begitu berarti. Cocok untuk menemani waktu santai, bernostalgia, dan menikmati musik Indonesia. ❤️🎶 Jangan lupa Follow akun ini untuk mendapatkan lebih banyak video musik, lagu nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Cuma Kamu” by Ridho Rhoma &amp; Sonet 2 Band in this Official Music Video. A romantic Indonesian dangdut song expressing love and sincere feelings for someone special. Perfect for relaxing, enjoying nostalgic music, and discovering Indonesian songs. ❤️🎵 Don&apos;t forget to Follow for more music videos, nostalgic songs, and Indonesian entertainment. #RidhoRhoma #Sonet2Band #CumaKamu #RidhoRhomaCumaKamu #CumaKamuRidhoRhoma #RidhoRhomaSonet2 #Official</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475641/3475641_720p.mp4</video:content_loc>
      <video:duration>243</video:duration>
      <video:publication_date>2026-09-21T17:28:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Employee Proposed His Lady Boss! | Kabhi Main Kabhi Tum | Emmad Irfani | Naeema Butt</video:title>
      <video:description>Employee Proposed His Lady Boss! | Kabhi Main Kabhi Tum | Emmad Irfani | Naeema Butt #KabhiMainKabhiTum</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475640/3475640_720p.mp4</video:content_loc>
      <video:duration>531</video:duration>
      <video:publication_date>2026-09-21T17:28:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Barcelona 14 - 6 Real Madrid</video:title>
      <video:description>#football</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475639/3475639_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-09-21T17:27:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>malam malam lemesin dulu</video:title>
      <video:description>cewek cantik pargoy #cewektanktop #cewekcantik #bodygoals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475638/3475638_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:27:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Power of Hope Chasing Dreams A Story to Remember Life and Inspiration Believe in Yourself The Ro</video:title>
      <video:description>Sure! 😊 What would you like a description of? For example: A person A place A product A picture Yourself A story or topic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475637/3475637_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:27:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ভিডিও 142</video:title>
      <video:description>ভিডিও</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475636/3475636_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T17:26:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ridho Rhoma &amp; Sonet 2 - Haruskah Berakhir</video:title>
      <video:description>Nikmati lagu “Haruskah Berakhir” dari Ridho Rhoma &amp; Sonet 2 dalam Official Music Video. Lagu bernuansa romantis dan penuh perasaan yang menghadirkan kisah tentang cinta, perpisahan, dan pertanyaan ketika sebuah hubungan harus berakhir. Cocok untuk menemani waktu santai dan para penggemar musik dangdut serta lagu-lagu Indonesia. ❤️🎶 Jangan lupa Follow akun ini untuk mendapatkan lebih banyak video musik, lagu nostalgia, dan hiburan lainnya. 🇬🇧 English Description Enjoy “Haruskah Berakhir” by Ridho Rhoma &amp; Sonet 2 in this Official Music Video. A heartfelt Indonesian song about love, separation, and the emotional question of whether a relationship really has to end. Perfect for relaxing and enjoying Indonesian dangdut and romantic music. ❤️🎵 Don&apos;t forget to Follow for more music videos, nostalgic songs, and Indonesian entertainment. #RidhoRhoma #Sonet2 #HaruskahBerakhir #RidhoRhomaHaruskahBerakhir #RidhoRhomaSonet2 #OfficialMusicVideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475635/3475635_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-21T17:26:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ELES SÓ ENCONTRARAM A MÃO DO HOMEM… MAS UMA CONVERSA REVELOU ALGO ESTRANHO. 😳</video:title>
      <video:description>Patrick encara a mulher por alguns segundos. Ela olha para ele e diz que sabia que ele a amava, mas que ele não tinha muito tempo. Logo depois, ela vai embora. A investigação continua, e a agente do FBI pergunta se o homem costumava andar com muito dinheiro. A mulher então revela que ele usava um anel e também carregava um cordão da sorte, que tinha uma ficha de 100 mil dólares do cassino. A agente começa a anotar cada detalhe do que ela está contando. Patrick então pede uma descrição da ficha para que possam procurá-la no cassino. Enquanto isso, a agente continua verificando os documentos. Agora eles precisam descobrir onde está essa ficha e se ela pode ajudar a entender o que aconteceu com aquele homem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475634/3475634_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T17:26:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Walaupun hamil tetap santai</video:title>
      <video:description>#Hamil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475633/3475633_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:26:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar Tengkurep</video:title>
      <video:description>Anak kecil laki-laki sedang belajar tengkurap di tempat tidurnya..</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475632/3475632_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T17:26:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dua wanita cantik</video:title>
      <video:description>#Wanita</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475631/3475631_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T17:25:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475630</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475630/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>moeda 22</video:title>
      <video:description>Moeda antiga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475630/3475630_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T17:25:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mobil yang mantap</video:title>
      <video:description>#Mobil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475629/3475629_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T17:25:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Countries boxing style</video:title>
      <video:description>Boxing styles from various countries #Brazil #Japan #Philippines #allcountries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475628/3475628_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T17:25:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantis 6</video:title>
      <video:description>#Romantis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475627/3475627_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:24:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ridho Rhoma - Mengapa | Official Music Video</video:title>
      <video:description>Nikmati lagu “Mengapa” dari Ridho Rhoma dalam Official Music Video. Lagu dengan nuansa romantis dan penuh perasaan yang cocok untuk menemani waktu santai dan para penggemar musik Indonesia. Jangan lupa Follow akun ini untuk mendapatkan lebih banyak video musik, lagu nostalgia, dan hiburan lainnya. 🎶 🇬🇧 English Description Enjoy “Mengapa” by Ridho Rhoma in this Official Music Video. A heartfelt Indonesian song with a romantic atmosphere, perfect for relaxing and enjoying beautiful Indonesian music. Don&apos;t forget to Follow for more music videos, nostalgic songs, and entertainment. 🎵 #RidhoRhoma #Mengapa #RidhoRhomaMengapa #OfficialMusicVideo #RidhoRhomaOfficial #LaguIndonesia #MusikIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475626/3475626_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-21T17:24:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuci rambut</video:title>
      <video:description>#Mandi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475625/3475625_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T17:24:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475624</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475624/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bayiku menangis</video:title>
      <video:description>Bayi laki-lakiku menangis kencang, setelah mendapat beberapa Imunisasi..</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475624/3475624_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:24:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berenang 6</video:title>
      <video:description>#Berenang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475623/3475623_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:24:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bermain bola kasti</video:title>
      <video:description>#Bolakasti</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475622/3475622_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:23:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nature video 26</video:title>
      <video:description>Luck is not always helpful hard work matters alot #sad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475621/3475621_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T17:23:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sunkissed and Swaying in the Pool</video:title>
      <video:description>Blending the calm waters with a little bit of grace and rhythm. Embracing the simple joy of movement and natural confidence under the sun. May your day be as refreshing as this moment. #NaturalBeauty #AestheticVibes #SunKissed #GracefulMovement #PoolDay #Confidence #CasualChic #MindAndBody</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475620/3475620_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T17:23:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 359</video:title>
      <video:description>#Funnycat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475619/3475619_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T17:22:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to throw the right hook</video:title>
      <video:description>#boxinglearnboxingboxingtips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475618/3475618_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T17:21:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 9 Hindi dubbed</video:title>
      <video:description>Lawless lawyer episode 9 Hindi dubbed K-drama season 1 #Action #Crime #Romance #Legal #K-dramaHindidubbed #lawlesslawyer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475617/3475617_720p.mp4</video:content_loc>
      <video:duration>3788</video:duration>
      <video:publication_date>2026-09-21T17:21:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fakta Menarik Isaac Newton yang Jarang Diketahui!</video:title>
      <video:description>Fakta mengenai seorang fisikawan dunia yang mungkin kita tidak tahu. #fisika #isaacnewton #fakta #sejarah #newton</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475616/3475616_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-21T17:21:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MMA the scariest young talent in women</video:title>
      <video:description>The scariest young talent in womens flyweight. #MMAshortMMA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475615/3475615_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-21T17:20:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lomba layangan malam</video:title>
      <video:description>Lomba layangan malam di pasang lampu #Layangan #world #malam #lomba</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475614/3475614_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T17:20:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strangers Again</video:title>
      <video:description>#Lyric Video #Trend</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475613/3475613_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T17:20:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 358</video:title>
      <video:description>Cute #Funnycat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475612/3475612_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T17:20:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gulali - Ridho Rhoma &amp; Sonet2 Band feat. Regy Suling | Live Session</video:title>
      <video:description>Nikmati penampilan “Gulali” oleh Ridho Rhoma &amp; Sonet2 Band feat. Regy Suling dalam versi Live Session. Sajian musik dengan nuansa khas dangdut dan penampilan yang menghibur, cocok untuk menemani waktu santai sekaligus menikmati musik Indonesia. Jangan lupa Follow akun ini agar tidak ketinggalan video musik, lagu nostalgia, dan hiburan lainnya. 🎶 🇬🇧 English Description Enjoy “Gulali” by Ridho Rhoma &amp; Sonet2 Band feat. Regy Suling in this Live Session performance. Experience the distinctive sound of Indonesian dangdut music with an entertaining live performance. Don&apos;t forget to Follow for more Indonesian music, nostalgic songs, live sessions, and entertainment videos. 🎵 #Gulali #RidhoRhoma #Sonet2Band #RegySuling #RidhoRhomaGulali #GulaliLiveSession #RidhoRhomaLive #Sonet2BandLive #Dangdut #LaguDangdut #MusikIndonesia #LaguIndonesia #IndonesianMusic #IndonesianDangdut #LiveSession #LaguNostalgia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475611/3475611_720p.mp4</video:content_loc>
      <video:duration>263</video:duration>
      <video:publication_date>2026-09-21T17:18:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Try this boxing combo 🥊🥊</video:title>
      <video:description>#boxinglearnboxingfitness</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475610/3475610_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T17:18:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Unwind and Recharge with Premium Manual Therapy Massage</video:title>
      <video:description>Melt away the stress and tension of your busy week. Our specialized Manual Therapy Massage combines expert hands-on techniques with a deeply calming ambiance to restore both your body and mind. You deserve this moment of pure relaxation. Book your session today and give your body the care it craves. #ManualTherapy #RelaxingMassage #SelfCareRoutine #WellnessJourney #BodyRejuvenation #MassageTherapy #MeTime #MindAndBody</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475607/3475607_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T17:17:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belly wallet</video:title>
      <video:description>If you like this wallet or bag, please buy it and try it out. But I&apos;m not responsible. #Wallet #stomach #adult</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475606/3475606_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T17:17:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Girl Talk galli</video:title>
      <video:description>funny engrez #entertenment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475601/3475601_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-21T17:16:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan malam 3</video:title>
      <video:description>#Jalanmalam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475599/3475599_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T17:16:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berdua di gubuk</video:title>
      <video:description>#Gubuk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475597/3475597_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T17:15:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PAPSEL STYLE - BERKAT</video:title>
      <video:description>Thank you for watching and listening to songs from Eastern Indonesia. Don&apos;t forget to keep supporting us and subscribing to our music. Greetings from us, the people of the East. We love you all. #musichip-hop #music-rap #music-slow #music-jazz #music-reggae #music-indonesia #music-rnb #music-pop</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475596/3475596_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-21T17:15:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ميڪون ڪر يار ڳچي دا solangi Bhai 786</video:title>
      <video:description>ميڪون ڪر يار ڳچي دا solangi Bhai 786 #ميڪونڪريارڳچيداsolangiBhai786</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475595/3475595_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T17:15:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nostalgia 14</video:title>
      <video:description>Nostagia di patai bersama istri #dipantai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475594/3475594_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-21T17:15:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasmaran</video:title>
      <video:description>#Kasmaran</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475593/3475593_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T17:15:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>crazy attraction</video:title>
      <video:description>This stunt is performed by a professional. #attraction</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475592/3475592_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-21T17:14:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngopi 27</video:title>
      <video:description>#Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475591/3475591_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:14:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boxing footwork in the void🥊🥊</video:title>
      <video:description>#boxinglearnboxingboxingtips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475590/3475590_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T17:14:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Merayu cewek cantik</video:title>
      <video:description>#Merayu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475589/3475589_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T17:14:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como Fazer Leite de Aveia Caseiro Cremoso e Sem Ficar Baboso.</video:title>
      <video:description>Aprenda a fazer um leite vegetal de aveia ultra cremoso, puro e muito mais barato em casa. #Southkorea #taiwan #vietnam #brazil #china #italy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475588/3475588_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-21T17:14:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kakek genit</video:title>
      <video:description>#Genit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475587/3475587_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T17:13:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>It just makes the audience laugh because of this one video Please watch it #Funny #chicken #people</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475586/3475586_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T17:13:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O menino da Gula</video:title>
      <video:description>Bênção ou maldição #Maldição #bencao</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475585/3475585_720p.mp4</video:content_loc>
      <video:duration>147</video:duration>
      <video:publication_date>2026-09-21T17:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nasi bakar 2</video:title>
      <video:description>#Nasigoreng</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475584/3475584_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:12:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>demon slayer animation</video:title>
      <video:description>demon slayer yeah #demonslayer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475583/3475583_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T17:12:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Kajal Dance 2</video:title>
      <video:description>Indian Girl Kajal Dance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475582/3475582_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T17:12:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wall mounted double sided sensor light for home decor</video:title>
      <video:description>Wall mounted double sided sensor light #sensorlight #useful #gadget #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475581/3475581_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T17:11:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Theatre video</video:title>
      <video:description>#Theatrevideo #amazingvideo #funny #newviral #hotvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475580/3475580_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:11:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>এই মুহূর্তটি মিস করবেন না! দেখে নিন এখনই</video:title>
      <video:description>আসসালামু আলাইকুম বন্ধুরা! আজকের ভিডিওটিতে আপনাদের জন্য রয়েছে দারুণ একটি সারপ্রাইজ। ভিডিওটি শেষ পর্যন্ত দেখলে আপনারা সত্যিই অবাক হয়ে যাবেন। যদি ভিডিওটি আপনাদের ভালো লেগে থাকে, তবে অবশ্যই লাইক, কমেন্ট এবং শেয়ার করতে ভুলবেন না। আর এমন আরও দারুণ সব ভিডিও পেতে চ্যানেলটি সাবস্ক্রাইব করে আমাদের সাথেই থাকুন! ধন্যবাদ সবাইকে। #viralvideo #amazingmoments #trendingnow #mustwatch #amazingclips #popularvideo #amazing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475579/3475579_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T17:11:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 59</video:title>
      <video:description>Compositora Bruna Rafaela de França #CompositoraBrunaRafaeladeFrança</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475578/3475578_720p.mp4</video:content_loc>
      <video:duration>165</video:duration>
      <video:publication_date>2026-09-21T17:10:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>joget brazil</video:title>
      <video:description>joget viral #cewekcantik #cindo #cewekimut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475577/3475577_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T17:10:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475576</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475576/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>লুকিং গ্লাস</video:title>
      <video:description>লুকিং গ্লাস</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475576/3475576_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T17:10:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 8 Hindi dubbed</video:title>
      <video:description>Lawless lawyer episode 8 Hindi dubbed K-drama season 1 #Action #Crime #Romance #Legal #K-dramaHindidubbed #lawlesslawyer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475575/3475575_720p.mp4</video:content_loc>
      <video:duration>3869</video:duration>
      <video:publication_date>2026-09-21T17:09:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>God revealing himself</video:title>
      <video:description>Prophecy is good</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475574/3475574_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-21T17:08:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baru Lagi</video:title>
      <video:description>cewe joget terbaru #cewejoget #trendjoget #seksi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475573/3475573_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:08:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Play with friends 3</video:title>
      <video:description>Play #Frien</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475572/3475572_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T17:07:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ELE ESCONDE SUA IDENTIDADE DE PRÍNCIPE… MAS SEU PODER VAI ENTREGÁ-LO! 😱👑</video:title>
      <video:description>✅ Descrição otimizada para seu vídeo de anime: 🔥 Novo Anime ÉPICO 2026 | Melhores Momentos, Lutas e Emoção Garantida! 🔥 #Anime2026 #MelhorAnime #NovosAnimes #AnimaTasticZone Você é fã de animes cheios de ação, personagens cativantes e histórias que mexem com o coração? Então prepare-se para conhecer o mais novo anime que está conquistando o mundo! Neste vídeo, trazemos os melhores momentos, teorias e tudo que você precisa saber sobre esse lançamento IMPACTANTE! 👉 Descubra os segredos por trás dos personagens 👉 Veja as lutas mais insanas do episódio 👉 Curta, comente e compartilhe com seus amigos otakus! 📌 Inscreva-se no canal AnimaTasticZone para mais conteúdos como esse toda semana! anime 2026, lançamento anime, novo anime #novosanimes #animeépico #melhoreslutasdeanime #cenasemocionantesanime #traileranimenovo #teoriaanime #análiseanime #animereview #AnimaTasticZone #animeviral #animedublado #animelegendado #animerecomendação #animecurto #animeação #animefantasia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475571/3475571_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T17:07:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zehra gunes volleyball match #volleyball</video:title>
      <video:description>Zehra gunes volleyball match #volleyball #zehragunes #vollyballmatch #zehragüneş #sports #shorts.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475570/3475570_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T17:06:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frango Assado Perfeito e Dourado com Batatas Crocantes.</video:title>
      <video:description>Descubra o segredo para conseguir um frango assado incrivelmente suculento, com pele dourada e carne a soltar do osso! #Southkorea #taiwan #vietnam #brazil #italy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475569/3475569_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-21T17:06:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deliverance with the prophet</video:title>
      <video:description>Connect any problem or condition you are in God will see you through distance is not a baeria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475568/3475568_720p.mp4</video:content_loc>
      <video:duration>150</video:duration>
      <video:publication_date>2026-09-21T17:06:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 7 Hindi dubbed</video:title>
      <video:description>Lawless lawyer episode 7 Hindi dubbed K-drama season 1 #Action #Crime #Romance #Legal #K-dramaHindidubbed #lawlesslawyer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475567/3475567_720p.mp4</video:content_loc>
      <video:duration>3895</video:duration>
      <video:publication_date>2026-09-21T17:06:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Makan Malam 2</video:title>
      <video:description>#MakanMalam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475566/3475566_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:05:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ibu muda gemoy</video:title>
      <video:description>#Gemoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475565/3475565_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T17:05:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hail in MULIA Puncak Jaya</video:title>
      <video:description>Hail that occurred in Puncak Jaya Mulia Regency, Papua, Indonesia Until it causes snow to pile up #Natural #incident #PuncakJayaRegency #Papua #Mulia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475564/3475564_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:05:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bermain glop</video:title>
      <video:description>#Glof</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475563/3475563_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:05:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>یہ فصل امیدوں کی ہمدم #reelsviralシ #shorts #solangibha786 2</video:title>
      <video:description>یہ فصل امیدوں کی ہمدم #reelsviralシ #shorts #solangibha786 #یہفصلامیدوںکیہمدمreelsviralシshortssolangibha786</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475562/3475562_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:05:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funnyvidio 2</video:title>
      <video:description>#Funny #animal #cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475561/3475561_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-21T17:04:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPSICUM EGG PASTA DELICIOUS RECIPE!!</video:title>
      <video:description>Ingredients Pasta: 200g (Penne, Macaroni, or Spaghetti) Eggs: 2 large Capsicum (Bell Pepper): 1 medium (sliced or diced) Aromatics: 1 small onion (chopped), 3 cloves garlic (minced) Sauce &amp; Spices: 2 tbsp tomato ketchup, 1 tbsp soy sauce, 1/2 tsp red chili flakes, 1/2 tsp black pepper, salt to taste Cooking Oil: 2 tbsp Step-by-Step Instructions Boil the Pasta Bring a pot of salted water to a boil. Add the pasta and cook according to package instructions until al dente. Drain and set aside, reserving 2 tablespoons of pasta water. Scramble the Eggs Heat 1 tablespoon of oil in a skillet over medium heat. Crack in the eggs, sprinkle with a pinch of salt and black pepper, and scramble until cooked through. Remove from the pan and set aside. Sauté the Vegetables Add the remaining tablespoon of oil to the same skillet. Sauté the minced garlic and chopped onion for 1–2 minutes until soft. Toss in the sliced capsicum and stir-fry on high heat for 2 minutes to keep it crunchy. Combine Sauce &amp; Pasta Lower the heat and stir in the tomato ketchup, soy sauce, red chili flakes, and reserved pasta water. Add the boiled pasta and scrambled eggs to the skillet. Toss &amp; Serve Toss everything together on medium-high heat for 1–2 minutes until the pasta is evenly coated and hot. Adjust salt and pepper to taste, and serve warm. #CAPSICUM #PASTA #EGG #RECIPE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475560/3475560_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T17:04:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam jago 3</video:title>
      <video:description>#Ayam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475559/3475559_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:04:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gadis gemoy</video:title>
      <video:description>#Gemoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475558/3475558_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:03:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum se Tum Tak • Episode 439 • 21 September 2026</video:title>
      <video:description>👍Don&apos;t Forget Like &amp; Follow! #TumseTumTak #ZeeTV #zee5 #zeetvserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475557/3475557_720p.mp4</video:content_loc>
      <video:duration>1348</video:duration>
      <video:publication_date>2026-09-21T17:03:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>#Funny #newfunny #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475556/3475556_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T17:03:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meri Zaryab ko apni Bahu bana lo 😭 | Dar E Nijaat | ARY Digital Drama</video:title>
      <video:description>Meri Zaryab ko apni Bahu bana lo 😭 | Dar E Nijaat | ARY Digital Drama #DarENijaat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475555/3475555_720p.mp4</video:content_loc>
      <video:duration>133</video:duration>
      <video:publication_date>2026-09-21T17:03:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Si hitam manis</video:title>
      <video:description>#Hitam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475554/3475554_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T17:03:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 210</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475553/3475553_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:03:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neng masak</video:title>
      <video:description>#Masak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475552/3475552_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T17:03:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pilih yang mana 3</video:title>
      <video:description>lemesin duluuu #cewektanktop #cewekcantik #cewekmanis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475551/3475551_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:02:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Olah laham</video:title>
      <video:description>#Olahlahan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475550/3475550_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:02:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Membajak kebun</video:title>
      <video:description>#Membajak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475549/3475549_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:02:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mobil merah 2</video:title>
      <video:description>#Mobilmerah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475548/3475548_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T17:01:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anak sekolah 3</video:title>
      <video:description>#Anaksekolah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475547/3475547_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:01:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Failed Kneel Slides</video:title>
      <video:description>#football</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475546/3475546_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T17:01:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita gemoy 2</video:title>
      <video:description>#Gemoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475545/3475545_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:01:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neng neng</video:title>
      <video:description>#Neng</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475544/3475544_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T17:00:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rules-of-Love-2026-Hindi-(Unofficial)-Dubbed-Movie-</video:title>
      <video:description>Rules-of-Love-2026-Hindi-(Unofficial)-Dubbed-Movie-</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475543/3475543_720p.mp4</video:content_loc>
      <video:duration>4816</video:duration>
      <video:publication_date>2026-09-21T17:00:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Putih mempesona 2</video:title>
      <video:description>#Putih</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475542/3475542_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T17:00:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Profil Anasthasia Khosasih, Selebriti Internet Indonesia yang Kerap Mencuri Perhatian Netizen</video:title>
      <video:description>Anasthasia Khosasih adalah seorang konten kreator dan selebriti internet asal Indonesia yang dikenal luas melalui berbagai platform media sosial seperti Instagram dan TikTok. Konten yang diunggah umumnya meliputi aktivitas sehari-hari, fesyen, serta hobi seperti bermain game, yang sering kali menarik perhatian netizen dan memicu berbagai reaksi di kolom komentar #AnasthasiaKhosasih #ProfilAnasthasiaKhosasih #SelebgramIndonesia #InfluencerIndonesia #KontenKreator #GamerGirlIndonesia #BrandAmbassador #FashionInspo #OOTDIndo #SelebgramHits #NetizenIndonesia #ViralHariIni #TrendingIndonesia #GossipArtis #FYPIndonesia #ExplorePage #ReelsInstagram</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475541/3475541_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T17:00:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayah sayang</video:title>
      <video:description>Ayah #Ayah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475540/3475540_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T17:00:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Maddies-Secret-(2026)-Hindi-(Unofficial)-Dubbed-Movie</video:title>
      <video:description>Maddies-Secret-(2026)-Hindi-(Unofficial)-Dubbed-Movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475539/3475539_720p.mp4</video:content_loc>
      <video:duration>6143</video:duration>
      <video:publication_date>2026-09-21T16:59:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 6 Hindi dubbed K-drama</video:title>
      <video:description>Lawless lawyer episode 6 Hindi dubbed K-drama season 1 #LawlessLawyerEpisode5 #LawlessLawyerEpisode5HindiDubbed #LawlessLawyerHindiDubbed #LawlessLawyerHindi #LawlessLawyerEp5 #LawlessLawyerKDrama #LawlessLawyerKoreanDrama #KoreanDramaHindiDubbed #KDramaHindiDubbed #KoreanSeriesHindiDubbed #HindiDubbedKoreanDrama #LawlessLawyerHindiEpisode</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475538/3475538_720p.mp4</video:content_loc>
      <video:duration>3918</video:duration>
      <video:publication_date>2026-09-21T16:57:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Jammy Thapa Dance</video:title>
      <video:description>Indian Girl Jammy Thapa Dance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475537/3475537_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T16:57:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The-Laksman-2026-Hindi-(Unofficial)-Dubbed-</video:title>
      <video:description>The-Laksman-2026-Hindi-(Unofficial)-Dubbed-</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475536/3475536_720p.mp4</video:content_loc>
      <video:duration>4181</video:duration>
      <video:publication_date>2026-09-21T16:57:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lost in Bangkok’s Embrace</video:title>
      <video:description>What started as a simple getaway to Thailand turned into an emotional whirlwind. The moment my eyes met Chayanit’s, my world shifted. Her gentle warmth, mesmerizing grace, and that signature Thai charm slowly shattered every wall I had built around my heart. Walking through the vibrant streets of Bangkok, I found myself deeply entangled in a sweet temptation I never saw coming. A story of unexpected love, cultural barriers, and a heart that refused to listen to reason. #RomanceNovel #WattpadStories #LoveInBangkok #ThaiRomance #RomanticDrama #AmWriting #BookTok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475535/3475535_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T16:57:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What a delicious mom!</video:title>
      <video:description>#Franca</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475534/3475534_720p.mp4</video:content_loc>
      <video:duration>336</video:duration>
      <video:publication_date>2026-09-21T16:57:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Heartbeat-of-a-Drum-Horse-(2025)-Hindi-(Unofficial)-Dubbed</video:title>
      <video:description>Heartbeat-of-a-Drum-Horse-(2025)-Hindi-(Unofficial)-Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475533/3475533_720p.mp4</video:content_loc>
      <video:duration>5048</video:duration>
      <video:publication_date>2026-09-21T16:56:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The 1987 Chicago TV Hijack That The FBI Never Solved | Case File #010</video:title>
      <video:description>November 22, 1987: An unknown pirate hijacked two live television network broadcasts in Chicago. Decades later, federal agencies hold zero suspects. Full technical dossiers in the vault. #MaxHeadroomincident #piratebroadcast #unsolvedmysteries #analoghorror #coldcase #StaticFiles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475532/3475532_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-21T16:56:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Killer-Thong-(2025)-Hindi-(Unofficial)-Dubbed</video:title>
      <video:description>Killer-Thong-(2025)-Hindi-(Unofficial)-Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475531/3475531_720p.mp4</video:content_loc>
      <video:duration>5838</video:duration>
      <video:publication_date>2026-09-21T16:55:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Help pleaseee</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475530/3475530_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T16:55:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Golden Lengha Design</video:title>
      <video:description>Trendy Design</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475529/3475529_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T16:54:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cewe joget 2</video:title>
      <video:description>cewe joget seksi #cewejoget #jogetseksi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475528/3475528_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T16:54:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prayer 35</video:title>
      <video:description>Berdoalah kepada Alloh swt #shortvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475527/3475527_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-21T16:54:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Virgem Aparecida: Cântico e Louvor na Celebração da Santa Missa.</video:title>
      <video:description>Acompanhe este lindo momento de fé, devoção e louvor durante a celebração litúrgica na igreja. #Southkorea #unitedstates #italy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475526/3475526_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-09-21T16:54:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Heat touch Islamic Video</video:title>
      <video:description>Allah Ka Zikr 🤍🌸Beautiful 👌</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475525/3475525_720p.mp4</video:content_loc>
      <video:duration>156</video:duration>
      <video:publication_date>2026-09-21T16:53:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vaca malhada #piadascurtas #comedia #humor</video:title>
      <video:description>#humorcomediacurta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475524/3475524_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T16:53:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatinho com celular rindo A risada mais fofa da internet!</video:title>
      <video:description>A risada mais fofa da internet! 🐱📱😹 &quot;Gatinho com celular rindo&quot; é um vídeo divertido e irresistível que mostra um felino se divertindo (e muito!) com o celular, soltando gargalhadas que vão contagiar qualquer um. Com expressões únicas e uma energia contagiante, essa produção é perfeita para os amantes de pets e para quem precisa de uma dose extra de alegria. Dê o play e ria junto com esse gatinho! ✨😂 #Gatinhocomcelularrindo #gatorindo #gatocomcelular #gatoengraçado #felinorindo #vídeodegato #petsengraçados #gatodivertido #risadadegato #vídeoviral #fofura #gatocomtelefone #animaisrindo #vídeopararir #momentopet #gatobrincando #vídeocontagioso #humoranimal #gatofofo #vídeodescontraído</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475523/3475523_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T16:53:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby n goat kids 😍</video:title>
      <video:description>Baby n goat kids 😍 #Baby #goat #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475522/3475522_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:52:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A verdade por trás da lenda  &quot;o Saci &quot;</video:title>
      <video:description>A história de Zinzala,príncipe africano que foi sequestrado e levado para o Brasil.... #GraçaBarros #Audiobooks #jornadadaalma</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475521/3475521_720p.mp4</video:content_loc>
      <video:duration>1519</video:duration>
      <video:publication_date>2026-09-21T16:52:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition 8</video:title>
      <video:description>#Generator #Transition #toy #ai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475520/3475520_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:52:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Twinkle twinkle little star 8</video:title>
      <video:description>Nursery rhymes #Nurseryrhymes #kids #trending #viral #twinklelittlestar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475519/3475519_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:52:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A maior lição que eu aprendi esse ano</video:title>
      <video:description>#reflexaoreflexionmotivacaomotivacionfyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475518/3475518_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T16:52:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bitccoin is one of the digital assets or digital currencies of the future</video:title>
      <video:description>The development of the current era is a change in the modern era introduced by one of the digital asset bitcoins</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475517/3475517_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T16:52:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition 7</video:title>
      <video:description>#Generator #Transition #toy #ai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475516/3475516_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:51:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>penyesalan 2</video:title>
      <video:description>Realizing #shortvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475515/3475515_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-21T16:51:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏆 Bora caçar verificados! 98</video:title>
      <video:description>🎧 FONE FIFINE H9 — RECOMENDO PRA VOCÊ! 🔗 https://onelink.shein.com/53/62f00ud4axhp?ismg_ol=GIt6n7MVzkN_01_KOC-C ✅ Som potente, perfeito pra ouvir passos no FF ✅ Microfone incluso pra conversar com galera ✅ Confortável pra jogar horas sem incomodar ✅ Preço bom demais! 💡 Compre por esse link e me ajuda sem gastar nada a mais! Obrigado! 🐎🔥 ⚠️ Esse vídeo contém link de afiliado</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475514/3475514_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T16:50:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dar e Nijaat Episode 14 | Sheheryar Munawar | Best Scene | ARY Digital</video:title>
      <video:description>Dar e Nijaat Episode 14 | Sheheryar Munawar | Best Scene | ARY Digital #ARYDigital</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475513/3475513_720p.mp4</video:content_loc>
      <video:duration>219</video:duration>
      <video:publication_date>2026-09-21T16:50:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m busy all day</video:title>
      <video:description># charli d&apos;amelio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475512/3475512_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T16:50:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>M pap janm dekouraje</video:title>
      <video:description>Lorsque le découragement, la peur, l&apos;abandon nous frappent comptons sur le Seigneur Jésus. Cette nous chanson nous rappelle de placer la confiance en lui. Lui seul est capable de renouveler notre force. Believe in Jesus. #Abandon #effroi #découragement #peur #courage #foi #confiance #renouvellement #promesse #honteDésespoir #espoir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475511/3475511_720p.mp4</video:content_loc>
      <video:duration>428</video:duration>
      <video:publication_date>2026-09-21T16:50:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A melhor decisão que eu já tomei</video:title>
      <video:description>#reflexaoreflexionmotivacaomotivacionfyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475510/3475510_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T16:50:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Es Jeruk</video:title>
      <video:description>#Esjeruk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475509/3475509_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:49:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngbrol siang</video:title>
      <video:description>#NgbrolSiang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475508/3475508_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:49:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan santai</video:title>
      <video:description>#Jalansantai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475507/3475507_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T16:48:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>assmae</video:title>
      <video:description>#canada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475506/3475506_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T16:47:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beli roti 2</video:title>
      <video:description>#Beliroti</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475505/3475505_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:47:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nada parará o enviado de Deus</video:title>
      <video:description>Nada parará o enviado de Deus #NadapararáoenviadodeDeus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475504/3475504_720p.mp4</video:content_loc>
      <video:duration>199</video:duration>
      <video:publication_date>2026-09-21T16:47:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Urut mood</video:title>
      <video:description>#Urut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475503/3475503_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:47:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu nunca vi uma frase tão verdadeira como essa</video:title>
      <video:description>#reflexãomotivacaofypvideoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475502/3475502_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T16:47:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Transformers</video:title>
      <video:description>Transformers Age Of Extinction #transformers #movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475501/3475501_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-21T16:47:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral Car Driving Reel Tutorial</video:title>
      <video:description>Viral Car Driving Reel Tutorial 🔥 ✨ Flow AI Video Prompt এর জন্য - Comment &quot;CAR&quot; Prompt-টি আপনার ইনবক্সে পাঠিয়ে দেব 🚀 : #viralreels #reelitfeelit #fypage #cardriving #ReelViral #FlowAI #GoogleFlow #AIVideo #AIVideoGenerator #AIVideoEditing #ViralVideo #ViralReels #InstagramReels #ReelsTips #AIEditing #AIContent #ContentCreator #AICreator #CarVideo #CinematicCar #CarReels #ViralCarVideo #VideoEditing #AITricks #AITools #TechTips #TrendingReels #Shorts #YouTubeShorts #TikTokTips Flow AI car video, Google Flow AI tutorial, AI car video generator, viral car video, how to make viral car videos, AI video editing tutorial, Flow AI video editing, cinematic car video AI, AI photo to video, AI image to video, viral Instagram reels, Instagram viral video tutorial, AI reels tutorial, cinematic AI video, AI video generator, create car video with AI, viral AI video, AI content creation, best AI video tools, AI editing tricks, 9:16 AI video, smartphone car video effect, trending AI video 2026 #FlowAIcarvideo #GoogleFlowAItutorial #AIcarvideogenerator #viralcarvideo #howtomakeviralcarvideos #AIvideoeditingtutorial #FlowAIvideoediting #cinematiccarvideoAI #AIphototovideo #AIimagetovideo #viralInstagramreels #Instagramviralvideotutorial #AIreelstutorial #cinematicAIvideo #AIvideogenerator #createcarvideowithAI #viralAIvideo #AIcontentcreation #bestAIvideotools #AIeditingtricks #916AIvideo #smartphonecarvideoeffect #trendingAIvideo2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475500/3475500_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T16:47:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tarzan 4</video:title>
      <video:description>#Tarzan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475499/3475499_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T16:46:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yung 🔥</video:title>
      <video:description>#Hindi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475498/3475498_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T16:45:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berpelukan</video:title>
      <video:description>#Berpelukan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475497/3475497_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T16:45:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Burung yang genit</video:title>
      <video:description>#Burung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475496/3475496_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:45:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless Lawyer Episode 5 | Hindi Dubbed | Korean Drama | K-Drama</video:title>
      <video:description>Watch Episode 5 of the Korean drama Lawless Lawyer in Hindi. A gripping K-Drama filled with action, revenge, romance and courtroom drama. 🎬 Drama: Lawless Lawyer 🎞️ Episode: 5 🌏 Country: South Korea 🗣️ Language: Hindi Dubbed 📺 Genre: Action | Crime | Romance | Legal If you enjoy Hindi-dubbed K-Dramas, follow for more episodes and Korean dramas. #LawlessLawyerEpisode5 #LawlessLawyerEpisode5HindiDubbed #LawlessLawyerHindiDubbed #LawlessLawyerHindi #LawlessLawyerEp5 #LawlessLawyerKDrama #LawlessLawyerKoreanDrama #KoreanDramaHindiDubbed #KDramaHindiDubbed #KoreanSeriesHindiDubbed #HindiDubbedKoreanDrama #LawlessLawyerHindiEpisode #Action #Crime #Romance #Legal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475495/3475495_720p.mp4</video:content_loc>
      <video:duration>3744</video:duration>
      <video:publication_date>2026-09-21T16:45:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kursi yang indah</video:title>
      <video:description>#Kursiyangindah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475494/3475494_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T16:45:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Panen kacang</video:title>
      <video:description>#Kacang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475493/3475493_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T16:44:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Edukasi, Motivasi, Inspirasi, Faktaunik, Quotes, febspot video, viral, fyp, shorts, tutorial, 60</video:title>
      <video:description>Edukasi, Motivasi, Inspirasi, Faktaunik, Quotes, febspot video, viral, fyp, shorts, tutorial, #Edukasi #Motivasi #Inspirasi #Faktaunik #Quotes #febspotvideo #viral #fyp #shorts #tutorial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475492/3475492_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T16:44:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Roushan - Hold Me Close (Legendado)</video:title>
      <video:description>🎵 ROUSHAN – Hold Me Close | Legendado em Português 🎵 Uma música envolvente e romântica sobre estar perto de alguém especial e encontrar paz, calor e segurança em sua presença. ❤️ “Hold Me Close” transmite uma atmosfera íntima e suave, falando sobre olhos que brilham sob a luz dourada, caminhadas durante a noite, sorrisos que mostram o caminho e aquele desejo de permanecer ao lado de quem amamos. ✨ “Hold me close, hold me close…” Um pedido simples, mas cheio de sentimento: ficar perto, aproveitar o momento e não deixar esse vínculo desaparecer. 🎧 Coloque os fones, aproveite a música e acompanhe a tradução em português. Se você gosta de músicas românticas, eletrônicas e envolventes com letras marcantes, inscreva-se no canal e acompanhe os próximos lançamentos. 🔔 💙 ROUSHAN – Hold Me Close 🎶 Original Mix 🇧🇷 Música legendada em português #ROUSHANHoldMeClose #ROUSHANHoldMeCloselegendado #HoldMeCloselegendado #HoldMeClosetradução #ROUSHANBebeOriginalMix #músicalegendada #músicaromântica #músicaeletrônicaromântica #músicaromânticalegendada #músicaeletrônica #romanticmusic #electronicmusic #HoldMeCloselyrics #HoldMeCloseportuguês #músicasparaouvir #músicasromânticas2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475491/3475491_720p.mp4</video:content_loc>
      <video:duration>223</video:duration>
      <video:publication_date>2026-09-21T16:43:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition Ant</video:title>
      <video:description>#Generator #Transition #toy #ant</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475490/3475490_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:43:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mainan anak 15</video:title>
      <video:description>Mainan anak anak miniatur mobil mobilan dan musik #Anak #mainan #mobil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475489/3475489_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T16:43:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saiba escolher</video:title>
      <video:description>Na vida aqui saber escolher bem as amizade</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475488/3475488_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-21T16:43:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition 6</video:title>
      <video:description>#Generator #Transition #toy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475487/3475487_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:43:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Jyoti Kohli Dance 6</video:title>
      <video:description>Indian Girl Jyoti Kohli Dance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475486/3475486_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-21T16:42:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Edukasi, Motivasi, Inspirasi, Faktaunik, Quotes, febspot video, viral, fyp, shorts, tutorial, 59</video:title>
      <video:description>Edukasi, Motivasi, Inspirasi, Faktaunik, Quotes, febspot video, viral, fyp, shorts, tutorial, #Edukasi #Motivasi #Inspirasi #Faktaunik #Quotes #febspotvideo #viral #fyp #shorts #tutorial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475485/3475485_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T16:42:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475484</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475484/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yamaha aerox Modification style</video:title>
      <video:description>Yamaha aerox Modification style #Yamaha #aerox #Modification #motorcycle #show</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475484/3475484_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T16:42:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Encher garrafas com as cores certas Um desafio divertido e cheio de cores!</video:title>
      <video:description>Um desafio divertido e cheio de cores! 🎨🍾 &quot;Encher garrafas com as cores certas&quot; é um vídeo criativo que mostra uma brincadeira envolvente de combinar e preencher garrafas com as cores correspondentes. Com ritmo, precisão e muita satisfação visual, essa produção é perfeita para quem gosta de conteúdos curiosos, desafios e experimentos coloridos. Dê o play e divirta-se com essa experiência única! ✨🌈 #Enchergarrafascomascorescertas #garrafascoloridas #cores #desafiodecores #brincadeiracomgarrafas #experimentovisual #vídeocriativo #conteúdosatisfatório #vídeodivertido #desafio #coresvibrantes #vídeohipnotizante #DIY #façavocêmesmo #vídeoviral #brincadeiraeducativa #aprendizadodecores #vídeodescontraído #experimentocolorido #atividadeinfantil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475483/3475483_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-21T16:42:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours (Hindi) - S01 Ep 04</video:title>
      <video:description>#ALoveOtherThanYours #ALoveOtherThanYoursdrama #ALoveOtherThanYoursK-drama #ALoveOtherThanYoursseries #ALoveOtherThanYoursKoreandrama #ALoveOtherThanYoursromance #ALoveOtherThanYoursstory #ALoveOtherThanYourscast #ALoveOtherThanYoursepisode #Koreandrama #K-drama #romancedrama #romanticseries #lovestory #Koreanromance #emotionaldrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475482/3475482_720p.mp4</video:content_loc>
      <video:duration>3881</video:duration>
      <video:publication_date>2026-09-21T16:42:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BACK IN HER PRIME.</video:title>
      <video:description>I hope you like my video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475481/3475481_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T16:41:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition 5</video:title>
      <video:description>#Generator #Transition #toy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475480/3475480_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T16:41:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The most beautiful place in Sylhet right now ❤️‍🩹</video:title>
      <video:description>The most beautiful place in Sylhet right now ❤️‍🩹</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475479/3475479_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T16:41:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yamaha XSR modifikasi</video:title>
      <video:description>Yamaha XSR modifikasi #Yamaha #XSR #modifikasi #motor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475477/3475477_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T16:41:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Edukasi, Motivasi, Inspirasi, Faktaunik, Quotes, febspot video, viral, fyp, shorts, tutorial, 58</video:title>
      <video:description>Edukasi, Motivasi, Inspirasi, Faktaunik, Quotes, febspot video, viral, fyp, shorts, tutorial, #Edukasi #Motivasi #Inspirasi #Faktaunik #Quotes #febspotvideo #viral #fyp #shorts #tutorial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475476/3475476_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T16:41:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reggae Music Lovers – No Rush Love _ Vibe Apaixonante</video:title>
      <video:description>Reggae Music Lovers – No Rush Love _ Vibe Apaixonante #reggaeloversmusic #reggaelovers #norushlove #reggaemusic #lovereggae #reggaelovesong #reggaevibes #reggaelovesongs #reggaelove #reggaeparaapaixonados #reggaeromantico #reggaeromanticointernacional #loversrock #reggaeinternacional #romanticreggaesongs #romanticreggae #officialmusicvideo #reggaeroots #reggae #reggaepararelaxar #musicasertaneja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475475/3475475_720p.mp4</video:content_loc>
      <video:duration>206</video:duration>
      <video:publication_date>2026-09-21T16:41:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475474</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475474/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition 4</video:title>
      <video:description>#Generator #Transition #toy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475474/3475474_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:41:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I need more view in my video 5</video:title>
      <video:description>I want my video to generate #ComedianUduak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475473/3475473_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-21T16:40:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Honda Vario Modification style 2</video:title>
      <video:description>Honda Vario Modification style #Honda #Vario #Modification #matic #style</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475472/3475472_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T16:40:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition 3</video:title>
      <video:description>#Generator #Transition #toy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475471/3475471_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T16:40:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Honda Vario Modification style</video:title>
      <video:description>Honda Vario Modification style #Honda #Vario #Modification #matic #style</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475470/3475470_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T16:39:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nascar</video:title>
      <video:description>#nascarnascarcupseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475469/3475469_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T16:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ato Gofur</video:title>
      <video:description>King Ato gofur #Adventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475468/3475468_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T16:39:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475467</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475467/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masula Indah is making me delusional</video:title>
      <video:description>I can’t even think straight anymore because Masula Indah is making me completely delusional. Every little thing they do leaves me daydreaming about a future that only exists in my head. #MasulaIndah #DelusionalEra #DaydreamingOfYou #LivingInMyHead #FakeScenarios #LostInThough #HopelessRomantic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475467/3475467_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T16:38:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>São Daniel Comboni: O Missionário Sem Limites e Pai dos Povos Africanos.</video:title>
      <video:description>Conheça a impressionante história de São Daniel Comboni, um homem de fé inabalável que dedicou e entregou toda a sua vida pelo continente africano! #Southkorea #unitedstates #italy #brazil #africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475466/3475466_720p.mp4</video:content_loc>
      <video:duration>127</video:duration>
      <video:publication_date>2026-09-21T16:38:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The First Heart Transplant: A Medical Miracle That Changed the World</video:title>
      <video:description>Discover the incredible history and groundbreaking science behind heart transplantation! From Dr. Christiaan Barnard&apos;s world-first surgery in 1967 to modern &quot;Heart in a Box&quot; technology, learn how medical miracles happen. How do doctors keep a heart alive outside the body? In this video, we explore the fascinating journey of heart transplants. We break down the historical 1967 breakthrough in South Africa, India&apos;s landmark legal and medical evolution in 1994, and the rigorous medical testing required to match donors with recipients. Plus, get an inside look at the incredible logistics of organ transport, including 4°C preservation, cutting-edge machine perfusion, and high-speed &quot;Green Corridors.&quot; Call to Action: If you found this medical history fascinating, hit the LIKE button and SUBSCRIBE for more deep dives into science and medical breakthroughs! Let us know in the comments what you think about the &quot;Heart in a Box&quot; technology. #hearttransplant #medicalhistory #ChristiaanBarnard #GrooteSchuurHospital #howorgantransplantworks #heartinaboxtechnology #organdonation #medicalmiracles #sciencedocumentary #humanheart #medicalcompatibility #organpreservation #medicaltransport #greencorridororgantransport #biologyexplained #USmedicalscience #healthandmedicine #cardiology</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475465/3475465_720p.mp4</video:content_loc>
      <video:duration>332</video:duration>
      <video:publication_date>2026-09-21T16:38:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Book of Ruth, Chapters 1–4, is a beautiful story of faith, loyalty, love, redemption, and God’s </video:title>
      <video:description>The Book of Ruth, Chapters 1–4, is a beautiful story of faith, loyalty, love, redemption, and God’s faithfulness. When Naomi loses her husband and sons, Ruth makes a life-changing decision: she refuses to leave Naomi and chooses to follow her, declaring her devotion to Naomi and to the God of Israel. From the fields of Bethlehem to Ruth’s encounter with Boaz, God quietly works behind the scenes. Ruth’s faithfulness leads to unexpected blessing, redemption, and a new beginning. ✨ In this video, discover: 📖 Ruth 1 — Ruth’s loyalty to Naomi 🌾 Ruth 2 — Ruth meets Boaz while gleaning in the fields ❤️ Ruth 3 — Ruth seeks redemption and Boaz responds with kindness 👑 Ruth 4 — Boaz becomes Ruth’s redeemer, and their family becomes part of the lineage of King David—and ultimately Jesus Christ 🙏 Key Message: Even when we cannot see what God is doing, He is working through every circumstance according to His purpose. “Where you go I will go, and where you stay I will stay. Your people will be</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475464/3475464_720p.mp4</video:content_loc>
      <video:duration>787</video:duration>
      <video:publication_date>2026-09-21T16:38:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition 2</video:title>
      <video:description>#Generator</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475463/3475463_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T16:37:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Makan bakso 3</video:title>
      <video:description>#Bakso</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475462/3475462_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T16:37:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menemani tidur</video:title>
      <video:description>#Menemani</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475461/3475461_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:37:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita hijab</video:title>
      <video:description>#Hijab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475460/3475460_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T16:36:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475459</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475459/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cd putih</video:title>
      <video:description>#Cdputih</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475459/3475459_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T16:36:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475458</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475458/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>maman nada</video:title>
      <video:description>#nizar_sbiti#ilyaselmaliki #الدارالبيضاء_المغرب #اروبا_تركيا_فرنسا_امريكا Originalton - 🌺نغمات بلادي🌺</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475458/3475458_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T16:36:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475457</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475457/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagi. Hamil</video:title>
      <video:description>#Hamil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475457/3475457_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:35:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475456</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475456/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Putih mempesona</video:title>
      <video:description>#Putihmempesona</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475456/3475456_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T16:35:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475455</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475455/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>masulaindah hijab tobrut indo viral</video:title>
      <video:description>@masulaindah hijab tobrut indo viral tiktok seleb #viral #tiktok #fyp #girl #hot #sexy #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475455/3475455_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T16:35:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475454</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475454/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VIRAL!! CCTV Captures Moment of Motorcycle Crash — Rude Drivers Blamed!</video:title>
      <video:description>CCTV footage has captured the moment of a traffic accident involving two motorcyclists, allegedly caused by selfish driving behavior. At a curved intersection, a speeding motorcycle collided with another that was crossing the road. The incident sparked public outrage as neither rider was willing to give way, resulting in a crash! #TrafficAccidentMotorcycleCrashCCTVFootageRoadSafetyDontBeSelfishViralIndonesia21September2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475454/3475454_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T16:35:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Generator Transition</video:title>
      <video:description>#Generator</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475453/3475453_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T16:34:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475452</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475452/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DHAMAAL 4 : Part -3A (Febspot) Enjoy Comedy</video:title>
      <video:description>When a burnt treasure map leads to a secret location on a remote island, Guddu (Ajay Devgn), Lallan (Riteish Deshmukh), Adi (Arshad Warsi), and Manav (Jaaved Jaaferi) find themselves locked in another high-stakes race. They must navigate pirate traps, mistaken identities, and personal mishaps to locate the legendary &quot;Shaitaan Singh&apos;s treasure&quot;—all while competing against rival fortune hunters and their own persistent bad luck. #Dhamaal4releasedate #Dhamaal4moviecast #AjayDevgnDhamaal4 #Dhamaal4trailer #Dhamaal4plotstory</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475452/3475452_720p.mp4</video:content_loc>
      <video:duration>616</video:duration>
      <video:publication_date>2026-09-21T16:33:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475451</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475451/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motorcycle 18</video:title>
      <video:description>#Otomotif</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475451/3475451_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T16:33:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475450</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475450/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MALANG CITY AT NIGHT</video:title>
      <video:description>This is a view of the city of Malang, East Java, Indonesia at night. #malangcity #eastjava #indonesia #night</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475450/3475450_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-21T16:33:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bojpori hot 2</video:title>
      <video:description>Bojpori dj hot sons</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475449/3475449_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T16:33:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tamanho desses morango</video:title>
      <video:description>Morango</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475448/3475448_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T16:33:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Food is life 4</video:title>
      <video:description>Japanese’s food #Foodtrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475447/3475447_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T16:32:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475446</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475446/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gato caçando rato</video:title>
      <video:description>Gato</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475446/3475446_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T16:30:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Toxic Syrup Scandal: How Cheap Medicine Became Deadly</video:title>
      <video:description>How did everyday cough syrup lead to a global medical tragedy? We uncover the dark reality behind low-cost generic drug manufacturing, toxic contaminants like ethylene glycol, and why cut corners in quality control cost children their lives. 🔔 Subscribe to Health Untold Stories for real medical investigations and health revelations: https://www.youtube.com/@healthuntoldstories 📌 In this video, we cover: The difference between active pharmaceutical ingredients (APIs) and inactive additives. How toxic solvents like ethylene glycol enter the medicine supply chain. The devastating condition known as Hemolytic Uremic Syndrome (HUS) and kidney failure. The international fallout in Uzbekistan, The Gambia, and beyond. What consumers need to know about generic medication safety and medical oversight. #toxiccoughsyrup #contaminatedcoughsyrup #genericvsbrandnamedrugs #ethyleneglycolpoisoning #hemolyticuremicsyndrome #pharmascandaldocumentary #drugsafetyregulation #healthuntoldstories #medicinequalitycontrol #globalpharmainvestigation #genericmedicationdangers #fdadrugstandards #childsafetymedicine #medicalmalpracticedocumentary</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475445/3475445_720p.mp4</video:content_loc>
      <video:duration>219</video:duration>
      <video:publication_date>2026-09-21T16:30:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Artificial fruit plant for home decor</video:title>
      <video:description>Artificial fruit plant for home decor #artificialfruit #plant #useful #gadget #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475444/3475444_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T16:30:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fall 2: Deadpoint (2026) Full Movie</video:title>
      <video:description>Fall 2 Deadpoint 2026 fall 2 deadpoint full movie 2026, fall 2 deadpoint full movie, fall 2 deadpoint 2026 movie, fall 2 deadpoint movie 2026, fall 2 deadpoint full movie hindi, fall 2 deadpoint full movie in english, fall 2 full movie 2026, fall 2 deadpoint 2026, fall 2 deadpoint movie, fall 2 deadpoint movie recap, fall 2 deadpoint movie tamil, fall 2 deadpoint movie facts, fall 2 deadpoint 2026 trailer, fall 2 deadpoint movie review, fall 2 deadpoint movie ending, fall 2 deadpoint hollywood movie, fall 2: deadpoint full movie explained in hindi #fall2deadpointfullmovie2026 #fall2deadpointfullmovie #fall2deadpoint2026movie #fall2deadpointmovie2026 #fall2deadpointfullmoviehindi #fall2deadpointfullmovieinenglish #fall2fullmovie2026 #fall2deadpoint2026 #fall2deadpointmovie #fall2deadpointmovierecap #fall2deadpointmovietamil #fall2deadpointmoviefacts #fall2deadpoint2026trailer #fall2deadpointmoviereview #fall2deadpointmovieending #fall2deadpointhollywoodmovie #fall2deadpointfullmovieexplainedinhindi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475443/3475443_720p.mp4</video:content_loc>
      <video:duration>5408</video:duration>
      <video:publication_date>2026-09-21T16:30:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Air terjun putih</video:title>
      <video:description>#Airterjun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475442/3475442_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T16:29:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mancing ikan laut</video:title>
      <video:description>#Mancing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475441/3475441_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T16:29:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja wanita</video:title>
      <video:description>#Ninja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475440/3475440_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:28:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buah kelapa 2</video:title>
      <video:description>#Kelapa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475439/3475439_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T16:28:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cemping malm</video:title>
      <video:description>#Cemping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475438/3475438_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T16:27:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju besi</video:title>
      <video:description>#Bajubesi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475437/3475437_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T16:27:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sanju and</video:title>
      <video:description>#sanju sir #paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475436/3475436_720p.mp4</video:content_loc>
      <video:duration>198</video:duration>
      <video:publication_date>2026-09-21T16:26:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bolinhas na bexiga de sopro Uma experiência visual divertida e cheia de cores!</video:title>
      <video:description>Uma experiência visual divertida e cheia de cores! 🎈✨ &quot;Bolinhas na bexiga de sopro&quot; é um vídeo criativo que mostra o efeito hipnotizante de bolinhas se movimentando dentro de uma bexiga inflável. Com cores vibrantes e movimentos únicos, essa produção é perfeita para quem gosta de conteúdos curiosos, experimentos visuais e momentos de pura descontração. Dê o play e se surpreenda com essa brincadeira! 🎨🌀 #Bolinhasnabexigadesopro #bexigadesopro #bolinhascoloridas #experimentovisual #brincadeiracombexiga #efeitovisual #vídeocriativo #coresvibrantes #conteúdocurioso #vídeodivertido #experiênciasensorial #bexigainflável #bolinhasdeplástico #vídeohipnotizante #DIY #façavocêmesmo #vídeoviral #brincadeirainfantil #movimentoecor #vídeodescontraído</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475435/3475435_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T16:25:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>douda</video:title>
      <video:description>‏💃🏼💃🏼💃🏼💃🏼💃🏼 @👑DouniaBellaOfficiel👑🎤🎬 #المغرب🇲🇦تونس🇹🇳الجزائر🇩🇿تركيا🇹🇷_العراق🇮🇶 #paris #المغرب🇲🇦تونس🇹🇳الجزائر🇩🇿تركيا🇹🇷_العراق #دنياوإحساس #تركيا</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475434/3475434_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-21T16:25:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hydraulic Press Crushing a Copper Pipe | Satisfying Metal ASMR</video:title>
      <video:description>What happens when a heavy industrial hydraulic press flattens a solid, shiny copper pipe? Watch the intense deformation process as extreme pressure crumples the thick metallic structure into a flattened sheet, accompanied by deep, resonant, and crunchy metal ASMR sounds. #hydraulicpressasmr #crushingcopperpipe #metalcrushing #satisfyingmetalcrunch #extremepressure #tactileasmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475433/3475433_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T16:24:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MindRhymes - Palhaço Assassino</video:title>
      <video:description>MindRhymes - Palhaço Assassino #travel #paris #france #music #rap #hiphop #eminemtypebeat #dorama #joker</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475432/3475432_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-21T16:23:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yazeed per aitrazz _ Sharab Badkari_ Jaffar Ishaq and Abulkalam Azam _ Banuummaiaa #maulanaishaq</video:title>
      <video:description>Yazeed per aitrazz _ Sharab Badkari_ Jaffar Ishaq and Abulkalam Azam _ Banuummaiaa #maulanaishaq</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475431/3475431_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T16:22:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kepala kambing</video:title>
      <video:description>#Kambing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475430/3475430_720p.mp4</video:content_loc>
      <video:duration>129</video:duration>
      <video:publication_date>2026-09-21T16:22:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teofimo Lopes</video:title>
      <video:description>Teofimo #Teofimolopez #boxing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475429/3475429_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T16:22:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sanju</video:title>
      <video:description>englis#viralreels #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475428/3475428_720p.mp4</video:content_loc>
      <video:duration>517</video:duration>
      <video:publication_date>2026-09-21T16:22:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Africa 38</video:title>
      <video:description>And it&apos;s own</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475427/3475427_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:21:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Floyd</video:title>
      <video:description>Floyd #Boxing #floyd</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475426/3475426_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T16:21:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer ep 4 Hindi dubbed</video:title>
      <video:description>Lawless lawyer episode 4 Hindi dubbed K-drama #LawlessLawyer #LawlessLawyerkdrama #LeeJoonGi #SeoYeJi #legalkdrama #lawkdrama #crimekdrama #actionkdrama #thrillerkdrama #revengekdrama #gangsterlawyer #badasslawyer #justicekdrama #courtroomkdrama #bestlegalkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475425/3475425_720p.mp4</video:content_loc>
      <video:duration>3837</video:duration>
      <video:publication_date>2026-09-21T16:21:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Morango gigante 4</video:title>
      <video:description>Morango</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475424/3475424_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T16:20:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call Of Duty 4</video:title>
      <video:description>Call Of Duty #Callofduty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475423/3475423_720p.mp4</video:content_loc>
      <video:duration>141</video:duration>
      <video:publication_date>2026-09-21T16:20:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pepino 3</video:title>
      <video:description>Pepino</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475422/3475422_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T16:19:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ultimate Nighttime Routine! 3 Simple Habits for Evening Recovery 💫</video:title>
      <video:description>The Ultimate Nighttime Routine! 3 Simple Habits for Evening Recovery 💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475421/3475421_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T16:19:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😳😳😳😳😳 2</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475420/3475420_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T16:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pé de ameixa amarelo</video:title>
      <video:description>Plantas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475419/3475419_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T16:19:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Klipaja.id</video:title>
      <video:description>https://klipaja.id/a/CLIPAQK1 #Klipajaid</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475418/3475418_720p.mp4</video:content_loc>
      <video:duration>143</video:duration>
      <video:publication_date>2026-09-21T16:19:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arts of Life</video:title>
      <video:description>It&apos;s a life with principal and immotions. #LifeArtsJeevan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475417/3475417_720p.mp4</video:content_loc>
      <video:duration>2159</video:duration>
      <video:publication_date>2026-09-21T16:18:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lasanha de Frigideira Cremosa – Receita Rápida e Feita Sem Forno</video:title>
      <video:description>Prepare uma lasanha de frigideira deliciosa e prática, feita sem forno e pronta em minutos. Receita cremosa com carne moída, molho encorpado e muito queijo. Ingredientes da Lasanha de Frigideira 1 colher de sopa de óleo 1 cebola pequena picada 500 g de carne moída 1 colher de chá de sal 1 colher de chá de tempero caseiro ou pronto 1 caixinha de molho de tomate (340 g) 1 xícara (200 ml) de água 250 g de massa fresca para lasanha 300 g de muçarela ralada Como Fazer Lasanha de Frigideira (Passo a Passo) 1. Refogue a base Aqueça o óleo em uma frigideira funda e refogue a cebola até ficar douradinha e macia. 2. Cozinhe a carne Adicione a carne moída, o sal e o tempero. Mexa bem, quebrando os pedacinhos até dourar completamente. 3. Prepare o molho Coloque o molho de tomate e a água, misturando para incorporar bem. Deixe cozinhar por 5 minutos até engrossar. 4. Monte a lasanha diretamente na frigideira Reserve um pouco do molho e deixe apenas uma camada fina no fundo. Coloque a massa fresca, cubra com molho e finalize com muçarela. Repita até acabar os ingredientes, sempre finalizando com queijo. 5. Cozinhe sem forno Tampe a frigideira e deixe cozinhar em fogo bem baixinho por cerca de 20 minutos. A massa vai cozinhar no vapor e no molho, ficando macia e saborosa. 6. Finalize e sirva Desligue o fogo, deixe descansar por 5 a 10 minutos e sirva as fatias ainda quentinhas e cremosas. #lazanha</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475416/3475416_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T16:18:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475415</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475415/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>yazeedi ulama se munazray - Brother Kashif Ali #shorts</video:title>
      <video:description>yazeedi ulama se munazray - Brother Kashif Ali #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475415/3475415_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T16:18:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Jot Bulani Dance 10</video:title>
      <video:description>Indian Girl Jot Bulani Dance #danceindia #bollywooddance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475414/3475414_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T16:18:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ready to sell</video:title>
      <video:description>#Cameroon</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475413/3475413_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-21T16:18:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FF vii remake of</video:title>
      <video:description>Ddft #Ff</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475412/3475412_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-21T16:17:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 16 Hindi dubbed (Last episode)</video:title>
      <video:description>The tale of lady ok episode 16 Hindi dubbed K-drama last episode (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475411/3475411_720p.mp4</video:content_loc>
      <video:duration>4546</video:duration>
      <video:publication_date>2026-09-21T16:16:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cameroon 🇨🇲 2</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475410/3475410_720p.mp4</video:content_loc>
      <video:duration>114</video:duration>
      <video:publication_date>2026-09-21T16:16:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bhai ko khana khilana</video:title>
      <video:description>Support help</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475409/3475409_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T16:16:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Overhead Kicks Ever Ranked</video:title>
      <video:description>Best Overhead Kicks Ever Ranked</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475408/3475408_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T16:16:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bounia</video:title>
      <video:description>أخر وحدة غدير تراند🤣 @دنيا زوجة إحساس💍❤️Dounia👑 @🇲🇦DouniaBellaOfficiel🇲🇦🎤 #إسبانيا🇪🇸_ايطاليا🇮🇹_البرتغال🇵🇹 #المغرب🇲🇦تونس🇹🇳الجزائر🇩🇿 #دنياوإحساس #الصين_ماله_حل #دنيابيلا #unist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475407/3475407_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T16:16:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy birthday to you 10</video:title>
      <video:description>Cc to Florida for a #Dff</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475406/3475406_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T16:16:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good evening ✨✨</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475405/3475405_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T16:16:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lilica 2</video:title>
      <video:description>Lilica #animais</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475404/3475404_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T16:16:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475403</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475403/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>azekk</video:title>
      <video:description>#cutedance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475403/3475403_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T16:15:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Visiting Hafizabad Pakistan and Pakistani drama</video:title>
      <video:description>West Punjab #Punjab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475402/3475402_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T16:15:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>L@nterns S01E06</video:title>
      <video:description>Lanterns S01E06</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475401/3475401_720p.mp4</video:content_loc>
      <video:duration>3207</video:duration>
      <video:publication_date>2026-09-21T16:15:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trading dengan Fibonacci Retracement &amp; Extension</video:title>
      <video:description>Cara Trading dengan Fibonacci Retracement &amp; Extension untuk Pemula (Simple &amp; Akurat) #Trading</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475400/3475400_720p.mp4</video:content_loc>
      <video:duration>842</video:duration>
      <video:publication_date>2026-09-21T16:14:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hollywood movies Heroes best Scene</video:title>
      <video:description>Best movies Heroes scene #Hollywoodmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475398/3475398_720p.mp4</video:content_loc>
      <video:duration>495</video:duration>
      <video:publication_date>2026-09-21T16:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475397</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475397/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khom Khlang (2026) Ep 3 - Eng Sub</video:title>
      <video:description>Khom Khlang - Episode 3 [Eng Sub] ข่มขลัง</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475397/3475397_720p.mp4</video:content_loc>
      <video:duration>3506</video:duration>
      <video:publication_date>2026-09-21T16:11:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>donia 2</video:title>
      <video:description>فبحر الرجلة أميمتي بنتك عوامة #tanger#طنجة #دبي #حبيبي_دوريجين #دنياوإحساس #المغرب🇲🇦تونس🇹🇳الجزائر🇩🇿 #الشعب_الصيني_ماله_حل😂😂 #foryouシ #shortstory #reels @👑DouniaBellaOfficiel👑🎤👌 @🇲🇦DouniaBellaOfficiel🇲🇦🎤 #canada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475396/3475396_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T16:10:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pepeling diri</video:title>
      <video:description>Pepeling,bahasa sunda #Ajaransunda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475395/3475395_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T16:10:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiga lawan satu</video:title>
      <video:description>#1dan3</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475394/3475394_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:10:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Les amoureux .</video:title>
      <video:description>Le courant d’eau a prit l’homme amoureux .</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475393/3475393_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T16:09:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zahanat Aqalmandi Aur Iman - Brother Kashif Ali #shorts</video:title>
      <video:description>Zahanat Aqalmandi Aur Iman - Brother Kashif Ali #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475392/3475392_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-21T16:09:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Against the Current (2026) Ep 23 - Eng Sub</video:title>
      <video:description>𝙴𝙿. 23 𝙰𝙶𝙰𝙸𝙽𝚂𝚃 𝙲𝚄𝚁𝚁𝙴𝙽𝚃 (2026) _ 𝙴𝙽</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475391/3475391_720p.mp4</video:content_loc>
      <video:duration>2766</video:duration>
      <video:publication_date>2026-09-21T16:08:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zalim Hakim Malookiat per khamooshi #shorts #sheikhulislammaulanaishaq</video:title>
      <video:description>Zalim Hakim Malookiat per khamooshi #shorts #sheikhulislammaulanaishaq</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475390/3475390_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T16:08:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Person Carrying and Moving a Huge Amount of Food</video:title>
      <video:description>Watch as this person carries and moves a large amount of food in an impressive way. A simple but interesting moment showing strength, effort, and determination. #sweetpotatoesmilk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475389/3475389_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T16:08:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Payal 2</video:title>
      <video:description>#Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475388/3475388_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T16:07:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FOOD Videos 2</video:title>
      <video:description>Videos UK #Food #Video #USA #mokong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475387/3475387_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T16:07:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral reels 19</video:title>
      <video:description>#munna bhai 🤪🤪 #Mirzapur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475386/3475386_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T16:07:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zameen Par Zakat - Molana Ishaq #shorts</video:title>
      <video:description>Zameen Par Zakat - Molana Ishaq #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475385/3475385_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T16:07:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QATAR just TRICKED TRUMP with BRILLIANT MOVE</video:title>
      <video:description>QATAR just TRICKED TRUMP with BRILLIANT MOVE #QATARjustTRICKEDTRUMPwithBRILLIANTMOVE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475384/3475384_720p.mp4</video:content_loc>
      <video:duration>806</video:duration>
      <video:publication_date>2026-09-21T16:06:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral 147</video:title>
      <video:description>#munna bhai mirzapur #India</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475383/3475383_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T16:06:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475382</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475382/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>save the day again</video:title>
      <video:description>#MLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475382/3475382_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T16:06:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>seahorses and penguins in the sea of snow</video:title>
      <video:description>Penguins and seahorses are having coffee in the sea of snow and ice #Seahorses</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475381/3475381_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:06:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Merokok 2</video:title>
      <video:description>#Rokok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475380/3475380_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T16:06:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>La roue .</video:title>
      <video:description>Une grosse roue s’echappée avec une femme .</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475379/3475379_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T16:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buah mangga 4</video:title>
      <video:description>#Buahmangga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475377/3475377_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:06:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475376</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475376/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nada hassi 2</video:title>
      <video:description>#almania</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475376/3475376_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T16:05:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zer e Naaf Baal Saaf karna - Molana Ishaq #shorts 2</video:title>
      <video:description>Zer e Naaf Baal Saaf karna - Molana Ishaq #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475375/3475375_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-21T16:05:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New reel Big ass big boobs curvy booty sexy viral video</video:title>
      <video:description>New reel Big ass big boobs curvy booty sexy viral video #Newreel #bigass #bigboobs #sexy #curvy #booty #viralvideo #trendingsearches #trendingvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475374/3475374_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T16:05:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This is just to tell you that we need to help each other</video:title>
      <video:description>If you help me today tomorrow might be your own time</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475373/3475373_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T16:05:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mentira</video:title>
      <video:description>A mentira ajuda ou não Homem com amante</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475372/3475372_720p.mp4</video:content_loc>
      <video:duration>116</video:duration>
      <video:publication_date>2026-09-21T16:05:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475370</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475370/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tell the truth 2</video:title>
      <video:description>Song of Indonesia which falling in love before the x #US #CA #UK #RU #BR #GR #NZ #AUS #EUROPE #CN #ID #INDONESIA #ASIA #MALASIA #LATINAMERICA #SA #AFRICA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475370/3475370_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-21T16:05:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why some people hands are so cold</video:title>
      <video:description>Why some people hands are so cold #🧠Psychology #🥶ColdHands #🖐️BodySignals #💭HumanBody</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475369/3475369_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-21T16:04:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Can This Love Be Translated  Episode 1 in Hindi Dubbed  | New Romantic C-Drama | Love Story</video:title>
      <video:description>#canthislovebetranslated #canthislovebetranslatedEpisode1 #KDrama #HindiDubbed #KoreanDrama #KDramaHindi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475368/3475368_720p.mp4</video:content_loc>
      <video:duration>145</video:duration>
      <video:publication_date>2026-09-21T16:04:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fase SINOM.</video:title>
      <video:description>Fase SINOM adalah Fase ke 3 dalam kehidupan, dalam Tembang Macapat, SINOM berarti anak muda... Syair -Syair Tembang Macapat di fase SINOM mengisahkan tentang anak muda yang semangat,kreatif.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475367/3475367_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T16:03:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dua for today</video:title>
      <video:description>May Allah answer our prayers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475366/3475366_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T16:03:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arrependimento 2</video:title>
      <video:description>Não pode perder Na mulher</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475365/3475365_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-21T16:03:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>রাতের বাজারের সৌন্দর্য</video:title>
      <video:description>রাতের বাজারের সৌন্দর্য</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475364/3475364_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T16:03:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475363</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475363/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>👉👌</video:title>
      <video:description>#kanjut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475363/3475363_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T16:02:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fresh Passive Income Ideas for Women 💰✨ | Smart Ways to Make Money Online</video:title>
      <video:description>Looking for simple passive income ideas? 💻💰 Explore smart and creative ways women can build extra income online and work toward greater financial freedom. ✨📈 #passiveincomeideasforwomen #makemoneyonline #womenincomeideas #sidehustleforwomen #onlineincome #passiveincome #workfromhome #moneymakingideas #financialfreedom #sideincome #onlinebusiness #digitalincome #businessideasforwomen #incomestreams #entrepreneurwomen #smartmoneyideas #extraincome #passiveincometips #onlinesidehustle #moneymotivation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475362/3475362_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T16:02:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 58</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475361/3475361_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-21T16:01:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como Deus é bom né não nego</video:title>
      <video:description>Deus Deus acima de tudo #Deus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475360/3475360_720p.mp4</video:content_loc>
      <video:duration>288</video:duration>
      <video:publication_date>2026-09-21T16:01:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ultimate Bengali Feast: Egg &amp; Chicken Curry Mukbang! 🥚🍗</video:title>
      <video:description>Welcome back to another mouth-watering feast! Today, I’m diving into a delicious traditional spread featuring spicy egg curry, rich chicken gravy, crispy fish fry, and fresh rice. Watch till the end to experience the ultimate crunch and satisfying flavors! Don&apos;t forget to like, comment, and subscribe for more delicious mukbang content! ​#Mukbang #BengaliFood #EggCurry #ChickenCurry #Foodie #EatingShow #ASMRFood #DesiFood #SpicyFood #FoodLover #BengaliMukbang​IndianStreetFood​SpicyEggCurryMukbang​EatingChallenge​ChickenCurrywithRice​ASMREatingSounds​UltimateFoodPlatter​DeliciousDesiMeal​FishFryMukbang​BengaliFoodEatingVideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475359/3475359_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T16:01:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475358</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475358/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 57</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475358/3475358_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-21T16:01:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Riscos</video:title>
      <video:description>Era uma vez um homem Sé apaixonou com uma mulher</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475357/3475357_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-21T16:01:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Os AUTÔMATOS da Grécia Antiga: Os Gigantes Mecânicos de Hefesto Eram Robôs Reais?</video:title>
      <video:description>Será que os gregos imaginaram robôs milhares de anos antes da tecnologia moderna? Neste vídeo você vai conhecer Talos, o lendário gigante de bronze criado por Hefesto, além dos incríveis autômatos da Grécia Antiga e das invenções de Heron de Alexandria, que desenvolveu mecanismos automáticos, portas movidas a vapor e máquinas surpreendentes. Com recriações cinematográficas feitas com Inteligência Artificial, exploramos um dos maiores mistérios da engenharia da Antiguidade. 👍 Curta o vídeo, inscreva-se no Curiosidades Históricas com IA e ative o sino para mais mistérios, arqueologia e tecnologias perdidas da história. 🔥 Hashtags #autômatosdaGréciaAntiga #Hefesto #Talosgigantedebronze #robôsdaantiguidade #HerondeAlexandria #tecnologiadaGréciaAntiga #mitologiagrega #gigantesmecânicos #engenhariaantiga #arqueologia #históriaantiga #curiosidadeshistóricas #inteligênciaartificial #IAhistórica #civilizaçõesantigas #templosgregos #máquinasdaantiguidade #ro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475356/3475356_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-09-21T16:00:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475355</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475355/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enjoy the beautiful view</video:title>
      <video:description>Enjoy the beautiful natural scenery</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475355/3475355_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T16:00:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 56</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475354/3475354_720p.mp4</video:content_loc>
      <video:duration>345</video:duration>
      <video:publication_date>2026-09-21T16:00:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 55</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475353/3475353_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-09-21T15:59:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Os AUTÔMATOS da Grécia Antiga: O Segredo dos Gigantes Mecânicos de Hefesto Revelado com IA!</video:title>
      <video:description>Será que a Grécia Antiga já imaginava robôs milhares de anos antes da tecnologia moderna? Neste vídeo você vai conhecer os lendários Autômatos de Hefesto, incluindo Talos, o gigantesco guerreiro de bronze que, segundo a mitologia grega, protegia a ilha de Creta. Com recriações cinematográficas feitas por Inteligência Artificial, exploramos como a mecânica, a robótica e as invenções da Antiguidade inspiraram histórias que continuam intrigando arqueólogos, historiadores e amantes dos mistérios da história. Descubra como Heron de Alexandria criou máquinas automáticas, portas movidas a vapor e mecanismos impressionantes que parecem tecnologia moderna. 👉 Inscreva-se no Curiosidades Históricas com IA, deixe seu like, compartilhe este vídeo e ative o sino para acompanhar mais mistérios, arqueologia, impérios antigos e tecnologias perdidas recriadas com IA. 🔥 Hashtags #incluindoTalos #ogigantescoguerreirodebronze</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475352/3475352_720p.mp4</video:content_loc>
      <video:duration>615</video:duration>
      <video:publication_date>2026-09-21T15:59:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 54</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475351/3475351_720p.mp4</video:content_loc>
      <video:duration>169</video:duration>
      <video:publication_date>2026-09-21T15:58:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zindagi Aur Maut - Molana Ishaq RA #shorts</video:title>
      <video:description>Zindagi Aur Maut - Molana Ishaq RA #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475350/3475350_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T15:57:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Who wants a beautiful cute daughter</video:title>
      <video:description>#cutebaby</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475349/3475349_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T15:57:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 53</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475348/3475348_720p.mp4</video:content_loc>
      <video:duration>165</video:duration>
      <video:publication_date>2026-09-21T15:57:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❤️ 46</video:title>
      <video:description>Existe uma pressa no mundo. Uma cobrança silenciosa para sermos mais, termos mais, chegarmos antes. Mas quase ninguém fala sobre o tempo das raízes. Antes da flor, existe o silêncio. Antes do aplauso, existe o esforço invisível. Antes da conquista, existe a dúvida. E crescer, às vezes, dói. Vivemos nos comparando — como se rosa precisasse ser girassol, como se cada história tivesse o mesmo relógio. Mas não tem. Há pessoas criando raízes profundas enquanto outras já exibem flores. E raiz também é progresso, mesmo que ninguém veja. Talvez hoje não seja o seu dia de florescer. Talvez seja apenas o dia de continuar. E continuar já é coragem.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475347/3475347_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T15:56:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475346</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475346/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main bulutangkis</video:title>
      <video:description>#Bulutangkis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475346/3475346_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:56:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475345</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475345/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nada hassi</video:title>
      <video:description>#francecandaitalia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475345/3475345_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T15:56:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main carambol</video:title>
      <video:description>#Carambol</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475344/3475344_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:56:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 52</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475343/3475343_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-21T15:56:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475342</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475342/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KURIDZA NGOMA NEDEMO WAKAGARIRA PFUMO</video:title>
      <video:description>The video is about warning people not to do things which might lead the in danger for the sake of pleasing other people. #warning #people #thingswhichmightleadindanger #forthesakeofpleasingotherpeople</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475342/3475342_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T15:56:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>São Roberto Belarmino: O Martelo dos Hereges e Doutor da Igreja.</video:title>
      <video:description>Descubra a história inspiradora de São Roberto Belarmino, um dos maiores teólogos e Doutores da Igreja Católica. Nascido numa família nobre da Toscana em 1542 e sobrinho de um Papa, Roberto renunciou a todo o poder e riqueza para se dedicar inteiramente à Companhia de Jesus. #Southkorea #brazil #unitedstates #italy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475341/3475341_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-09-21T15:55:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Supir dan kenek</video:title>
      <video:description>#Bus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475340/3475340_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:55:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naik hartop</video:title>
      <video:description>#Hartop</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475339/3475339_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:55:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 51</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475338/3475338_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-21T15:55:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Santai di. Kereta api</video:title>
      <video:description>#Keretaapi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475337/3475337_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:55:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 50</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475336/3475336_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-21T15:54:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naik truk</video:title>
      <video:description>#Truk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475335/3475335_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:54:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Balap lari 2</video:title>
      <video:description>#Lari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475334/3475334_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:54:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Secret of SL and TP</video:title>
      <video:description>Rahasia SL &amp; TP yang Bikin Trading Tetap Konsisten Meski Kena Loss! #Trading</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475333/3475333_720p.mp4</video:content_loc>
      <video:duration>747</video:duration>
      <video:publication_date>2026-09-21T15:54:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 49</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475332/3475332_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-21T15:54:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagi. Jajan di pinggir kampung</video:title>
      <video:description>#Jajan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475331/3475331_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:53:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475330</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475330/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hassinadaofficiel</video:title>
      <video:description>#canada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475330/3475330_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T15:53:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 48</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475329/3475329_720p.mp4</video:content_loc>
      <video:duration>151</video:duration>
      <video:publication_date>2026-09-21T15:53:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 47</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475328/3475328_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-21T15:52:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuando tu pareja te abraza fuerte al dormir,</video:title>
      <video:description>Cuando tu pareja te abraza fuerte al dormir, #Pareja #Amor #Salud #Sueño #Relaciones</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475327/3475327_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-09-21T15:52:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 46</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475326/3475326_720p.mp4</video:content_loc>
      <video:duration>358</video:duration>
      <video:publication_date>2026-09-21T15:52:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>মেন রোড</video:title>
      <video:description>মেন রোড</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475325/3475325_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T15:51:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eleições de bombeira dos índios</video:title>
      <video:description>Vai set top #Deus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475324/3475324_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-09-21T15:51:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ViralFlow 3</video:title>
      <video:description>Most challenges prepare your destiny. #Yourself #Discipline #Adapt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475323/3475323_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-21T15:51:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 45</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475322/3475322_720p.mp4</video:content_loc>
      <video:duration>167</video:duration>
      <video:publication_date>2026-09-21T15:51:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My god help..</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475321/3475321_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T15:51:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semangat berjualan</video:title>
      <video:description>Cuacanya panas #berjualan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475320/3475320_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-21T15:51:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475319</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475319/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 44</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475319/3475319_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-21T15:51:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 43</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475318/3475318_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-09-21T15:50:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 160</video:title>
      <video:description>Love you</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475317/3475317_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T15:50:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 42</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475316/3475316_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-21T15:49:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fase MIJIL</video:title>
      <video:description>Fase MIJIL adalah fase siklus yang ke 2, MIJIL berarti Lahir. Lahirnya janin yang menjadi bayi,insan dan lain sebagainya..</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475315/3475315_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T15:49:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O reggae</video:title>
      <video:description>No. As melhores #Deus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475314/3475314_720p.mp4</video:content_loc>
      <video:duration>113</video:duration>
      <video:publication_date>2026-09-21T15:49:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compositora Bruna Rafaela de França 41</video:title>
      <video:description>Compositora Bruna Rafaela de França #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475313/3475313_720p.mp4</video:content_loc>
      <video:duration>161</video:duration>
      <video:publication_date>2026-09-21T15:49:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat rasa syukur tumbuh jalan terasa ringan</video:title>
      <video:description>Motivasi #Motivation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475312/3475312_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T15:48:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atal tunnel</video:title>
      <video:description>Impressive view of atal tunnel #Ataltunnel #mountains #travel #solotravel #rohtang #view #influencer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475311/3475311_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T15:48:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475310</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475310/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>São Zygmunt Szczęsny Feliński: Da Dor Familiar ao Exílio por Amor e Fé.</video:title>
      <video:description>Conheça a emocionante e inspiradora trajetória de São Zygmunt Szczęsny Feliński, um homem cuja vida foi marcada por grandes provações desde a juventude. Após perder o pai precocemente e ver a sua mãe ser exilada para a Sibéria, Zygmunt transformou a dor e as dificuldades em uma força inabalável de fé, amor e dedicação ao próximo. #Southkorea #brazil #unitedstates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475310/3475310_720p.mp4</video:content_loc>
      <video:duration>118</video:duration>
      <video:publication_date>2026-09-21T15:47:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 15 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 15 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475309/3475309_720p.mp4</video:content_loc>
      <video:duration>4454</video:duration>
      <video:publication_date>2026-09-21T15:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuting sticker</video:title>
      <video:description>Cating sticker variasi #Cutingsticker #variasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475308/3475308_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-21T15:47:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Magic tooth powder</video:title>
      <video:description>Is a magic tooth powder that cleanse the mouth and refreshes the mouth #Cleanse #refresh #mouth</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475307/3475307_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T15:46:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Traditional Village Vegetable Recipes</video:title>
      <video:description>Traditional Village Vegetable Recipes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475306/3475306_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:44:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jabse Tumhein Maine Dekha Sanam l Apu Rahman l Movie Song l Dahek l जबसे तुम्हें मैंने देखा सनम l</video:title>
      <video:description>Romantic Hindi Song #jabse tumhein maine dekha sanam #movie song dahek #cover song hindi #coversong #bollywood song #romantic hindi song #love song #old movie song #90s songs #viral #जबसे तुम्हें मैंने देखा सनम Song- Jabse Tumhein Maine Dekha Sanam Covered By Apu Rahman Main Artist- Udit Narayan &amp; Anuradha Paudwal Lyrics- Shyam Raj Music- Adesh Shrivastava Movie- Dahek #JabseTumheinMaineDekhaSanam #MovieSongDahek #Coversong #CoverSongHindi #BollywoodSong #Dahek #RomanticHindiSong #LoveSong #OldMovieSong #90sSongs #Viral #जबसेतुम्हेंमैंनेदेखासनम</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475305/3475305_720p.mp4</video:content_loc>
      <video:duration>275</video:duration>
      <video:publication_date>2026-09-21T15:42:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thank You for Not Being the Person I Hoped You Would Be</video:title>
      <video:description>Sometimes disappointment becomes a blessing in disguise. A heartfelt reflection about letting go, discovering yourself, and realizing that some people leave your life to help you become stronger than ever. #thankyou #emotionalquote #lifequotes #inspirationalquotes #deepquotes #relationshipquotes #lettinggo #selfdiscovery #healingquotes #motivationalvideo #sadquotes #sunsetocean #peacefulscenery #emotionalvideo #lifelesson #movingon #innerstrength #personalgrowth #inspirationalvideo #quotevideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475304/3475304_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T15:42:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The devils also believe there is ONLY ONE GOD &amp; THEY TREMBLE!</video:title>
      <video:description>#Jesus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475303/3475303_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-21T15:41:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Adorable bear behavior</video:title>
      <video:description>bear cub&apos;s misbehavior #abearcubandagrandfather</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475302/3475302_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T15:41:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Epic husky sled adventure</video:title>
      <video:description>Experience an unforgettable husky sled ride across a breathtaking snowy landscape. Feel the beauty of winter, the power of the sled dogs, and the peaceful Arctic adventure. Like, share, and follow for more amazing travel and nature videos! Hashtag Globa #huskydogsledingwinterwonderland</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475301/3475301_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:40:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ViralFlow 2</video:title>
      <video:description>Deserves your self better than anything. #Self #You #Me</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475300/3475300_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T15:40:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Candle Rejection</video:title>
      <video:description>Candle Rejection_ Sinyal Pembalikan Paling Akurat yang Wajib Dilihat Trader! #Trading</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475299/3475299_720p.mp4</video:content_loc>
      <video:duration>876</video:duration>
      <video:publication_date>2026-09-21T15:39:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criação divina!!!</video:title>
      <video:description>Galáxias, constelações, estrelas, universo e muito mais da criação Divina!!! #criaçãodivinoDeus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475298/3475298_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T15:38:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating breakfast 😋 alone</video:title>
      <video:description>#breakfasts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475297/3475297_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T15:38:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 14 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 14 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475296/3475296_720p.mp4</video:content_loc>
      <video:duration>4012</video:duration>
      <video:publication_date>2026-09-21T15:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ciptaan Allah sungguh menakjubkan</video:title>
      <video:description>Segerombolan Ikan yang di selamatkan oleh burung #fish #bird #nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475295/3475295_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T15:37:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>São Columba de Iona: Do Remorso e Guerra à Redenção e Fé.</video:title>
      <video:description>Descubra a impressionante história de São Columba de Iona, um homem de nobre linhagem na Irlanda que trocou os seus privilégios pelo exílio eterno em busca de expiação. Após um desentendimento sobre a cópia de um livro de Salmos desencadear uma sangrenta batalha entre mosteiros, Columba partiu para a remota ilha de Iona, na Escócia, com a missão de evangelizar e transformar o seu remorso numa obra de redenção. #Southkorea #unitedstates #italy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475294/3475294_720p.mp4</video:content_loc>
      <video:duration>114</video:duration>
      <video:publication_date>2026-09-21T15:37:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuting sticker variasi</video:title>
      <video:description>Cuting sticker variasi #Cutingsticker #variasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475293/3475293_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T15:37:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flamengo  Meio Campo Crítico e Ataque Decisivo Contra Estudiantes</video:title>
      <video:description>⚽ O futebol que arrepia. Aqui você encontra: 🔥 Cortes virais 🏆 Copa do Mundo 🇧🇷 Seleção Brasileira ⭐ Neymar, Vini Jr e os maiores craques 🎬 Momentos inesquecíveis Se você vive futebol, este canal é para você. 🔔 Inscreva-se e faça parte da torcida! #clips #futebol #esporte #sport #brasileirao #brasil #neymar #vinijr #rusk #rusko #ruski #sallat #tursb #fila2024 #bola</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475292/3475292_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T15:36:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sparks of Tomorrow (Hindi) - S01 Ep 12</video:title>
      <video:description>#SparksofTomorrow #SparksofTomorrowdrama #SparksofTomorrowseries #SparksofTomorrowChinesedrama #SparksofTomorrowC-drama #SparksofTomorrowepisodes #SparksofTomorrowcast #SparksofTomorrowromance #Chineseromancedrama #C-drama #modernromancedrama #youthdrama #Chineseseries #Asiandrama #romanticdrama #newC-drama #SparksofTomorrowfullseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475291/3475291_720p.mp4</video:content_loc>
      <video:duration>1535</video:duration>
      <video:publication_date>2026-09-21T15:35:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 209</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475290/3475290_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T15:35:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>siga @socratesitba</video:title>
      <video:description>#meme #zueira</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475289/3475289_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T15:35:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Youth - Season 01 Episode 02</video:title>
      <video:description>#Youth #Youthdrama #Youthseries #YouthK-drama #YouthKoreandrama #Youthromance #Youthdramaseries #Koreandrama #Koreanseries #romancedrama #friendshipdrama #comingofage #emotionaldrama #relationshipdrama #Asiandrama #Koreanromance #dramaepisodes #youthstory #romanticseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475288/3475288_720p.mp4</video:content_loc>
      <video:duration>1681</video:duration>
      <video:publication_date>2026-09-21T15:34:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Irfan Sayzz - Tonight_ V took a turn in the audience as he watched Gracie Abrams and Doja</video:title>
      <video:description>Irfan Sayzz - Tonight_ V took a turn in the audience as he watched Gracie Abrams and Doja Cat perform at_ Hollywood. No stranger to a fashion show either_#othoi #anime #jinwosung #viral #video #short #foryou #shortvideo #freefire #free #youtube #facebook #instagram #telegram #link #music #palystore #chrome #wepsit #fespot #me #you #freefireanimeviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475287/3475287_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T15:34:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>腾龙公司注册游戏账号</video:title>
      <video:description>在2026年最新的，‌腾龙公司在线申请游戏账号的步骤大致如下：‌ 打开腾龙公司官网：‌首先，‌您需要在浏览器中输入腾龙公司的官方网站地址（‌如示例中的tl12060.com）钉钉as84523，‌但请注意，‌实际地址可能有所不同，‌请确保访问的是官方认证的网站）‌。‌ 点击注册按钮：‌在官网主页的右上角或显眼位置，‌找到并点击“注册”按钮。‌ #旅行</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475286/3475286_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T15:33:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OMG 😱 super super.....</video:title>
      <video:description>OMG 😱 super super.....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475285/3475285_720p.mp4</video:content_loc>
      <video:duration>435</video:duration>
      <video:publication_date>2026-09-21T15:33:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Subscribe. 4</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475284/3475284_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T15:33:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Princess of My Heart_Full Movie_Hindi Dubbed_New Chinese Drama__cdrama _cdramahindi_cdramaclips(</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475283/3475283_720p.mp4</video:content_loc>
      <video:duration>10436</video:duration>
      <video:publication_date>2026-09-21T15:33:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Taxi No. 4554 _ South UNPREDICTABLE TWIST THRILLER Full Movie Hindi Dubbed _ Ashok_ Sheela(1080P_HD)</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475282/3475282_720p.mp4</video:content_loc>
      <video:duration>6428</video:duration>
      <video:publication_date>2026-09-21T15:33:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Superstar Ravi Teja __RAILWAY OFFICER__ _ New Released Full South Hindi Dubbed Movie _ Sreeleela _HD</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475281/3475281_720p.mp4</video:content_loc>
      <video:duration>6824</video:duration>
      <video:publication_date>2026-09-21T15:33:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Son Of Satyamurthy (4K)- Allu Arjun Blockbuster Action Comedy Romantic Film _ Samantha_ Nithya Menen</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475280/3475280_720p.mp4</video:content_loc>
      <video:duration>7884</video:duration>
      <video:publication_date>2026-09-21T15:33:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>✨ Cozy Skincare Shelf Ideas That Look Expensive on a Budget 🧴🤍</video:title>
      <video:description>Turn your skincare shelf into a cozy, aesthetic space without spending a fortune! 🧴✨ Simple organization, clean vibes, and luxe-looking touches that make your skincare routine even more satisfying. 🤍 #skincareshelf #skincareorganization #aestheticskincare #cozyroomdecor #skincareroutine #shelfdecor #beautyorganization #aestheticroom #skincareideas #budgetskincaresetup #luxeskincare #cleangirlaesthetic #beautyshelf #organizationideas #aestheticdecor #skincarecollection #satisfyingorganization #selfcare #beautytips #aestheticvibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475279/3475279_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T15:33:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skanda_ The Attacker - South Indian Movie Hindi Dubbed - Ram Pothineni_ Sreeleela_ Saiee Manjrekar(7</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475278/3475278_720p.mp4</video:content_loc>
      <video:duration>9407</video:duration>
      <video:publication_date>2026-09-21T15:33:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475277</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475277/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Please.</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475277/3475277_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T15:33:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ruler _ South Indian Released Full Hindi Dubbed Action Movies _ Allu Arjun_ Samantha New Movie 2026(</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475276/3475276_720p.mp4</video:content_loc>
      <video:duration>7005</video:duration>
      <video:publication_date>2026-09-21T15:32:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Help please.</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475275/3475275_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T15:32:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 208</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475274/3475274_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T15:32:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Subscribe please.</video:title>
      <video:description>#Susbcribe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475273/3475273_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T15:31:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hey brother-in-law, haven&apos;t heard from you in a while. Do you feel like talking to your sister-in-la</video:title>
      <video:description>Hey brother-in-law, haven&apos;t heard from you in a while. Do you feel like talking to your sister-in-law tonight? If you do, give me a call. new video,,</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475272/3475272_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:30:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Panduan tentang Trading View Dan Meta trader</video:title>
      <video:description>Apa Itu MetaTrader &amp; TradingView_ Panduan Lengkap Trading untuk Pemula + Modal Awal yang Dibutuhkan #Trading</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475271/3475271_720p.mp4</video:content_loc>
      <video:duration>1607</video:duration>
      <video:publication_date>2026-09-21T15:30:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 207</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475270/3475270_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:29:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Youth - Season 01 Episode 01</video:title>
      <video:description>#Youth #Youthdrama #Youthseries #YouthK-drama #YouthKoreandrama #Youthromance #Youthdramaseries #Koreandrama #Koreanseries #romancedrama #friendshipdrama #comingofage #emotionaldrama #relationshipdrama #Asiandrama #Koreanromance #dramaepisodes #youthstory #romanticseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475269/3475269_720p.mp4</video:content_loc>
      <video:duration>1735</video:duration>
      <video:publication_date>2026-09-21T15:29:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enchanted Moonlit Garden</video:title>
      <video:description>A graceful fairy sits upon a glowing crescent moon surrounded by colorful flowers and lush green foliage. Beneath a magical night sky filled with sparkling stars and luminous butterflies, her flowing green dress shimmers like a gentle stream of light. The dreamy scene creates a sense of wonder, beauty, and enchantment, as if it were a peaceful garden hidden among the stars.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475267/3475267_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T15:28:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ms setti big ass big boobs sexy curvy booty viral video</video:title>
      <video:description>Ms setti big ass big boobs sexy curvy booty viral video #Mssetthi #bigass #bigboobs #curvy #booty #sexy #viralvideo #trendingsearches #trendingvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475266/3475266_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T15:28:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Playing Free fire for Rank push in Br mode | 15+ kill in one game</video:title>
      <video:description>🔥 Free Fire BR Ranked Gameplay with 15+ Kills! In this video, I’m playing Solo Rank Push in Free Fire Battle Royale, taking on intense fights and trying to climb the rank while playing completely solo. 🎮 This Free Fire gameplay was packed with close fights, aggressive pushes, clutch moments, good rotations and 15+ kills. The goal was to survive, get as many eliminations as possible, and keep pushing the BR rank until the end. If you enjoy Free Fire ranked gameplay, Free Fire BR gameplay, solo rank push, high-kill Free Fire games, clutch gameplay, intense gunfights and Free Fire mobile gameplay, you’ll enjoy this match. 💀 15+ KILLS 🔥 SOLO BR RANK PUSH 🏆 BR RANKED GAMEPLAY 🎯 HIGH-KILL GAME ⚔️ INTENSE GUNFIGHTS &amp; CLUTCH MOMENTS I’m trying to improve every game and push my rank while playing solo. Some fights were easy, while others were extremely close and required better movement, aim and positioning. Watch the full gameplay and let me know in the comments: 👉 What is your highest kill count in Solo BR? 👉 Which Free Fire gun do you use the most? 👉 How far have you pushed your BR rank? If you enjoyed the video, make sure to LIKE 👍, COMMENT 💬 and SUBSCRIBE 🔔 for more Free Fire gameplay, ranked matches, solo rank pushes, high-kill games and gaming content. Your support helps the channel grow and motivates me to keep making more gameplay videos. ❤️ 🎮 GAME: Free Fire 🎮 MODE: Battle Royale / BR Ranked 👤 PLAY STYLE: Solo 💀 KILLS: 15+ 🏆 CONTENT: Solo Rank Push &amp; High-Kill Gameplay More Free Fire gameplay coming soon with rank pushes, high-kill matches, clutch moments, intense fights and BR ranked gameplay. Thanks for watching! ❤️ See you in the next match! 🔥🎮 #Freefire #gameplay #gaming #Freefiresolo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475265/3475265_720p.mp4</video:content_loc>
      <video:duration>1182</video:duration>
      <video:publication_date>2026-09-21T15:28:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>পার্কের সৌন্দর্য</video:title>
      <video:description>পার্কের সৌন্দর্য</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475264/3475264_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-21T15:28:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Culture ☆=&gt; Display.</video:title>
      <video:description>It&apos;s unique when it comes to Culture. #▪︎▪︎☆Blood #Birth #Right☆▪︎▪︎</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475263/3475263_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T15:28:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexo escondido</video:title>
      <video:description>Era uma vez Assalto aconteceu No barreiro E daí todo aconteceu #Sexo #assalto</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475262/3475262_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T15:27:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clutch! 1vs4 Impossible Squad Wipe 😈 | Free Fire MAX Best Gameplay #freefire</video:title>
      <video:description>Clutch! 1vs4 Impossible Squad Wipe 😈 | Free Fire MAX Best Gameplay #freefire</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475261/3475261_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T15:27:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 13 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 13 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475260/3475260_720p.mp4</video:content_loc>
      <video:duration>3928</video:duration>
      <video:publication_date>2026-09-21T15:27:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Breakfasts 🍓</video:title>
      <video:description>this iss my favourite meal of the day #healthybreakfast</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475259/3475259_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T15:26:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animasi AI</video:title>
      <video:description>Animasijava #Lesjavaindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475258/3475258_720p.mp4</video:content_loc>
      <video:duration>155</video:duration>
      <video:publication_date>2026-09-21T15:26:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Colony2026📸 complete (part 63) with &quot;3&quot; different subtitles.</video:title>
      <video:description>Follow and visit our complete profile for more parts..💪 The new kdrama/movie colony episodes are here to watch with English and different subtitles....🔥 Come and see for more parts...🎥 #hitkdramas #mustwatch🔥 #mustwatch #viralclip🤯 #fulltrending🎯Watch #viralclip #millionviews🔥 #fullsupport😎</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475257/3475257_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T15:25:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>a peaceful atmosphere</video:title>
      <video:description>calm atmosphere in the middle of the mountain #travel #mountain #nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475256/3475256_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T15:23:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teacher Day</video:title>
      <video:description>Masti time #India</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475255/3475255_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T15:23:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The scale of this new COD campaign is actually insane! 🤯</video:title>
      <video:description>The scale of this new COD campaign is actually insane! 🤯 Cinematic story meets all-out warfare. Pre-order to get Early Access on October 23! 💥 #CallOfDuty #ModernWarfare #COD #Gaming #FYP</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475254/3475254_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T15:22:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Palm oil harvest</video:title>
      <video:description>Nyawit dulu #anakfelda #harvest #oil #palmoil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475253/3475253_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-21T15:22:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I like 3</video:title>
      <video:description>Colll #LestsumateraUtaraIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475252/3475252_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T15:22:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Unique Culture</video:title>
      <video:description>Deserves to display real identity. #☆Culture #☆Unique #☆Identity▪︎▪︎</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475251/3475251_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-21T15:22:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Marathon 2</video:title>
      <video:description>Money orientation all through #Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475250/3475250_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T15:22:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the sea off clouds</video:title>
      <video:description>The sunset and the sea of ​​clouds from the mountaintop are truly breathtaking. #mountain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475249/3475249_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T15:20:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Demons of The Night</video:title>
      <video:description>Demons of The Night</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475248/3475248_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-09-21T15:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#febspot#tungrung fanny video</video:title>
      <video:description>Tung tung fanny video 🤣🤣🤣</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475247/3475247_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T15:18:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Floating In My Mind - Recontando a vida - 삶을 다시 이야기하다</video:title>
      <video:description>CGI short animated film - Amazing ! #CGI #short #animation #life #time #ages #storytelling #curta-metragem #animação #vida #tempo #idades #narrativa #단편영화 #애니메이션 #삶 #시간 #시대 #서사</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475246/3475246_720p.mp4</video:content_loc>
      <video:duration>189</video:duration>
      <video:publication_date>2026-09-21T15:18:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New song 100</video:title>
      <video:description>New song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475245/3475245_720p.mp4</video:content_loc>
      <video:duration>285</video:duration>
      <video:publication_date>2026-09-21T15:18:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>macaco vai a praia.mp4</video:title>
      <video:description>macaco vai a praia.mp4 #macacovaiapraiamp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475244/3475244_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T15:17:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#16 LIMA VS FERREIRA - VALENDO VAGA PRA DISPUTA DE CINTURÃO - ELETRONICS ARTS EA SPORTS - MMA - PS3</video:title>
      <video:description>EA Sports MMA é um jogo de videogame de artes marciais mistas desenvolvido e publicado pela Electronic Arts (EA) Sports. Foi lançado para várias plataformas de jogos, incluindo o PlayStation 3 (PS3), em 2010. No jogo, os jogadores podem criar e personalizar seu próprio lutador e competir em uma variedade de torneios e eventos de artes marciais mistas. EA Sports MMA apresentou um elenco de lutadores da vida real de várias organizações de MMA e permitiu aos jogadores se envolverem em combates realistas usando uma variedade de disciplinas de artes marciais. Embora EA Sports MMA tenha sido geralmente bem recebido por sua jogabilidade e representação realista do esporte, enfrentou uma concorrência difícil de outras franquias de jogos de MMA, como o UFC Undisputed. A EA Sports eventualmente mudou o foco para o UFC (Ultimate Fighting Championship) e desenvolveu a série EA Sports UFC, que se tornou a principal série de jogos de MMA produzida pela EA Sports. Por favor, note que meu conhecimento se baseia em informações disponíveis até janeiro de 2022, e pode ter havido desenvolvimentos ou novos lançamentos relacionados a jogos de MMA desde então. #EASportsMMA #PS3Games #ArtesMarciaisMistas #JogosdeLuta #Lutadores #JogosdeEsportes #EAPlayStation #MMAVirtual #CompetiçõesOnline #JogosdeEsportesdeLuta #easports</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475243/3475243_720p.mp4</video:content_loc>
      <video:duration>440</video:duration>
      <video:publication_date>2026-09-21T15:17:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KAMLA KI LADDER KA RAAZ #shorts</video:title>
      <video:description>KAMLA KI LADDER KA RAAZ #shorts #HORROR</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475242/3475242_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T15:16:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>macaco vai ao supermercado.mp4</video:title>
      <video:description>macaco vai ao supermercado.mp4 #macacovaiaosupermercadomp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475241/3475241_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-09-21T15:15:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475240</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475240/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Será apena eu? rsrs</video:title>
      <video:description>#meme #zueira</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475240/3475240_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T15:15:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475239</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475239/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>me and brother</video:title>
      <video:description>Proof that guys aren&apos;t picky about their friends. #sea #brother #sunset</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475239/3475239_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T15:15:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dil Ko Sukoon Dene Wali Baat | Islamic Status #Shorts</video:title>
      <video:description>Assalamu Alaikum viewers, Welcome to Islamic Learning 786. In this short video, we share a beautiful and heart-touching Islamic reminder/lesson to inspire peace, faith, and positivity in your daily life. ✨ &quot;Remember Allah in times of ease, and He will remember you in times of hardship.&quot; If you found this reminder beneficial: 👍 Like the video 💬 Share your thoughts in the comments 🔔 Subscribe to Islamic Learning 786 for daily Islamic quotes, wazaif, and motivational reminders! #IslamicLearning786 #islamicshorts #islamicstatus #islamicreminder #urduquotes #hazrataliquotes #islamicquotesinurdu #hearttouchingislamicstatus #shorts #islamicwazaif #deenibatein #motivationalislamicquotes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475238/3475238_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T15:14:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475237</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475237/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ip Man 2 2010 iNTERNAL 720p BluRay ESub</video:title>
      <video:description>Centering on Ip Man’s migration to Hong Kong in 1949 as he attempts to propagate his discipline of Wing Chun martial arts. Follow and Share to show support on this channel so I can upload more movies. #Drama #action #Adventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475237/3475237_720p.mp4</video:content_loc>
      <video:duration>6486</video:duration>
      <video:publication_date>2026-09-21T15:14:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beach Vibes cool guy in orange polo</video:title>
      <video:description>Untuk video pantai ini bos: *Title:* Beach Vibes Cool Guy in Orange Polo 😎 Just chilling on the beach, feeling the flow. Anjayy moment. #beachViibes #coolguysunglasses #beachDance #Orangepolo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475236/3475236_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T15:14:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 12</video:title>
      <video:description>The tale of lady ok episode 12 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #kosageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475235/3475235_720p.mp4</video:content_loc>
      <video:duration>4242</video:duration>
      <video:publication_date>2026-09-21T15:13:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perenung</video:title>
      <video:description>Memahami makna yg terjadi #Prancis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475234/3475234_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T15:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dji Death Fails -</video:title>
      <video:description>CGI funny short animated film #CGI #shortfilm #hospital #deathpersonified #funny #curta-metragem #personificaçãodamorte #engraçado #단편영화 #병원 #의인화된죽음 #코믹</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475233/3475233_720p.mp4</video:content_loc>
      <video:duration>236</video:duration>
      <video:publication_date>2026-09-21T15:12:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Garapan criptes</video:title>
      <video:description>Menggarap crypto dicripte gratis dan mudah mengerjakannya latar belakang apapun bisa mengerjakannya #Criptesgratis #melihatiklasdapatcoincrypto #crypteslegit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475232/3475232_720p.mp4</video:content_loc>
      <video:duration>450</video:duration>
      <video:publication_date>2026-09-21T15:12:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spring of the Blade Episode 14 English Subtitles 2026 Drama latest Chinese</video:title>
      <video:description>Other name: 一瓯春 Description: Xie Qing Yuan, orphaned at a young age, lived on the streets until she met Shen Run, who had been sent to the army after a family tragedy. They parted ways with a promise to survive, and Shen Run gave her a penny as a token. Years later, Xie Qing Yuan returns to Xie Mansion, determined to uncover the truth about her mother’s death. As Shen Run rises to power, he is assigned to oversee the Xie family during a crisis. While working together, the two rekindle their bond. Shen Run is drawn to Xie Qing Yuan’s courage, intelligence, and optimism, while she grows to trust him as a close ally and friend. (Source: MyDramaList) ~~ Adapted from the novel “Yi Ou Chun” (一瓯春) by You Si Jie (尤四姐). Native Title: 一瓯春 Also Known As: A Cup of Love , Yi Ou Chun Country: Chinese Status: Ongoing Released: 2026 Genre: Family, Historical, political, Romance #Othername一瓯春DescriptionXieQingYuan #orphanedatayoungage #livedonthestreetsuntilshemetShenRun #whohadbeensenttothearmyafterafamilytragedyTheypartedwayswithapromisetosurvive #andShenRungaveherapennyasatokenYearslater #XieQingYuanreturnstoXieMansion #determinedtouncoverthetruthabouthermother’sdeathAsShenRunrisestopower #heisassignedtooverseetheXiefamilyduringacrisisWhileworkingtogether #thetworekindletheirbondShenRunisdrawntoXieQingYuan’scourage #intelligence #andoptimism #whileshegrowstotrusthimasacloseallyandfriendSourceMyDramaListAdaptedfromthenovel“YiOuChun”一瓯春byYouSiJie尤四姐NativeTitle一瓯春AlsoKnownAsACupofLove #YiOuChunCountryChineseStatusOngoingReleased2026GenreFamily #Historical #political #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475231/3475231_720p.mp4</video:content_loc>
      <video:duration>2738</video:duration>
      <video:publication_date>2026-09-21T15:12:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spring of the Blade Episode 13 English Subtitles 2026 Drama latest Chinese</video:title>
      <video:description>Other name: 一瓯春 Description: Xie Qing Yuan, orphaned at a young age, lived on the streets until she met Shen Run, who had been sent to the army after a family tragedy. They parted ways with a promise to survive, and Shen Run gave her a penny as a token. Years later, Xie Qing Yuan returns to Xie Mansion, determined to uncover the truth about her mother’s death. As Shen Run rises to power, he is assigned to oversee the Xie family during a crisis. While working together, the two rekindle their bond. Shen Run is drawn to Xie Qing Yuan’s courage, intelligence, and optimism, while she grows to trust him as a close ally and friend. (Source: MyDramaList) ~~ Adapted from the novel “Yi Ou Chun” (一瓯春) by You Si Jie (尤四姐). Native Title: 一瓯春 Also Known As: A Cup of Love , Yi Ou Chun Country: Chinese Status: Ongoing Released: 2026 Genre: Family, Historical, political, Romance #Othername一瓯春DescriptionXieQingYuan #orphanedatayoungage #livedonthestreetsuntilshemetShenRun #whohadbeensenttothearmyafterafamilytragedyTheypartedwayswithapromisetosurvive #andShenRungaveherapennyasatokenYearslater #XieQingYuanreturnstoXieMansion #determinedtouncoverthetruthabouthermother’sdeathAsShenRunrisestopower #heisassignedtooverseetheXiefamilyduringacrisisWhileworkingtogether #thetworekindletheirbondShenRunisdrawntoXieQingYuan’scourage #intelligence #andoptimism #whileshegrowstotrusthimasacloseallyandfriendSourceMyDramaListAdaptedfromthenovel“YiOuChun”一瓯春byYouSiJie尤四姐NativeTitle一瓯春AlsoKnownAsACupofLove #YiOuChunCountryChineseStatusOngoingReleased2026GenreFamily #Historical #political #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475230/3475230_720p.mp4</video:content_loc>
      <video:duration>2680</video:duration>
      <video:publication_date>2026-09-21T15:10:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Against The Current Episode 23 English Subtitles 2026 Drama latest Japanese</video:title>
      <video:description>Other name: 兰香如故 Description: Shen Jia Lan, once a nobleman’s granddaughter, falls from grace after her family is falsely accused of treason. Abandoned by her fiancé Lin Jin Qi, she is forced to assume a servant’s identity in his household. Despite hardships, she refuses to bow to fate. With resilience and wit, she rises above class barriers, wins Lin Jin Qi’s heart, earns the family’s respect, and ultimately clears her family’s name. (Source: WeTV) ~~ Adapted from the novel “Lan Xiang Yuan” (兰香缘) by He Yan Shan (禾晏山). Native Title: 兰香如故 Also Known As: Lan Xiang Ru Gu , Orchid Fragrance Remains , The Story of Xiang Lan , 蘭香如故 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama, Fantasy, Historical, Romance #Othername兰香如故DescriptionShenJiaLan #onceanobleman’sgranddaughter #fallsfromgraceafterherfamilyisfalselyaccusedoftreasonAbandonedbyherfiancéLinJinQi #sheisforcedtoassumeaservant’sidentityinhishouseholdDespitehardships #sherefusestobowtofateWithresilienceandwit #sherisesaboveclassbarriers #winsLinJinQi’sheart #earnsthefamily’srespect #andultimatelyclearsherfamily’snameSourceWeTVAdaptedfromthenovel“LanXiangYuan”兰香缘byHeYanShan禾晏山NativeTitle兰香如故AlsoKnownAsLanXiangRuGu #OrchidFragranceRemains #TheStoryofXiangLan #蘭香如故CountryChineseStatusOngoingReleased2026GenreDrama #Fantasy #Historical #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475229/3475229_720p.mp4</video:content_loc>
      <video:duration>2766</video:duration>
      <video:publication_date>2026-09-21T15:10:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Replay CGI short animated film</video:title>
      <video:description>The value that memories hold... - O valor que têm as lembranças... - 추억의 가치... #CGI #short #memories #distopic #pollution #death #mother #son #child #recorder #playground #curta-metragem #memórias #distópico #poluição #morte #mãe #filho #criança #gravador #parquinho #단편영화 #기억 #디스토피아 #오염 #죽음 #어머니 #아들 #아이 #녹음기 #놀이터</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475228/3475228_720p.mp4</video:content_loc>
      <video:duration>504</video:duration>
      <video:publication_date>2026-09-21T15:09:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fire home</video:title>
      <video:description>#Fire</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475227/3475227_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T15:09:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Against The Current Episode 22 English Subtitles 2026 Drama latest Japanese</video:title>
      <video:description>Other name: 兰香如故 Description: Shen Jia Lan, once a nobleman’s granddaughter, falls from grace after her family is falsely accused of treason. Abandoned by her fiancé Lin Jin Qi, she is forced to assume a servant’s identity in his household. Despite hardships, she refuses to bow to fate. With resilience and wit, she rises above class barriers, wins Lin Jin Qi’s heart, earns the family’s respect, and ultimately clears her family’s name. (Source: WeTV) ~~ Adapted from the novel “Lan Xiang Yuan” (兰香缘) by He Yan Shan (禾晏山). Native Title: 兰香如故 Also Known As: Lan Xiang Ru Gu , Orchid Fragrance Remains , The Story of Xiang Lan , 蘭香如故 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama, Fantasy, Historical, Romance #Othername兰香如故DescriptionShenJiaLan #onceanobleman’sgranddaughter #fallsfromgraceafterherfamilyisfalselyaccusedoftreasonAbandonedbyherfiancéLinJinQi #sheisforcedtoassumeaservant’sidentityinhishouseholdDespitehardships #sherefusestobowtofateWithresilienceandwit #sherisesaboveclassbarriers #winsLinJinQi’sheart #earnsthefamily’srespect #andultimatelyclearsherfamily’snameSourceWeTVAdaptedfromthenovel“LanXiangYuan”兰香缘byHeYanShan禾晏山NativeTitle兰香如故AlsoKnownAsLanXiangRuGu #OrchidFragranceRemains #TheStoryofXiangLan #蘭香如故CountryChineseStatusOngoingReleased2026GenreDrama #Fantasy #Historical #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475226/3475226_720p.mp4</video:content_loc>
      <video:duration>2770</video:duration>
      <video:publication_date>2026-09-21T15:08:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Rebecca Singha Dance</video:title>
      <video:description>Indian Girl Rebecca Singha Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475225/3475225_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T15:07:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Olha as plantinhas da minha esposa</video:title>
      <video:description>Linda né</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475224/3475224_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T15:07:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Energia, Estilo e Motivação</video:title>
      <video:description>Com look esportivo moderno e acessórios funcionais, a foto transmite energia, motivação e disciplina – elementos essenciais para quem busca saúde, bem-estar e performance. Uma inspiração perfeita para quem ama treinar, se cuidar e manter um estilo de vida equilibrado. #loira #modelo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475223/3475223_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T15:07:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💥💥💥💥</video:title>
      <video:description>🥰🥰🥰🥰🥰 #Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475222/3475222_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:06:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Against The Current Episode 21 English Subtitles 2026 Drama latest Japanese</video:title>
      <video:description>Other name: 兰香如故 Description: Shen Jia Lan, once a nobleman’s granddaughter, falls from grace after her family is falsely accused of treason. Abandoned by her fiancé Lin Jin Qi, she is forced to assume a servant’s identity in his household. Despite hardships, she refuses to bow to fate. With resilience and wit, she rises above class barriers, wins Lin Jin Qi’s heart, earns the family’s respect, and ultimately clears her family’s name. (Source: WeTV) ~~ Adapted from the novel “Lan Xiang Yuan” (兰香缘) by He Yan Shan (禾晏山). Native Title: 兰香如故 Also Known As: Lan Xiang Ru Gu , Orchid Fragrance Remains , The Story of Xiang Lan , 蘭香如故 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama, Fantasy, Historical, Romance #Othername兰香如故DescriptionShenJiaLan #onceanobleman’sgranddaughter #fallsfromgraceafterherfamilyisfalselyaccusedoftreasonAbandonedbyherfiancéLinJinQi #sheisforcedtoassumeaservant’sidentityinhishouseholdDespitehardships #sherefusestobowtofateWithresilienceandwit #sherisesaboveclassbarriers #winsLinJinQi’sheart #earnsthefamily’srespect #andultimatelyclearsherfamily’snameSourceWeTVAdaptedfromthenovel“LanXiangYuan”兰香缘byHeYanShan禾晏山NativeTitle兰香如故AlsoKnownAsLanXiangRuGu #OrchidFragranceRemains #TheStoryofXiangLan #蘭香如故CountryChineseStatusOngoingReleased2026GenreDrama #Fantasy #Historical #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475220/3475220_720p.mp4</video:content_loc>
      <video:duration>2800</video:duration>
      <video:publication_date>2026-09-21T15:06:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Are You</video:title>
      <video:description>🥰❤️🥰❤️🥰❤️🥰 #Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475218/3475218_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T15:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MIDNIGHT RULER</video:title>
      <video:description>I just made this song and its my first one so yeah #midnight #knight #song #music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475217/3475217_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-21T15:05:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475216</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475216/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New blog beautiful nature viral video 🥰👍</video:title>
      <video:description>New blog beautiful nature viral video 🥰👍 #Newblog #beautiful #nature #viralvideo #trendingsearches #trendingvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475216/3475216_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T15:05:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PELCIMADESO 3</video:title>
      <video:description>PELCIMADESO #PELCIMADESO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475215/3475215_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:05:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Tiny Zebra Comes Out of a Paint Tube?! 😱🦓✨</video:title>
      <video:description>It starts with a simple paint tube… then suddenly, a tiny zebra magically comes to life! 🦓😍 Watch the transformation and see this adorable little zebra appear right before your eyes! ✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475214/3475214_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T15:05:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My video 139</video:title>
      <video:description>Hello How are you #Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475213/3475213_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T15:05:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PELCIMADESO 2</video:title>
      <video:description>CURSOS #CURSOS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475212/3475212_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:05:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>পার্কের কাজ চলতেছে</video:title>
      <video:description>পার্কের কাজ চলতেছে</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475211/3475211_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T15:04:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sabiá faz ninho dentro da igreja</video:title>
      <video:description>Eu estava na igreja quando de repente uma sabiá veio voando e fui para o seu ninho que fica dentro da igreja #viralbrasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475210/3475210_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T15:04:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como Fazer Arroz Paraense Tradicional com Tucupi e Jambu</video:title>
      <video:description>O arroz paraense é uma das maiores joias da culinária do Norte do Brasil. Misturando a acidez única do tucupi, o aroma marcante do camarão e o famoso tremor do jambu, esse prato transforma um almoço comum em uma verdadeira viagem gastronômica pela Amazônia. Se você procura uma refeição de prato único que seja rica em texturas e sabores marcantes, essa receita é a escolha perfeita. Ingredientes 2 xícaras (chá) de arroz (tipo agulhinha ou parboilizado) 4 xícaras (chá) de tucupi (caldo de mandioca amarela) 1 maço de jambu fresco 400g de camarões médios limpos (você pode usar camarão seco dessalgado ou fresco grelhado) 3 dentes de alho picados 1 cebola média picada em cubos finos 2 colheres (sopa) de azeite de oliva ou óleo Pimenta-de-cheiro picada a gosto Sal a gosto Modo de Preparo: Prepare o Jambu: Lave bem as folhas e ramos de jambu. Em uma panela com água fervente e uma pitada de sal, de uma leve escaldada nas folhas por cerca de 2 minutos. Escorra e jogue imediatamente em água gelada para parar o cozimento e manter o verde vivo. Reserve. Aqueça o Tucupi: Em outra panela, coloque o tucupi com um dente de alho amassado e uma pimenta-de-cheiro inteira. Deixe ferver por 10 minutos para apurar o sabor. Mantenha morno. Refogue a Base: Em uma panela grande, aqueça o azeite e refogue a cebola e o alho até que fiquem dourados e aromáticos. Cozinhe o Arroz: Adicione o arroz à panela e frite por um minuto. Em vez de usar água, adicione o tucupi quente aos poucos para cozinhar o arroz. Mexa de vez em quando para que o arroz absorva o caldo e fique com uma textura úmida e aveludada. Adicione os Camarões e o Jambu: Quando o arroz estiver quase cozido (al dente), adicione as folhas de jambu reservadas e os camarões. Se estiver usando camarões frescos grelhados, adicione-os apenas no</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475209/3475209_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T15:04:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1million</video:title>
      <video:description>Viral #Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475208/3475208_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T15:04:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PECIMADESO</video:title>
      <video:description>PELCIMADESO #CIMADESO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475207/3475207_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:04:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SEJA BEM VINDO ESPÍRITO SANTO</video:title>
      <video:description>SEJA BEM VINDO ESPÍRITO SANTO #SEJABEMVINDOESPÍRITOSANTO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475206/3475206_720p.mp4</video:content_loc>
      <video:duration>161</video:duration>
      <video:publication_date>2026-09-21T15:03:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Tiny Tiger Came Out of a Paint Tube?! 😱🐯✨</video:title>
      <video:description>What starts as a simple drop of paint turns into an adorable tiny tiger! 🐯😍 Watch as the magical paint transforms into a cute, realistic tiger right before your eyes. ✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475205/3475205_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T15:03:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ujung ujungnya begini mulu</video:title>
      <video:description>Ujung ujungnya begini mulu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475204/3475204_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-09-21T15:03:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Earn 50_$ per hour???</video:title>
      <video:description>#EarningMOneySurveys50Dollars</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475203/3475203_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T15:02:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kiwi  - CGI short animated film</video:title>
      <video:description>Short film with a message... #CGI #short #kiwi #dream #obsession #fly #death #curta-metragem #sonho #obsessão #voar #morte #단편영화 #키위 #꿈 #집착 #비행 #죽음</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475202/3475202_720p.mp4</video:content_loc>
      <video:duration>190</video:duration>
      <video:publication_date>2026-09-21T15:02:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PELCIMADESO</video:title>
      <video:description>PELCIMADESO #PELCIMADESO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475201/3475201_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T15:02:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIGUINHO</video:title>
      <video:description>DIGUINHO #DIGUINHO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475200/3475200_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T15:01:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Super Air Jet flight attendant Maya Resti.mp4</video:title>
      <video:description>Beautiful Super Air Jet flight attendant Maya Resti.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475199/3475199_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T15:01:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masak nasi</video:title>
      <video:description>#Masaknasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475198/3475198_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T15:01:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iris kol</video:title>
      <video:description>#Iriskol</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475197/3475197_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T15:00:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 675</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE SWIMMMINGPOOL PART 675 #HOST #AMERIKA #BEAITUFULSEXY #SWIMMMINGPOOLPART675</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475196/3475196_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T15:00:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sinceramente</video:title>
      <video:description>😌😌</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475195/3475195_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T15:00:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bersolek</video:title>
      <video:description>#Bersolek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475194/3475194_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T15:00:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pisang 6</video:title>
      <video:description>#Pisang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475193/3475193_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T15:00:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Made garden</video:title>
      <video:description>#Garden</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475192/3475192_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T14:59:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kesiangan 2</video:title>
      <video:description>#Kesiangan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475191/3475191_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:59:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🦚 A Beautiful Peacock Came Out of a Paint Tube?! 😱✨</video:title>
      <video:description>At first, it looked like ordinary paint… but when the tube was squeezed, it suddenly transformed into a tiny, incredibly realistic peacock! 😍✨ Wait until its beautiful tail opens!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475190/3475190_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:59:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The piano - Classic CGI short animation film</video:title>
      <video:description>Pure poetry. Nostalgic. Moving. - Pura poesia. Nostálgica. Comovente. - 순수한 시적 감성. 향수를 불러일으키는. 감동적인. #CGI #short #animation #piano #oldman #memories #youngman #childhood #death #nostalgic #sad #poetry #curta-metragem #animação #idoso #memórias #jovem #infância #morte #nostálgico #triste #poesia #단편 #애니메이션 #피아노 #노인 #추억 #청년 #어린시절 #죽음 #향수 #슬픔 #시</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475189/3475189_720p.mp4</video:content_loc>
      <video:duration>143</video:duration>
      <video:publication_date>2026-09-21T14:59:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menyapu halaman</video:title>
      <video:description>#Menyapu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475188/3475188_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T14:58:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasih makan ayam</video:title>
      <video:description>#Ayam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475187/3475187_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:58:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475186</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475186/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menimba air buat mandi</video:title>
      <video:description>#Menimbaair</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475186/3475186_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:57:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 674</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE WATERFALL PART 674 #HOST #AMERIKA #BEAUTIFUL #SEXY #WATERFALL #PART674</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475185/3475185_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T14:56:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475184</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475184/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As Promised Episode 6 English Subtitles Chinese Drama</video:title>
      <video:description>Other name: 如期 Description: He Xiao Yuan is trapped in a cycle of thirty-three rebirths. In every lifetime, she tries and fails to win the love of Crown Prince Zhao Jun Yao. After being reborn in the thirty-fourth lifetime, the Seventh Prince, Zhao Bo Qing, reveals the condition for ending the cycle that Zhao Bo Qing must ascend the throne, and He Xiao Yuan must win the Crown Prince’s true love. Zhao Bo Qing helps He Xiao Yuan develop the skills to get closer to the Crown Prince. However, as feelings gradually grow between Zhao Bo Qing and He Xiao Yuan, new obstacles arise. He Xiao Yuan is unwilling to end the cycle because she wants to reunite with her deceased parents, while Zhao Bo Qing must break the cycle in order to save the people. In the end, they are forced to face a painful choice between country and family. (Source: Chinese = Baidu || Translation = MyDramaList) ~~ Adapted from the web novel “The Villain Teaches Me How to Chase Girls” (反派教我追女生) by Lan San Jiao (蓝三角). Native Title: 如期 Also Known As: Fan Pai Jiao Wo Zhui Nv Sheng , Ru Qi , The Villain Teaches Me How to Chase Girls , 反派教我追女生 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #Othername如期DescriptionHeXiaoYuanistrappedinacycleofthirty-threerebirthsIneverylifetime #shetriesandfailstowintheloveofCrownPrinceZhaoJunYaoAfterbeingreborninthethirty-fourthlifetime #theSeventhPrince #ZhaoBoQing #revealstheconditionforendingthecyclethatZhaoBoQingmustascendthethrone #andHeXiaoYuanmustwintheCrownPrince’strueloveZhaoBoQinghelpsHeXiaoYuandeveloptheskillstogetclosertotheCrownPrinceHowever #asfeelingsgraduallygrowbetweenZhaoBoQingandHeXiaoYuan #newobstaclesariseHeXiaoYuanisunwillingtoendthecyclebecauseshewantstoreunitewithherdeceasedparents #whileZhaoBoQingmustbreakthecycleinordertosavethepeopleIntheend </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475184/3475184_720p.mp4</video:content_loc>
      <video:duration>902</video:duration>
      <video:publication_date>2026-09-21T14:55:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>my bird</video:title>
      <video:description>song #beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475183/3475183_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T14:55:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🦍 A Tiny Gorilla Came Out of the Tube?! 😱✨</video:title>
      <video:description>At first, it looked like an ordinary tube… but suddenly, a tiny, incredibly realistic gorilla came out! 😍🦍 So creative and satisfying to watch—wait until the end!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475182/3475182_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:55:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475181</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475181/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As Promised Episode 5 English Subtitles Chinese Drama</video:title>
      <video:description>Other name: 如期 Description: He Xiao Yuan is trapped in a cycle of thirty-three rebirths. In every lifetime, she tries and fails to win the love of Crown Prince Zhao Jun Yao. After being reborn in the thirty-fourth lifetime, the Seventh Prince, Zhao Bo Qing, reveals the condition for ending the cycle that Zhao Bo Qing must ascend the throne, and He Xiao Yuan must win the Crown Prince’s true love. Zhao Bo Qing helps He Xiao Yuan develop the skills to get closer to the Crown Prince. However, as feelings gradually grow between Zhao Bo Qing and He Xiao Yuan, new obstacles arise. He Xiao Yuan is unwilling to end the cycle because she wants to reunite with her deceased parents, while Zhao Bo Qing must break the cycle in order to save the people. In the end, they are forced to face a painful choice between country and family. (Source: Chinese = Baidu || Translation = MyDramaList) ~~ Adapted from the web novel “The Villain Teaches Me How to Chase Girls” (反派教我追女生) by Lan San Jiao (蓝三角). Native Title: 如期 Also Known As: Fan Pai Jiao Wo Zhui Nv Sheng , Ru Qi , The Villain Teaches Me How to Chase Girls , 反派教我追女生 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #Othername如期DescriptionHeXiaoYuanistrappedinacycleofthirty-threerebirthsIneverylifetime #shetriesandfailstowintheloveofCrownPrinceZhaoJunYaoAfterbeingreborninthethirty-fourthlifetime #theSeventhPrince #ZhaoBoQing #revealstheconditionforendingthecyclethatZhaoBoQingmustascendthethrone #andHeXiaoYuanmustwintheCrownPrince’strueloveZhaoBoQinghelpsHeXiaoYuandeveloptheskillstogetclosertotheCrownPrinceHowever #asfeelingsgraduallygrowbetweenZhaoBoQingandHeXiaoYuan #newobstaclesariseHeXiaoYuanisunwillingtoendthecyclebecauseshewantstoreunitewithherdeceasedparents #whileZhaoBoQingmustbreakthecycleinordertosavethepeopleIntheend </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475181/3475181_720p.mp4</video:content_loc>
      <video:duration>969</video:duration>
      <video:publication_date>2026-09-21T14:55:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motu Patlu 12</video:title>
      <video:description>Motu Patlu #MotuPatlu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475180/3475180_720p.mp4</video:content_loc>
      <video:duration>118</video:duration>
      <video:publication_date>2026-09-21T14:54:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As Promised Episode 4 English Subtitles Chinese Drama</video:title>
      <video:description>Other name: 如期 Description: He Xiao Yuan is trapped in a cycle of thirty-three rebirths. In every lifetime, she tries and fails to win the love of Crown Prince Zhao Jun Yao. After being reborn in the thirty-fourth lifetime, the Seventh Prince, Zhao Bo Qing, reveals the condition for ending the cycle that Zhao Bo Qing must ascend the throne, and He Xiao Yuan must win the Crown Prince’s true love. Zhao Bo Qing helps He Xiao Yuan develop the skills to get closer to the Crown Prince. However, as feelings gradually grow between Zhao Bo Qing and He Xiao Yuan, new obstacles arise. He Xiao Yuan is unwilling to end the cycle because she wants to reunite with her deceased parents, while Zhao Bo Qing must break the cycle in order to save the people. In the end, they are forced to face a painful choice between country and family. (Source: Chinese = Baidu || Translation = MyDramaList) ~~ Adapted from the web novel “The Villain Teaches Me How to Chase Girls” (反派教我追女生) by Lan San Jiao (蓝三角). Native Title: 如期 Also Known As: Fan Pai Jiao Wo Zhui Nv Sheng , Ru Qi , The Villain Teaches Me How to Chase Girls , 反派教我追女生 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #Othername如期DescriptionHeXiaoYuanistrappedinacycleofthirty-threerebirthsIneverylifetime #shetriesandfailstowintheloveofCrownPrinceZhaoJunYaoAfterbeingreborninthethirty-fourthlifetime #theSeventhPrince #ZhaoBoQing #revealstheconditionforendingthecyclethatZhaoBoQingmustascendthethrone #andHeXiaoYuanmustwintheCrownPrince’strueloveZhaoBoQinghelpsHeXiaoYuandeveloptheskillstogetclosertotheCrownPrinceHowever #asfeelingsgraduallygrowbetweenZhaoBoQingandHeXiaoYuan #newobstaclesariseHeXiaoYuanisunwillingtoendthecyclebecauseshewantstoreunitewithherdeceasedparents #whileZhaoBoQingmustbreakthecycleinordertosavethepeopleIntheend </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475179/3475179_720p.mp4</video:content_loc>
      <video:duration>907</video:duration>
      <video:publication_date>2026-09-21T14:54:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pengantin tertipu</video:title>
      <video:description>Hati hati sebelum menetapkan pasangan hidup. Jangan sampai kena tipu. #pengantinpalsu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475178/3475178_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T14:53:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475177</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475177/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 673</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE GARDEN PART 673 #HOST #AMERIKA #BEAUTIFUL #SEXY #GARDEN #PART673</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475177/3475177_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T14:53:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475176</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475176/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As Promised Episode 3 English Subtitles Chinese Drama</video:title>
      <video:description>Other name: 如期 Description: He Xiao Yuan is trapped in a cycle of thirty-three rebirths. In every lifetime, she tries and fails to win the love of Crown Prince Zhao Jun Yao. After being reborn in the thirty-fourth lifetime, the Seventh Prince, Zhao Bo Qing, reveals the condition for ending the cycle that Zhao Bo Qing must ascend the throne, and He Xiao Yuan must win the Crown Prince’s true love. Zhao Bo Qing helps He Xiao Yuan develop the skills to get closer to the Crown Prince. However, as feelings gradually grow between Zhao Bo Qing and He Xiao Yuan, new obstacles arise. He Xiao Yuan is unwilling to end the cycle because she wants to reunite with her deceased parents, while Zhao Bo Qing must break the cycle in order to save the people. In the end, they are forced to face a painful choice between country and family. (Source: Chinese = Baidu || Translation = MyDramaList) ~~ Adapted from the web novel “The Villain Teaches Me How to Chase Girls” (反派教我追女生) by Lan San Jiao (蓝三角). Native Title: 如期 Also Known As: Fan Pai Jiao Wo Zhui Nv Sheng , Ru Qi , The Villain Teaches Me How to Chase Girls , 反派教我追女生 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #Othername如期DescriptionHeXiaoYuanistrappedinacycleofthirty-threerebirthsIneverylifetime #shetriesandfailstowintheloveofCrownPrinceZhaoJunYaoAfterbeingreborninthethirty-fourthlifetime #theSeventhPrince #ZhaoBoQing #revealstheconditionforendingthecyclethatZhaoBoQingmustascendthethrone #andHeXiaoYuanmustwintheCrownPrince’strueloveZhaoBoQinghelpsHeXiaoYuandeveloptheskillstogetclosertotheCrownPrinceHowever #asfeelingsgraduallygrowbetweenZhaoBoQingandHeXiaoYuan #newobstaclesariseHeXiaoYuanisunwillingtoendthecyclebecauseshewantstoreunitewithherdeceasedparents #whileZhaoBoQingmustbreakthecycleinordertosavethepeopleIntheend </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475176/3475176_720p.mp4</video:content_loc>
      <video:duration>657</video:duration>
      <video:publication_date>2026-09-21T14:53:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você Não Está Atrasado — Está No Seu Caminho.</video:title>
      <video:description>Você Não Está Atrasado — Está No Seu Caminho. #VocêNãoEstáAtrasadoEstáNoSeuCaminhoMotivaçãoSuperaçãoForçaInteriorResiliênciaSuperaçãoDiária</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475175/3475175_720p.mp4</video:content_loc>
      <video:duration>736</video:duration>
      <video:publication_date>2026-09-21T14:53:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Let&apos;s dance, little friend.</video:title>
      <video:description>#Dance #hot #girlhot #girls #Shakeit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475174/3475174_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-09-21T14:53:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>lets go mootage</video:title>
      <video:description>moontage #music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475173/3475173_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T14:53:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475172</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475172/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As Promised Episode 2 English Subtitles Chinese Drama</video:title>
      <video:description>Other name: 如期 Description: He Xiao Yuan is trapped in a cycle of thirty-three rebirths. In every lifetime, she tries and fails to win the love of Crown Prince Zhao Jun Yao. After being reborn in the thirty-fourth lifetime, the Seventh Prince, Zhao Bo Qing, reveals the condition for ending the cycle that Zhao Bo Qing must ascend the throne, and He Xiao Yuan must win the Crown Prince’s true love. Zhao Bo Qing helps He Xiao Yuan develop the skills to get closer to the Crown Prince. However, as feelings gradually grow between Zhao Bo Qing and He Xiao Yuan, new obstacles arise. He Xiao Yuan is unwilling to end the cycle because she wants to reunite with her deceased parents, while Zhao Bo Qing must break the cycle in order to save the people. In the end, they are forced to face a painful choice between country and family. (Source: Chinese = Baidu || Translation = MyDramaList) ~~ Adapted from the web novel “The Villain Teaches Me How to Chase Girls” (反派教我追女生) by Lan San Jiao (蓝三角). Native Title: 如期 Also Known As: Fan Pai Jiao Wo Zhui Nv Sheng , Ru Qi , The Villain Teaches Me How to Chase Girls , 反派教我追女生 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #Othername如期DescriptionHeXiaoYuanistrappedinacycleofthirty-threerebirthsIneverylifetime #shetriesandfailstowintheloveofCrownPrinceZhaoJunYaoAfterbeingreborninthethirty-fourthlifetime #theSeventhPrince #ZhaoBoQing #revealstheconditionforendingthecyclethatZhaoBoQingmustascendthethrone #andHeXiaoYuanmustwintheCrownPrince’strueloveZhaoBoQinghelpsHeXiaoYuandeveloptheskillstogetclosertotheCrownPrinceHowever #asfeelingsgraduallygrowbetweenZhaoBoQingandHeXiaoYuan #newobstaclesariseHeXiaoYuanisunwillingtoendthecyclebecauseshewantstoreunitewithherdeceasedparents #whileZhaoBoQingmustbreakthecycleinordertosavethepeopleIntheend </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475172/3475172_720p.mp4</video:content_loc>
      <video:duration>577</video:duration>
      <video:publication_date>2026-09-21T14:53:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475171</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475171/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>monkey eat mango</video:title>
      <video:description>#monskey</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475171/3475171_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:53:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Birdon - CGI intelligent short film</video:title>
      <video:description>The freedom you dream of and the freedom you have - A liberdade com a que você sonha e a que você tem - 당신이 꿈꾸는 자유와 당신이 누리는 자유 #CGI #short #animation #bird #cage #dream #freedom #nightmare #scare #terror #prison #curta-metragem #animação #pássaro #gaiola #sonho #liberdade #pesadelo #susto #prisão #짧은 #애니메이션 #새 #새장 #꿈 #자유 #악몽 #공포 #테러 #감옥</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475170/3475170_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-21T14:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As Promised Episode 1 English Subtitles Chinese Drama</video:title>
      <video:description>Other name: 如期 Description: He Xiao Yuan is trapped in a cycle of thirty-three rebirths. In every lifetime, she tries and fails to win the love of Crown Prince Zhao Jun Yao. After being reborn in the thirty-fourth lifetime, the Seventh Prince, Zhao Bo Qing, reveals the condition for ending the cycle that Zhao Bo Qing must ascend the throne, and He Xiao Yuan must win the Crown Prince’s true love. Zhao Bo Qing helps He Xiao Yuan develop the skills to get closer to the Crown Prince. However, as feelings gradually grow between Zhao Bo Qing and He Xiao Yuan, new obstacles arise. He Xiao Yuan is unwilling to end the cycle because she wants to reunite with her deceased parents, while Zhao Bo Qing must break the cycle in order to save the people. In the end, they are forced to face a painful choice between country and family. (Source: Chinese = Baidu || Translation = MyDramaList) ~~ Adapted from the web novel “The Villain Teaches Me How to Chase Girls” (反派教我追女生) by Lan San Jiao (蓝三角). Native Title: 如期 Also Known As: Fan Pai Jiao Wo Zhui Nv Sheng , Ru Qi , The Villain Teaches Me How to Chase Girls , 反派教我追女生 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #Othername如期DescriptionHeXiaoYuanistrappedinacycleofthirty-threerebirthsIneverylifetime #shetriesandfailstowintheloveofCrownPrinceZhaoJunYaoAfterbeingreborninthethirty-fourthlifetime #theSeventhPrince #ZhaoBoQing #revealstheconditionforendingthecyclethatZhaoBoQingmustascendthethrone #andHeXiaoYuanmustwintheCrownPrince’strueloveZhaoBoQinghelpsHeXiaoYuandeveloptheskillstogetclosertotheCrownPrinceHowever #asfeelingsgraduallygrowbetweenZhaoBoQingandHeXiaoYuan #newobstaclesariseHeXiaoYuanisunwillingtoendthecyclebecauseshewantstoreunitewithherdeceasedparents #whileZhaoBoQingmustbreakthecycleinordertosavethepeopleIntheend </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475169/3475169_720p.mp4</video:content_loc>
      <video:duration>748</video:duration>
      <video:publication_date>2026-09-21T14:52:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ladies dance</video:title>
      <video:description>A ladies was dance in the beach #Dance #ladies #beach #woman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475168/3475168_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:51:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yuna&apos;s making her bed</video:title>
      <video:description>#makingherbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475167/3475167_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:51:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475166</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475166/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata hari maseh</video:title>
      <video:description>Lest goooo #katakata #motivasi #sindiran #fyp #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475166/3475166_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T14:50:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frome</video:title>
      <video:description>Another planet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475165/3475165_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:50:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Self adhesive hooks for bathroom</video:title>
      <video:description>Self adhesive hooks for bathroom #bathroomhook #useful #gadget #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475164/3475164_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:50:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m going to teach you how to do a difficult dance.</video:title>
      <video:description>#DanceHot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475163/3475163_720p.mp4</video:content_loc>
      <video:duration>109</video:duration>
      <video:publication_date>2026-09-21T14:50:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Food Videos</video:title>
      <video:description>Videos mukhang happy #Videos #USA #UK #Food</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475162/3475162_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T14:49:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475161</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475161/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masa lalu adalah pelajaran, bukan sesuatu yang harus terus diratapi</video:title>
      <video:description>motivasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475161/3475161_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T14:49:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tolders cake</video:title>
      <video:description>Enjoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475160/3475160_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:49:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Esse Pai é extreçado</video:title>
      <video:description>Conselhos da vida que vc tenta lembrar mas esqueces 😂😂</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475159/3475159_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T14:49:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Music 507</video:title>
      <video:description>This is one of my favorite music #Music #Song #keren #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475158/3475158_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:49:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aku tetap berharga, bahkan ketika pencapaianku belum sesuai harapan</video:title>
      <video:description>motivasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475157/3475157_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T14:49:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475156</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475156/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tourist attractions in Bali</video:title>
      <video:description>A tourist spot that is currently going viral in Bali. #Tourist #Bali #indah #viral #videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475156/3475156_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:49:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475155</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475155/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enjoy 110</video:title>
      <video:description>The magic of horogram</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475155/3475155_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:48:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>White Stripes_ Seven Nation Army (guitar)</video:title>
      <video:description>#WhiteStripesGuitatCover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475154/3475154_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T14:48:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Assalamualaik Zainal Anbiya lagu merdu sholawat#sholawat#mahalulqiyam #islam #shorts.mp4</video:title>
      <video:description>Assalamualaik Zainal Anbiya lagu merdu sholawat#sholawat#mahalulqiyam #islam #shorts.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475153/3475153_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-21T14:48:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cheerful Minion Yarn Doll</video:title>
      <video:description>A cute handmade Minion-inspired doll crafted from colorful yarn, featuring bright yellow and blue tones, oversized googly eyes, black details, and tiny decorative beads. The adorable doll is held up by hand, while several similar handmade figures appear in the background. The vibrant colors and playful design create a cheerful, fun, and creative atmosphere, showcasing the charm of handmade crafts.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475152/3475152_720p.mp4</video:content_loc>
      <video:duration>133</video:duration>
      <video:publication_date>2026-09-21T14:47:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Watch the funny antics of these animals.</video:title>
      <video:description>Get ready to smile and laugh at the hilarious and adorable antics of these funny animals! From playful moments to unexpected reactions, these cute creatures are sure to brighten your day. 🐾❤️ #FunnyAnimalsAnimalFunnyCuteAnimalsFunnyPetsAnimalLoversPetLoversAnimalVideosFunnyVideoCutePetsAdorableAnimalsAnimalLifePetVideosHilariousAnimalsFunnyMomentsAnimals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475151/3475151_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T14:46:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasian tapi lucu</video:title>
      <video:description>Humor, lucu, fany #Humor #lucu #fany</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475150/3475150_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T14:45:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reacher S4E7 Hindi Dubbed</video:title>
      <video:description>Reacher S4E7 Hindi Dubbed #hindidubbed #reacher #s4 #episodes #webseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475149/3475149_720p.mp4</video:content_loc>
      <video:duration>2574</video:duration>
      <video:publication_date>2026-09-21T14:45:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resident Evil New</video:title>
      <video:description>Resident Evil New #residentevil #horromovie #movies #horror</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475148/3475148_720p.mp4</video:content_loc>
      <video:duration>5221</video:duration>
      <video:publication_date>2026-09-21T14:45:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475147</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475147/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aku tidak harus menjadi yang terbaik hari ini, cukup menjadi lebih baik dari kemarin</video:title>
      <video:description>motivasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475147/3475147_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T14:45:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mobil mini</video:title>
      <video:description>Mobil mini terbaru 2026 #Mobilmini</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475146/3475146_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T14:44:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nirvana_ Smells Like a Teen Spirit (guitar)</video:title>
      <video:description>#NirvanaCoverGuitarSmellslikeateenSpirit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475145/3475145_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T14:44:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Litoral do Paraná Brasil</video:title>
      <video:description>#Praia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475144/3475144_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T14:44:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crew Girl S01 E08 720p WEB-DL ESub</video:title>
      <video:description>16-year-old rower Teagan becomes coxswain of a troubled boys’ crew at an elite prep school. She navigates team drama, romance, rival crews, and a complex relationship with her mom while trying to lead them to victory. Follow and Share to show support on this channel so I can upload more movies. #Drama #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475143/3475143_720p.mp4</video:content_loc>
      <video:duration>2671</video:duration>
      <video:publication_date>2026-09-21T14:40:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus passou por Mateus e disse: “Segue-me!” 🙏✨  Ele também passa pela nossa vida e nos chama .</video:title>
      <video:description>Jesus passou por Mateus e disse: “Segue-me!” 🙏✨ Ele também passa pela nossa vida e nos chama a uma nova história. Será que hoje você está disposto a deixar tudo e seguir Jesus? ❤️ #EvangelhoJesusTeChamaFéCatólicaMãeDaMisericórdia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475142/3475142_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T14:39:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BLOODSTRIKER🔥🔥??? 32</video:title>
      <video:description>#fyp #warzone #bloodstrike #bloodstrikebr #foryou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475141/3475141_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T14:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lets &apos;make a peace&apos;</video:title>
      <video:description>For a war where do not stop. #US #CA #UK #BR #FR #EUROPE #CN #ID #INA #ASIA #AUS #NZ #RU #LATINAMERICAN #AFRICA #SA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475140/3475140_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T14:39:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crew Girl S01 E07 720p WEB-DL ESub</video:title>
      <video:description>16-year-old rower Teagan becomes coxswain of a troubled boys’ crew at an elite prep school. She navigates team drama, romance, rival crews, and a complex relationship with her mom while trying to lead them to victory. Follow and Share to show support on this channel so I can upload more movies. #Drama #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475139/3475139_720p.mp4</video:content_loc>
      <video:duration>2410</video:duration>
      <video:publication_date>2026-09-21T14:39:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>baju tidur wanita dewasa / gaun malam,  nightgown / baju dinas, bodysuit cocok,  untuk seserahan per</video:title>
      <video:description>BELI DI SINI https://vt.tokopedia.com/t/ZS9AAegKjNTGM-rsjRz/ baju tidur wanita dewasa / gaun malam, nightgown / baju dinas, bodysuit cocok, untuk seserahan pernikahan, #bajutidurwanitadewasagaunmalam #nightgownbajudinas #bodysuitcocok #untukseserahanpernikahan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475138/3475138_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:39:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crew Girl S01 E6 720p WEB-DL ESub</video:title>
      <video:description>16-year-old rower Teagan becomes coxswain of a troubled boys’ crew at an elite prep school. She navigates team drama, romance, rival crews, and a complex relationship with her mom while trying to lead them to victory. Follow and Share to show support on this channel so I can upload more movies. #Drama #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475137/3475137_720p.mp4</video:content_loc>
      <video:duration>2607</video:duration>
      <video:publication_date>2026-09-21T14:38:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;If you want to find true happiness, seek new places and new experiences.&quot; 😊🏕️🏔️</video:title>
      <video:description>&quot;If you want to find true happiness, seek new places and new experiences.&quot; 😊🏕️🏔️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475136/3475136_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T14:37:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Música 28</video:title>
      <video:description>Música</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475135/3475135_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:37:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crew Girl S01 E05 720p WEB-DL ESub</video:title>
      <video:description>16-year-old rower Teagan becomes coxswain of a troubled boys’ crew at an elite prep school. She navigates team drama, romance, rival crews, and a complex relationship with her mom while trying to lead them to victory. Follow and Share to show support on this channel so I can upload more movies. #Drama #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475134/3475134_720p.mp4</video:content_loc>
      <video:duration>2796</video:duration>
      <video:publication_date>2026-09-21T14:36:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>সাথী পার্ক 2</video:title>
      <video:description>সাথী পার্ক</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475133/3475133_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T14:36:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>a giant frog project in the middle of the island</video:title>
      <video:description>a large island under construction of a giant frog project using heavy equipment #giantfrog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475132/3475132_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:36:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hujan turun</video:title>
      <video:description>#Hujanderas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475131/3475131_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T14:36:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beast Tamer: The Weakest Support Beast Ascends via Devouring</video:title>
      <video:description>Enter the world of Luna&apos;s Choice Shorts — where myths meet burning passion. 🐺✨ Synopsis：Transmigrated into a beast‑tamer world, everyone contracts combat beasts that level up by fighting monsters. Support beasts, however, are seen as worthless and incompetent. #Cenimaticfilm #AIfilm #aifullmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475130/3475130_720p.mp4</video:content_loc>
      <video:duration>6734</video:duration>
      <video:publication_date>2026-09-21T14:35:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Playing Football</video:title>
      <video:description>#Football #playfootball</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475129/3475129_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T14:35:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beli autan</video:title>
      <video:description>#Beliautan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475128/3475128_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:35:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crew Girl S01 E04 720p WEB-DL ESub</video:title>
      <video:description>16-year-old rower Teagan becomes coxswain of a troubled boys’ crew at an elite prep school. She navigates team drama, romance, rival crews, and a complex relationship with her mom while trying to lead them to victory. Follow and Share to show support on this channel so I can upload more movies. #Drama #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475127/3475127_720p.mp4</video:content_loc>
      <video:duration>2745</video:duration>
      <video:publication_date>2026-09-21T14:35:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berbincang sama nenek</video:title>
      <video:description>#Berbincangsamanenek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475126/3475126_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:35:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iris cabe</video:title>
      <video:description>#Iriscabe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475125/3475125_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:34:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buat nasi goreng</video:title>
      <video:description>#Buatnasigoreng</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475124/3475124_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:34:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The festival that is going viral</video:title>
      <video:description>The festival that is currently viral in Indonesia #Festival #karnaval #indonesia #viral #fyp #videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475123/3475123_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T14:34:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Football Match drone shoot</video:title>
      <video:description>#FootballMatch #droneshoot #drone</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475122/3475122_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-21T14:34:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Weak Hero Class 2 | Part 3</video:title>
      <video:description>Weak Hero Class 2 Best fighting drama High school students Best kdrama Weak hero class 2 part 3 #Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475121/3475121_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T14:33:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POR QUE O GAARA NÃO TIRA OS OLHOS DE SHUKAKU?! 😱🔥</video:title>
      <video:description>✅ Descrição otimizada para seu vídeo de anime: 🔥 Novo Anime ÉPICO 2026 | Melhores Momentos, Lutas e Emoção Garantida! 🔥 #Anime2026 #MelhorAnime #NovosAnimes #AnimaTasticZone Você é fã de animes cheios de ação, personagens cativantes e histórias que mexem com o coração? Então prepare-se para conhecer o mais novo anime que está conquistando o mundo! Neste vídeo, trazemos os melhores momentos, teorias e tudo que você precisa saber sobre esse lançamento IMPACTANTE! 👉 Descubra os segredos por trás dos personagens 👉 Veja as lutas mais insanas do episódio 👉 Curta, comente e compartilhe com seus amigos otakus! 📌 Inscreva-se no canal AnimaTasticZone para mais conteúdos como esse toda semana! anime 2026, lançamento anime, novo anime #novosanimes #animeépico #melhoreslutasdeanime #cenasemocionantesanime #traileranimenovo #teoriaanime #análiseanime #animereview #AnimaTasticZone #animeviral #animedublado #animelegendado #animerecomendação #animecurto #animeação #animefantasia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475120/3475120_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T14:33:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crew Girl S01 E03 720p WEB-DL ESub</video:title>
      <video:description>16-year-old rower Teagan becomes coxswain of a troubled boys’ crew at an elite prep school. She navigates team drama, romance, rival crews, and a complex relationship with her mom while trying to lead them to victory. Follow and Share to show support on this channel so I can upload more movies. #Drama #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475119/3475119_720p.mp4</video:content_loc>
      <video:duration>2679</video:duration>
      <video:publication_date>2026-09-21T14:33:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PRT 672</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ON THE BEACH FLORIDA PART 672 #HOST #AMERIKABEAUTIFUL #SEXY #BEACH #FLORIDA #PART672</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475118/3475118_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T14:32:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crew Girl S01 E02 720p WEB-DL ESub</video:title>
      <video:description>16-year-old rower Teagan becomes coxswain of a troubled boys’ crew at an elite prep school. She navigates team drama, romance, rival crews, and a complex relationship with her mom while trying to lead them to victory. Follow and Share to show support on this channel so I can upload more movies. #Drama #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475117/3475117_720p.mp4</video:content_loc>
      <video:duration>3096</video:duration>
      <video:publication_date>2026-09-21T14:31:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 671</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ROLE PART 671 #HOST #AMERIKA #BEAUTIFULSEXY #ROLEPART671</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475116/3475116_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-21T14:30:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ter controlo</video:title>
      <video:description>Na vida aque ter controle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475115/3475115_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T14:29:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Main Function of Catfish Farming Pond Drainage</video:title>
      <video:description>Fish farming ponds must have drainage #PembuanganKolamBudidaya #Peternaklele #peternakikanairtawar #tipbudidayalele</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475114/3475114_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T14:29:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crew Girl S01 E01 720p WEB-DL ESub</video:title>
      <video:description>16-year-old rower Teagan becomes coxswain of a troubled boys’ crew at an elite prep school. She navigates team drama, romance, rival crews, and a complex relationship with her mom while trying to lead them to victory. Follow and Share to show support on this channel so I can upload more movies. #Drama #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475113/3475113_720p.mp4</video:content_loc>
      <video:duration>3340</video:duration>
      <video:publication_date>2026-09-21T14:29:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Some views just make your heart slow down instantly.</video:title>
      <video:description>The Bernese Oberland region in Switzerland offers the serene beauty of nature through Lauterbrunnen with its 72 waterfalls, Grindelwald which offers the splendor of three Alpine peaks, and Brünig Pas. #nomatterhowbeautifulthescenthesceneryisasbeautifulasaphealingvibesvibeswitzerlandtravelgottaappreciatethebeautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475112/3475112_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T14:28:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute baby moment 2</video:title>
      <video:description>So beautiful video cute baby moment 😍😍😍😍🥰😍🤩🥳😍😍😍 #Europe🌍country❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475111/3475111_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:27:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hope (2026) | A Mysterious Creature Turns a Korean Village Into a Nightmare</video:title>
      <video:description>Hope (2026) Korean Movie in English 🎬 A remote Korean village suddenly finds itself completely isolated when all communication is cut off. While the local police struggle to protect the remaining residents, a group of villagers heads into the mountains to hunt a mysterious creature. But everything changes when the hunters realize that they are no longer hunting the creature — the creature is hunting them. What begins as a mysterious encounter soon turns into a terrifying fight for survival, with the conflict growing into something far bigger and more dangerous than anyone could have imagined. 🎬 Movie: Hope (2026) 🇰🇷 Country: South Korea 🎭 Genre: Sci-Fi | Thriller | Action | Horror 🎥 Director: Na Hong-jin ⭐ Cast: Hwang Jung-min, Zo In-sung, Hoyeon, Michael Fassbender, Alicia Vikander, Taylor Russell &amp; Cameron Britton If you enjoy Korean horror movies, mysterious creatures, alien encounters, survival thrillers and sci-fi movie recaps, make sure to like the video and subscribe for more. #Hope2026 #Hopemovie2026 #HopeKoreanmovie #Hope2026movierecap #Hopemovierecap #HopeKoreanmovierecap #Hope2026story #Hopefullstory #Hopemoviestory #HoperecapEnglish #Hope2026Englishrecap #Koreanmovierecap #KoreanmovierecapEnglish #Koreanhorrormovie #Koreanhorrormovie2026 #Koreanscifimovie #scifimovierecap #horrormovierecap #creaturemovierecap #alienmovierecap #mysteriouscreaturemovie #survivalhorrormovie #survivalmovierecap #newKoreanmovie2026 #newhorrormovie2026 #NaHongJinHope #NaHongJinmovie #HoyeonHope #MichaelFassbenderHope #AliciaVikanderHope #HwangJungMinHope #ZoInSungHope #TheWailingdirector #movierecapEnglish #scifithriller2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475110/3475110_720p.mp4</video:content_loc>
      <video:duration>9042</video:duration>
      <video:publication_date>2026-09-21T14:27:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 670</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ON THE BEACH HAWAII PART 670 #HOST #AMERIKA #BEAUTIFUL #SEXY #BEACH #HAWAII #PART670</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475109/3475109_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-21T14:27:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny baby 90</video:title>
      <video:description>So beautiful video cute baby moment 💝😍💝💝😍😍😍🥰😍🤩😍😍🥰 #Europe🌍country❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475108/3475108_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T14:26:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>conjunto-arrastao-feminino</video:title>
      <video:description>conjunto-arrastao-feminino #conjunto-arrastao-feminino</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475107/3475107_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T14:26:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tips on saving money</video:title>
      <video:description>It&apos;s important to save money all the time. #USA #Canada #paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475106/3475106_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-21T14:26:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Worm Roast Gone Wrong_ Library Fire Magic Chaos!</video:title>
      <video:description>Adult Animation Enjoy #GoldenAxe #AdultAnimation #FYI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475105/3475105_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-21T14:26:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Couting x5 BMW</video:title>
      <video:description>Mentenen couting mobil x5 bmw #X5bmw</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475104/3475104_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-09-21T14:26:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute baby 310</video:title>
      <video:description>So beautiful video cute baby 😍🍼🍼🍼😍😍😍🍼🍼😍😍🍼🍼 #Europe🌍country❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475103/3475103_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T14:26:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>saia-telinha-brilho-glamour-body-manga-longa</video:title>
      <video:description>saia-telinha-brilho-glamour-body-manga-longa #saia-telinha-brilho-glamour-body-manga-longa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475102/3475102_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:25:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute baby 309</video:title>
      <video:description>Top 5 baby falls 🤩🤩🤩🤩🤩🥰😍😍🍼🤩🍼🍼💕💕💖💗💗😽😽✨✨💗👑👑🥰🥰👋🏻</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475101/3475101_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T14:25:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dance girls 12</video:title>
      <video:description>#Dance #dancinha</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475100/3475100_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T14:24:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Listen to this🙏</video:title>
      <video:description>Please let&apos;s take care of our loved ones..</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475099/3475099_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T14:24:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute baby 308</video:title>
      <video:description>So beautiful baby 🤩🍼🍼🍼🤩🤩💕🍼🍼🤩🤩🍼🍼🍼</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475098/3475098_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T14:23:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carnival festival in Indonesia</video:title>
      <video:description>Carnival festival in Indonesia #Festival #carnivalIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475097/3475097_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T14:23:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>notebook-positivo-mobo-s7-ideal-para-estudos</video:title>
      <video:description>notebook-positivo-mobo-s7-ideal-para-estudos #notebook-positivo-mobo-s7-ideal-para-estudos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475096/3475096_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T14:23:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon Ball (1986) Season 1 Episode 12 in Hindi Dubbed | A Wish to the Eternal Dragon | Shenron e no</video:title>
      <video:description>Dragon Ball (1986) Season 1 Episode 12 Full Episode in Hindi Dubbed | Hindi Anime | SEASON 1 FINALE OF PILAF SAGA Episode 12 - A Wish to the Eternal Dragon (Shenron e no Negai) - Originally aired 14th of May 1986 - The Wish to Shen Long Shen Long finally appears! Pilaf tries to say his wish, in order to rule the world!! Desperate to stop Emperor Pilaf, and just as Goku manages to destroy the wall with another Kamehameha, Oolong interrupts his wish for world domination with his own: a pair of underpants. This wish is granted, Shenron disappears, and the seven balls scatter all over the earth Because Oolong said his wish of &quot;Give me a girl&apos;s panties&quot; a moment sooner, his wish ended up being granted! With the wish granted, Shen Long returns again to the Dragon Balls, and they scatter to the four winds. To stop Emperor Pilaf, Oolong interrupts his wish for world conquest with a wish for underpants. Oolong ne duniya ko bacha liya lekin sabse funny wish maang ke! Ab Dragon Balls bikhargayi poori duniya me! Ye Pilaf Saga ka last episode hai! Agla arc shuru hoga Tournament se! Anime: Dragon Ball (1986) Episode: S01 E12 - A Wish to the Eternal Dragon Language: Hindi Dubbed Quality: HD 1080p All Episodes: Dragon Ball S01 Hindi Playlist New Episode Daily 7:30 PM! #DragonBallEpisode12Hindi #DragonBallS01E12HindiDubbed #DragonBallSeason1Episode12HindiMe #AWishtotheEternalDragonHindi #ShenronenoNegaiHindi #DragonBall1986Episode12HindiDubbed #ShenronFirstAppearanceHindi #OolongPantiesWishHindi #PilafWorldDominationWishFailHindi #DragonBallsScatterHindi #GokuKamehamehaWallHindi #HindiAnime #AnimeinHindiDubbed #dragonballs01e12hindi #dragonball1986episode12hindi #oolongunderpantswishhindi #pilafworlddominationfailhindi #pilafsagafinalehindi #dragonballhindidubbed #animeinhindi #dailyhin</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475095/3475095_720p.mp4</video:content_loc>
      <video:duration>1479</video:duration>
      <video:publication_date>2026-09-21T14:23:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video semangat belajar</video:title>
      <video:description>Video semangat belajar para anak sekolah mengenai ke pemiluan untuk masa depannya lebih mengetahui apa arti ke pemiluan. #Mengenal #memperdalam #ilmuyangdimiliki</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475094/3475094_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T14:22:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Hate My Job_ The Toxic Skeleton Culture Exposed</video:title>
      <video:description>Enjoy #AdultAnimation #GoldenAxe #FYI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475093/3475093_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T14:22:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Will Mayra flatly refuse to listen to Abhira | Today Full Episode</video:title>
      <video:description>Will Mayra flatly refuse to listen to Abhira, YRKKH Today Full Episode #yrkkh #yehrishtakyakehlatahai #trending #viral #gossips #news #todayepisode #promo #episodeupdate #fullepisode</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475092/3475092_720p.mp4</video:content_loc>
      <video:duration>217</video:duration>
      <video:publication_date>2026-09-21T14:22:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anak ku 2</video:title>
      <video:description>Cerita kehidupan tentang ayah Dan anaj #kehidupan #pejalanhidup #vidio #fyp #semuaorang #america #prancis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475091/3475091_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-21T14:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The monkey is eating a mango</video:title>
      <video:description>Entertainment monkey eating mango again #Entertainment #monkeys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475090/3475090_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:21:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>balcao-de-aco-cozinha</video:title>
      <video:description>balcão-de-aço-cozinha #balcao-de-aco-cozinha</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475089/3475089_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:21:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautiful morning in my apartment</video:title>
      <video:description>have you opened your curtains? this is what i do in living alone #livingalonedaires</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475088/3475088_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:21:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>massageador-facial-led-firmeza-e-juventude</video:title>
      <video:description>massageador-facial-led-firmeza-e-juventude #massageador-facial-led-firmeza-e-juventude</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475087/3475087_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T14:20:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main di sawah</video:title>
      <video:description>#Maindisawah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475086/3475086_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T14:20:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main bola 3</video:title>
      <video:description>#Bolakaki</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475085/3475085_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T14:20:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MY REALITY vs MY DREAM</video:title>
      <video:description>🎸 GHOST IN THE MACHINE - The True Story of Rocky Radio Station Everything you see on my channel is created by AI. The avatar, the studio, the voice. But the reality? It&apos;s just me, working 12 hours a day on a 12-year-old PC named &quot;Zeus&quot; with a vintage fan and a bird on my shoulder. 🎯 THE DREAM: I&apos;m saving up to upgrade to this PC: https://www.mercadolivre.com.br/pc-gamer-combat-rtx-ryzen-5-5500-rtx-3060-32gb-nvme-1tb-w11/up/MLBU3065241579 This machine has an RTX 3060 (12GB VRAM) - the key to creating BETTER AI content for you! HOW YOU CAN HELP: 1️⃣ **BUY A CUSTOM COMEDY SONG:** Turn your funniest story (churrasco disaster, wedding mishap, family drama) into a PREMIUM comedy music track! 📝 HOW IT WORKS: - Send your story (short summary) - Choose your genre (Sertanejo, Pagode, Rock, Country, Gospel, etc.) - We create a UNIQUE song just for you 💰 PRICING: Contact us for a fair quote 📧 EMAIL: nandorocky61@gmail.com 💳 PIX/PayPal: nandorocky61@gmail.com 2️⃣ **DIRECT SUPPORT:** Any contribution goes directly to the &quot;New PC Fund&quot; PIX/PayPal: nandorocky61@gmail.com 3️⃣ **SHARE &amp; SUBSCRIBE:** Help us reach more people who love comedy music! 📻 FOLLOW ROCKY RADIO STATION: Rumble: https://rumble.com/c/ROCKYRADIOSTATION Every sale, every dollar, every share... is a step closer to that dream machine. Let&apos;s make this happen TOGETHER! #Música24horaspordia #7diasporsemanaSupportIndieCreatorsBrazilianCreatorAIArtistCountryRockCrowdfundingDreamBigCustomMusicComedyMusicRockyRadioStation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475084/3475084_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-09-21T14:20:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita cantik berkuda</video:title>
      <video:description>#Berkuda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475083/3475083_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:19:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475082</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475082/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>confianca-engarrafada</video:title>
      <video:description>confiança engarrafada #confianca-engarrafada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475082/3475082_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T14:19:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hijau 2</video:title>
      <video:description>#Hijau</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475081/3475081_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-21T14:18:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju merah mengoda</video:title>
      <video:description>#Bajumerah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475080/3475080_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:16:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Invention .</video:title>
      <video:description>Invention manuel pratique .</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475079/3475079_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:16:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sambal terasi</video:title>
      <video:description>#Sambalterasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475078/3475078_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T14:16:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GOSPEL &amp; ACAPELLA = LIVE</video:title>
      <video:description>Welcome to ROCKY RADIO STATION OFFICIAL©. Enjoy a special live stream featuring Gospel and Acapella music designed to bring peace, inspiration, faith, and encouragement to your day. Listen to uplifting worship songs, beautiful vocal harmonies, and inspiring Christian music 24 hours a day. Perfect for: • Prayer and devotion • Bible study • Relaxation and meditation • Family listening • Worship and praise If you enjoy the music: ✔ Subscribe to the channel ✔ Like this live stream ✔ Share with your friends and family Music copyrights available for licensing and acquisition. Contact: nandorocky61@gmail.com ROCKY RADIO STATION OFFICIAL© Music That Feels Good! #Música24horaspordia #7diasporsemanagospelliveacapellalivegospelmusicacapellamusicchristianmusicworshipmusicpraiseandworshipgospelsongschristiansongs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475077/3475077_720p.mp4</video:content_loc>
      <video:duration>5507</video:duration>
      <video:publication_date>2026-09-21T14:15:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sabuk pengaman yang mantap</video:title>
      <video:description>#Sabukpengamanmobil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475076/3475076_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T14:15:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Film thailand</video:title>
      <video:description>#Film</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475075/3475075_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-21T14:14:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sang pembalap Andy firmansyah</video:title>
      <video:description>Pembalap #Pembalap #motorbalap #roadrace</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475074/3475074_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T14:14:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quotes 131</video:title>
      <video:description>Quotes #Quotes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475073/3475073_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-21T14:14:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🍉 Glass Fruit &amp; Cold Drinks ASMR 🧊</video:title>
      <video:description>Satisfying ASMR of slicing crystal-clear glass fruit and chilled drinks. Crisp cuts, sparkling textures, and relaxing sounds in every slice. ✨🔊 #Asmr #satisfying #glassfruit #colddrinks #Shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475072/3475072_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:13:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita Dubai</video:title>
      <video:description>#WanitaDubai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475071/3475071_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T14:13:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você não precisa ser perfeito para avançar. Precisa apenas continuar, um passo de cada vez.</video:title>
      <video:description>Você não precisa ser perfeito para avançar. Precisa apenas continuar, um passo de cada vez. #MotivaçãoMotivaçãoPessoalAcrediteEmVocêConfieEmVocêAutoConfiançaForçaDeVontadeSuperaçãoDeterminaçãoFocoPersistênciaInspiraçãoPensamentoPositivoNuncaDesistaSucessoVencedor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475070/3475070_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:13:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Epic Skyscraper Jump &amp; Springboard Bounce | Hyper-Realistic 3D Animation</video:title>
      <video:description>AI Video Generation &amp; 3D Physics Simulation ⚡ Resolution: 4K Ultra HD #3DAnimation #PhotorealisticJump #SkyscraperJump #SpringboardBounce #AIVideoGeneration #HyperRealisticAI #UnrealEngine5Render #CinematicFreeFall #3DPhysicsSimulation #Shorts #Reels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475069/3475069_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:12:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 117</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475068/3475068_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T14:12:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OLHA O PIX 👀👀👀</video:title>
      <video:description>#Pt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475067/3475067_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-21T14:12:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 116</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475066/3475066_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:11:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Jharana Pariyar Dance 7</video:title>
      <video:description>Indian Girl Jharana Pariyar Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475065/3475065_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-21T14:11:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 206</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475064/3475064_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:11:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 115</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475063/3475063_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T14:11:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seven.Snipers.2026.[Bolly4u.org]  Dual Audio</video:title>
      <video:description>Seven.Snipers.2026.[Bolly4u.org] Dual Audio #SevenSnipers2026Bolly4uorgDualAudio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475062/3475062_720p.mp4</video:content_loc>
      <video:duration>5278</video:duration>
      <video:publication_date>2026-09-21T14:11:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flamengo Escapa de Tropeço Histórico no Maracanã</video:title>
      <video:description>⚽ O futebol que arrepia. Aqui você encontra: 🔥 Cortes virais 🏆 Copa do Mundo 🇧🇷 Seleção Brasileira ⭐ Neymar, Vini Jr e os maiores craques 🎬 Momentos inesquecíveis Se você vive futebol, este canal é para você. 🔔 Inscreva-se e faça parte da torcida! #clips #futebol #esporte #sport #brasileirao #brasil #neymar #vinijr #rusk #rusko #ruski #sallat #tursb #fila2024 #bola</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475061/3475061_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-21T14:11:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>L’ambulance .</video:title>
      <video:description>Une ambulance traditionnelle a l’aide d’un ane .</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475060/3475060_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:10:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 114</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475059/3475059_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T14:10:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 113</video:title>
      <video:description>Mulher, bonita, sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475058/3475058_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video komedi</video:title>
      <video:description>video ini adalah video komedi dan lucu #lucu #komedi #fanny #kocak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475057/3475057_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T14:10:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kiasan 2</video:title>
      <video:description>Rintihan hidup #Perjalanan #Indonesia #amerika</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475056/3475056_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T14:10:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Expulsão Justa ou Exagerada  Análise do Jogo!</video:title>
      <video:description>⚽ O futebol que arrepia. Aqui você encontra: 🔥 Cortes virais 🏆 Copa do Mundo 🇧🇷 Seleção Brasileira ⭐ Neymar, Vini Jr e os maiores craques 🎬 Momentos inesquecíveis Se você vive futebol, este canal é para você. 🔔 Inscreva-se e faça parte da torcida! #clips #futebol #esporte #sport #brasileirao #brasil #neymar #vinijr #rusk #rusko #ruski #sallat #tursb #fila2024 #bola</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475055/3475055_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T14:10:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 112</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475054/3475054_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T14:09:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 111</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475053/3475053_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T14:09:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Depois da Cruz, Uma Mensagem Se Perdeu… Mas o Amor Nunca Deixou de Ser o Caminho”</video:title>
      <video:description>“Depois da Cruz, Uma Mensagem Se Perdeu… Mas o Amor Nunca Deixou de Ser o Caminho” #“DepoisdaCruz #UmaMensagemSePerdeu…MasoAmorNuncaDeixoudeSeroCaminho” #reinodosceus #segundavindadecristo #fé #salvação #fimdostempos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475052/3475052_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-21T14:09:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 110</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475051/3475051_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T14:09:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 109</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475050/3475050_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T14:08:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Música 27</video:title>
      <video:description>Música</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475049/3475049_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T14:08:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shaun The Sheep last part</video:title>
      <video:description>Shaun The Sheep bagian 5 last part #shaunthesheep</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475047/3475047_720p.mp4</video:content_loc>
      <video:duration>450</video:duration>
      <video:publication_date>2026-09-21T14:08:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 108</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475046/3475046_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T14:08:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BLOODSTRIKER🔥🔥??? 31</video:title>
      <video:description>#fyp #warzone #bloodstrike #bloodstrikebr #foryou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475045/3475045_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:07:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 107</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475044/3475044_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T14:07:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 106</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475043/3475043_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T14:07:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hollywood, news, fame, celebritynews, funny, celebrities, popculturenews, celebrit, celebritynews, 1</video:title>
      <video:description>hollywood, news, fame, celebritynews, funny, celebrities, popculturenews, celebrit, celebritynews, #hollywood #news #fame #celebritynews #funny #celebrities #popculturenews #celebrit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475042/3475042_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T14:06:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Married 317 Years_ The Shocking Truth Revealed!</video:title>
      <video:description>Adult Animation Enjoy #GoldenAxe #AdultAnimation #Comedy #FYI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475041/3475041_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T14:06:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 105</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475040/3475040_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T14:06:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Beauty of Milkyway Galaxy!!</video:title>
      <video:description>The Beauty of Milkyway Galaxy!! #milkyway</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475039/3475039_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:06:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 104</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475038/3475038_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T14:06:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 103</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475037/3475037_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:05:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 99</video:title>
      <video:description>Hiburan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475036/3475036_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:05:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 102</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475035/3475035_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T14:05:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>São Francisco de Assis - Parte 6 Final /Autores: Pe. Geraldo e Pe. Joãozinho / Intérprete: Francisco</video:title>
      <video:description>São Francisco de Assis - Parte 6 Autores: Pe. Geraldo e Pe. Joãozinho. Intérprete: Francisco Sérgio. Letra - Parte 6 Final: E este amor foi tão amado por Francisco, que o seu ser se revestiu de luz. E na explosão da graça, em felicidade, celebrou sua páscoa nos estigmas da Cruz. A gente pode ser muito mais feliz, seguindo o exemplo de Francisco de Assis. Que o amor de Deus que tocou São Francisco toque também o seu coração! Deixe seu amém e inscreva-se para mais cânticos de fé! #SãoFranciscoDeAssis #Fé #Oração #CantoReligioso #Devoção #Faith #CatholicMusic #Worship #Christianmusic #SaintFrancis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475034/3475034_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-21T14:05:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 101</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475033/3475033_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T14:05:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 100</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475032/3475032_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T14:04:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 99</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475031/3475031_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T14:04:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 98</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475030/3475030_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T14:04:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 97</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475029/3475029_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T14:03:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love is too beautiful.</video:title>
      <video:description>#Amor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475028/3475028_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-21T14:02:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Me trying to wear my pant watch me</video:title>
      <video:description>#Howtowearpant #Iloveyou #doyoumissme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475026/3475026_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T14:01:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lamborghini Murciélago GT Build – Low, Loud &amp; Absolutely Insane! 🏎️🔥</video:title>
      <video:description>Lamborghini Murciélago GT Build – Low, Loud &amp; Absolutely Insane! 🏎️🔥 #Lamborghini #Murcielago #SupercarLife #CarTok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475025/3475025_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T14:00:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Morning routine 5</video:title>
      <video:description>this is YUNA when she wakes up in her beautiful pink apartment 🌸 #morningroutine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475024/3475024_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T13:59:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 205</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475023/3475023_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:59:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spring of the Blade (2026) Ep 14 - Eng Sub</video:title>
      <video:description>Episode 14. Spring of the blade English sub -</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475022/3475022_720p.mp4</video:content_loc>
      <video:duration>2738</video:duration>
      <video:publication_date>2026-09-21T13:59:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Blue Saree Look 💙 | Traditional Bengali Style TikTok Video</video:title>
      <video:description>A graceful and elegant video featuring a young woman in a stunning blue saree with traditional jewelry. The beautiful Bengali-inspired look, charming smile, and aesthetic presentation make this video perfect for fashion, lifestyle, and social media content #bluesaree #Bengalisaree #traditionallook #beautifulgirl #sareefashion #TikTokvideo #desibeauty #elegantwoman #ethnicwear #fashionreel #viralvideo #SouthAsianstyle #jewelrylook #aestheticvideo #culturalfashion #beautycontent #stylishsaree #portraitvideo #Bengalifashion #socialmediareel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475021/3475021_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T13:58:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reflexão ...Ei você não está só 🙏✝️ 8</video:title>
      <video:description>#viral #esperança #shorts #fé #Jesus #forçainterior #superação #históriasdevidareais #mensagens #Deusnocomando #fé #força #nuncadesista #transformaçãodevida #motivaçãoparavencer #canalmotivacional #oraçãodehoje #canaldeoração #palavradedeus #históriasdesuperação #motivacional #motivation #inspiration #faithingod #nevergiveup #discipline #personalgrowth #mohammedhijab #morningmotivation #motivaçãoparavida #motivaçãoyoutube #motivação</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475020/3475020_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T13:57:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 204</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475019/3475019_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:57:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Title: Beautiful Bengali Girl in Blue Saree | Elegant TikTok Portrait Video</video:title>
      <video:description>A beautiful close-up portrait video featuring a young woman in a stylish blue saree. Soft lighting, elegant makeup, and a graceful pose create a charming and aesthetic social media reel perfect for fashion, beauty, and lifestyle content. #Bengaligirl #bluesaree #beautifulwoman #portraitvideo #TikTokgirl #sareefashion #traditionaldress #beautyreel #aestheticvideo #elegantlook #desifashion #SouthAsianbeauty #stylishgirl #makeuplook #socialmediareel #viralvideo #fashioncontent #closeupportrait #sareemodel #lifestylevideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475018/3475018_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T13:57:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spring of the Blade (2026) Ep 13 - Eng Sub</video:title>
      <video:description>Episode 13. Spring of the blade English sub</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475017/3475017_720p.mp4</video:content_loc>
      <video:duration>2680</video:duration>
      <video:publication_date>2026-09-21T13:57:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>te dipikiran</video:title>
      <video:description>musik sunda yg paling enak #musikhiburan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475016/3475016_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T13:56:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475015</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475015/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bodyguard Full Hollywood Hindi Dubbed Movie | Action Thriller Superhit Hollywood Movie</video:title>
      <video:description>The Bodyguard Full Hollywood Hindi Dubbed Movie | Action Thriller Superhit Hollywood Movie #TheBodyguardFullHollywoodHindiDubbedMovieActionThrillerSuperhitHollywoodMovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475015/3475015_720p.mp4</video:content_loc>
      <video:duration>5290</video:duration>
      <video:publication_date>2026-09-21T13:56:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What are you trying to do now</video:title>
      <video:description>Watch me first ok #France #love #datingtime #Imissyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475014/3475014_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T13:55:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>santai 2</video:title>
      <video:description>santai dulu bro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475013/3475013_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T13:55:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Childhood Bullies Murdered! A Skeleton&apos;s Revenge</video:title>
      <video:description>Enjoy #GoldenAxe #AdultAnimation #FYI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475012/3475012_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-09-21T13:53:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏆 Bora caçar verificados! 97</video:title>
      <video:description>🎧 FONE FIFINE H9 — RECOMENDO PRA VOCÊ! 🔗 https://onelink.shein.com/53/62f00ud4axhp?ismg_ol=GIt6n7MVzkN_01_KOC-C ✅ Som potente, perfeito pra ouvir passos no FF ✅ Microfone incluso pra conversar com galera ✅ Confortável pra jogar horas sem incomodar ✅ Preço bom demais! 💡 Compre por esse link e me ajuda sem gastar nada a mais! Obrigado! 🐎🔥 ⚠️ Esse vídeo contém link de afiliado #Desviralviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475011/3475011_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T13:52:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌴 This Poolside Backyard Is the Ultimate Dream Escape! 🏡✨</video:title>
      <video:description>🌴 This Poolside Backyard Is the Ultimate Dream Escape! 🏡✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475010/3475010_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T13:52:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bali tourism</video:title>
      <video:description>Tourist attractions that are currently viral in Bali #Touristattractions #Bali #beautiful #viral #fyp #viralvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475009/3475009_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T13:51:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wow escape from alien</video:title>
      <video:description>Movie clip #Clip #movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475008/3475008_720p.mp4</video:content_loc>
      <video:duration>125</video:duration>
      <video:publication_date>2026-09-21T13:50:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIY Butterfly Card Ideas</video:title>
      <video:description>DIY-butterfly-card-ideas #diycraftsdiyideascraftpapercraft</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475007/3475007_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T13:49:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amanda 3</video:title>
      <video:description>Amanda #Amanda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475006/3475006_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T13:49:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful and clean city</video:title>
      <video:description>Beautiful Japanese city #City #Japan #View</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475005/3475005_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T13:48:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Andre 2</video:title>
      <video:description>Andre taulany #Andre</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475004/3475004_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T13:48:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Miku and alya</video:title>
      <video:description>look at this song itsss soooooo good</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475003/3475003_720p.mp4</video:content_loc>
      <video:duration>152</video:duration>
      <video:publication_date>2026-09-21T13:47:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIY EASY-Cute Pen Holder</video:title>
      <video:description>DIY-EASY-Cute-pen-holder</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475002/3475002_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T13:47:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My granddaughter 3</video:title>
      <video:description>She likes to play and cry at the same time 😂. But I&apos;m happy to be a grandmother 😄😌 she is handful 😄 #SouthAfrica🙏🌍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475001/3475001_720p.mp4</video:content_loc>
      <video:duration>215</video:duration>
      <video:publication_date>2026-09-21T13:46:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3475000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3475000/3475000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Battle between Ants and scorpions 2</video:title>
      <video:description>Battle between Ants and scorpions</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3475000/3475000/3475000_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T13:46:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title># De Valor a quem merece!</video:title>
      <video:description>Devemos nos valorizar, nao mendigar amor e atenção. Ss gostarem compartilhem . Me sigam para mais . #Amorvalor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474999/3474999_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T13:45:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semua demi keluarga</video:title>
      <video:description>Bekerja keras kadang tanpa hasil, capek semua demi keluarga #Ceritakehidupan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474998/3474998_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-21T13:44:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Hemali Kamble Dance 8</video:title>
      <video:description>Indian Girl Hemali Kamble Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474997/3474997_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-21T13:43:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Proses pembangunan badan jalan</video:title>
      <video:description>Pemasangan batu kali Prsiapan badan jalan #Pemasanganbatukalibuatbadanjalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474996/3474996_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T13:43:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>leaf + a few garden flowers</video:title>
      <video:description>leaf + a few garden flowers #leafposyfoldedleafbouquet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474995/3474995_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T13:43:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Azhar &amp; Mazhar Funny</video:title>
      <video:description>foryoupageviralシ゚</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474994/3474994_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-21T13:43:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meat wholesale</video:title>
      <video:description>This is meat wholesale 😁 this meat is fresh and cheap 😄😄😋. This is my favourite butcher. #SouthAfrica🙏🌍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474993/3474993_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T13:43:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BLOODSTRIKER🔥🔥??? 30</video:title>
      <video:description>#fyp #warzone #bloodstrike #bloodstrikebr #foryou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474992/3474992_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:42:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Modern Smart living</video:title>
      <video:description>Modern Smart living · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474991/3474991_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T13:42:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fountain light for home decor</video:title>
      <video:description>Fountain light for home decor #fountainlight #useful #gadget #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474990/3474990_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T13:42:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dance 728</video:title>
      <video:description>#Danca #mulheres</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474989/3474989_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T13:41:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Little Artist Nargish</video:title>
      <video:description>Beautiful islamic art ❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474988/3474988_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-21T13:41:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My baby Ncuncu</video:title>
      <video:description>My husband is busy feeding her. She likes to eat a lot 😂😂😂. #SouthAfrica🙏</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474987/3474987_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T13:41:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Visa Solutions EU</video:title>
      <video:description>Study in Europe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474986/3474986_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-21T13:40:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bocil core 2026</video:title>
      <video:description>kocak habis core indonesia #videolucuindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474985/3474985_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T13:40:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mr. Bean’s Funniest Adventure Ever! 🤣💥 | You Won’t Stop Laughing 10</video:title>
      <video:description>Mr. Bean’s Funniest Adventure Ever! 🤣💥 | You Won’t Stop Laughing!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474984/3474984_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:39:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474983</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474983/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milky ice results</video:title>
      <video:description>This are my milky ice when they are ready to go to my freezer 😌. There are delicious 😋 #SouthAfrica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474983/3474983_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T13:39:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIY Paper Daisy Flowers</video:title>
      <video:description>Diy paper daisy flowers #artandcraftdiycraftshandmade</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474982/3474982_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T13:38:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milky ice</video:title>
      <video:description>This video is showing my milky ice that children loves a lot ❤️❤️. And they buying it for R1 #SouthAfrica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474981/3474981_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T13:38:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seenay Dy Wich Mari Goli - Shafeeq Shani - (Official Music Video 2026) - Singer Shani Official</video:title>
      <video:description>Seenay Dy Wich Mari Goli - Shafeeq Shani - (Official Music Video 2026) - Singer Shani Official #song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474980/3474980_720p.mp4</video:content_loc>
      <video:duration>365</video:duration>
      <video:publication_date>2026-09-21T13:37:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Travel with Adnan</video:title>
      <video:description>نوازشریف کاغان میں</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474979/3474979_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T13:37:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIY Paper Craft Ideas</video:title>
      <video:description>DIY Paper Craft Ideas #diycraftsdiyideascraftpapercraft</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474978/3474978_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T13:35:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hamza Butt Mhnb</video:title>
      <video:description>House for rent location fasil colony Rawalpindi 03185971861</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474977/3474977_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-21T13:34:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIY Cute Lantern</video:title>
      <video:description>DIY Cute Lantern Home Decoration Idea #diycraftroomdecoraestheticshortsdiycrafts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474976/3474976_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T13:33:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zindagi Ki Baat 2</video:title>
      <video:description>Loyal men are given to those who are lucky...</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474975/3474975_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T13:33:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>live tiktok bentar</video:title>
      <video:description>gabut banget #cewekbondol #cewekimut #cewekmanis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474974/3474974_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-21T13:32:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muhammad Sufiyan</video:title>
      <video:description>AI se tasveer banwai… lekin paani kahaan kharch hua? 🤔💧</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474973/3474973_720p.mp4</video:content_loc>
      <video:duration>139</video:duration>
      <video:publication_date>2026-09-21T13:32:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cooking Tuna Balado on a Stormy Cliff 🌊🔥</video:title>
      <video:description>Cooking Tuna Balado on the edge of a stormy cliff 🌊🔥 Spicy, bold, and worth every bite! 🌶️🐟 #TunaBalado #Indonesianfood #extremecooking #spicytuna #cookingASMR #cinematiccooking #foodvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474972/3474972_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T13:31:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎙️ திருக்குறள் 204 🔥 “மற்றவருக்கு தீமை நினைத்தால்”</video:title>
      <video:description>🎙️ திருக்குறள் 204 🔥 “மற்றவருக்கு தீமை நினைத்தால்...அது உண்மையிலேயே நமக்கே திரும்புமா?”</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474971/3474971_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T13:30:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>.Funny News 😂 | آج کی سب سے مزاحیہ خبریں | Funny &amp; Viral News | Pari News</video:title>
      <video:description>Pari News میں خوش آمدید! اس ویڈیو میں دیکھیں دلچسپ، مزاحیہ اور حیران کن Funny News &amp; Viral Updates۔ اگر آپ کو funny news، funny incidents اور entertaining videos پسند ہیں تو ویڈیو آخر تک ضرور دیکھیں۔ 👍 Video پسند آئے تو Like کریں 🔔 Pari News کو Subscribe کریں 💬 Comment میں بتائیں کہ آپ کو کون سی خبر سب سے زیادہ funny لگی۔ Disclaimer: یہ ویڈیو تفریحی مقصد کے لیے ہے۔ خبر یا واقعے کی حقیقت جاننے کے لیے معتبر ذرائع سے تصدیق ضرور کریں۔ #FunnyNews #FunnyNewsPakistan #PariNews #FunnyNewsUrdu #FunnyNewsToday #ViralFunnyNews #LatestFunnyNews #FunnyVideos #FunnyNewsVideo #ComedyNews #FunnyIncidents #ViralNews #UrduFunnyVideo #EntertainmentNews #TrendingNews #FunnyClips #PakistanFunnyNewsPariNewsFunnyNewsFunnyNewsPakistanViralNewsFunnyVideosUrduNewsComedyNewsTrendingNews</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474970/3474970_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T13:30:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Is my b🤩🤩bs are b🖕g</video:title>
      <video:description>#Japanesedance #Japanesegirlsdance #Japanreels #dancereels #hotdance #dancevideo #Japanesedancevideo #trendingdance #viralreels #Instagramreels #dancetrend #Japanvibes #beautifuldance #energeticdance #trendingreels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474969/3474969_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T13:29:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Veja o nosso vídeo 3</video:title>
      <video:description>Cobertura nas redes sociais #Coberturanasredessociais</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474968/3474968_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-21T13:29:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474967</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474967/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menanti janji mu mas.</video:title>
      <video:description>Gadis Desa.. minta kepastian.. #Dramapercintaanromantis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474967/3474967_720p.mp4</video:content_loc>
      <video:duration>260</video:duration>
      <video:publication_date>2026-09-21T13:29:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>अचानक 70 के दशक में जा पहुंचा युवक! (A young man suddenly transported to the 70s!)</video:title>
      <video:description>अचानक 70 के दशक में जा पहुंचा युवक! आज के सुपरमार्केट से सामान लाकर दुकान खोली और परिवार पाला! - अंतिम बदला #ChineseDrama #ChineseDramaHindiDubbed #Cdrama #CdramaHindiDubbed #HistoricalCdrama #FantasyCdrama #RomanticCdrama #Xianxia #ChineseFantasyDrama #CostumeDrama #HistoricalDrama #FantasyRomance #LoveStory #ImmortalLove #DemonGodDevilGod #TimeTravel #Reincarnation #SecondChanceLove #EnemiesToLovers #ForbiddenLove #Magic #Cultivation #HindiDubbedDrama #DramaInHindi #HindiDrama #TrendingCdrama #BestCdrama #AsianDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474966/3474966_720p.mp4</video:content_loc>
      <video:duration>5202</video:duration>
      <video:publication_date>2026-09-21T13:27:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Duaa Zahra</video:title>
      <video:description>Ajmal Sajid · Asaan Ishq Da Laya Naara</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474965/3474965_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T13:27:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Airsungai mengalir deras</video:title>
      <video:description>Dipagi hari yang sejuk melihat air sungai yang mengalir deras dan terasa sangat segar #Airsungaiyangsejuk #airmengalirderas #airsungaidipagihari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474964/3474964_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-09-21T13:27:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>𝐓𝐄𝐀𝐌 𝐔𝐒𝐌𝐀𝐍 𝐑𝐄𝐀𝐋 𝐄𝐒𝐓𝐀𝐓𝐄</video:title>
      <video:description>#جوہرآباد میں پیارے پیارے گھر لینے کے لیے ہمارا نمبر نوٹ کر لیں</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474963/3474963_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-21T13:26:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Weekend Escapes</video:title>
      <video:description>Rainy Morning Walk &amp; Calming River Sounds in Rural Japan 🍃</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474962/3474962_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T13:24:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Heer Batra Dance 9</video:title>
      <video:description>Indian Girl Heer Batra Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474961/3474961_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-21T13:23:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌼 Title: The Grace of a White Blossom</video:title>
      <video:description>A delicate white flower blooms gracefully, its soft petals surrounding a bright golden-yellow center. Set against a calm blue background, the flower creates a peaceful and refreshing atmosphere, capturing the simple beauty and quiet elegance of nature.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474960/3474960_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T13:23:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>selamat malam 3</video:title>
      <video:description>cewek main tiktok #cewekcantik #cewekmanis #gadiskacamata #cewekdaster</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474959/3474959_720p.mp4</video:content_loc>
      <video:duration>123</video:duration>
      <video:publication_date>2026-09-21T13:22:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resident Evil (2026) | Deadly Virus Outbreak &amp; Mutant Survival Horror</video:title>
      <video:description>Resident Evil (2026) in English 🎬 A routine delivery turns into a terrifying fight for survival when a medical courier finds himself trapped in the middle of a deadly outbreak. With mutated creatures everywhere and danger closing in, he must fight his way through the chaos and survive the nightmare. In this video, we cover the story of Resident Evil (2026), including its major events, terrifying moments, characters, and survival horror storyline. 🎬 Movie: Resident Evil (2026) 🎭 Genre: Horror | Sci-Fi | Action | Survival 🎥 Director: Zach Cregger ⭐ Cast: Austin Abrams, Paul Walter Hauser, Zach Cherry, Kali Reis If you enjoy horror movies, zombie outbreaks, mutant creatures, survival stories, and movie recaps, subscribe for more videos. #ResidentEvil #ResidentEvil2026 #HorrorMovie #SurvivalHorror #ZombieMovie #SciFiHorror #MovieRecapEnglish #HorrorMovies #ResidentEvilMovie Disclaimer: This video is intended for commentary, review, and educational purposes. All rights to the original film footage, characters, music, and related materials belong to their respective copyright owners. #ResidentEvil2026 #ResidentEvil2026movierecap #ResidentEvilmovierecap #ResidentEvilrecap #ResidentEvil2026story #ResidentEvilfullstory #ResidentEvilmoviestory #ResidentEvilEnglishrecap #ResidentEvil2026English #ResidentEvilnewmovie2026 #ResidentEvilhorrormovie #ResidentEvilsurvivalhorror #zombiemovierecap #horrormovierecap #scifihorrormovie #virusoutbreakmovie #mutantoutbreakmovie #survivalmovierecap #horrormovies2026 #newhorrormovie2026 #movierecapEnglish #ResidentEvilZachCregger #AustinAbramsResidentEvil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474958/3474958_720p.mp4</video:content_loc>
      <video:duration>5189</video:duration>
      <video:publication_date>2026-09-21T13:21:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dry well dating back to ancient times (सूखा कुआँ प्राचीन युग से जुड़ा)</video:title>
      <video:description>सूखा कुआँ प्राचीन युग से जुड़ा—गरीब युवक नमक के बदले दुर्लभ जिनसेंग लेकर रातोंरात अमीर! - Agni Yoddha 🔥 शक्तिशाली लोगों की काल्पनिक दुनिया में आपका स्वागत है! यहाँ आपको रोमांचक पलटवार, शक्ति जागरण, रहस्यमय सिस्टम, सुपरपावर और बदली हुई किस्मत की कहानियाँ मिलेंगी। जब एक साधारण व्यक्ति को जीवन बदलने का मौका मिलता है, जब छिपी शक्तियाँ जागती हैं और कमजोर लोग महान बन जाते हैं, हर कहानी आपको वास्तविकता से परे एक नई दुनिया में ले जाएगी। 🎬 यह चैनल AI एनीमेशन, AI कॉमिक ड्रामा और फैंटेसी कहानियों पर केंद्रित है। अगर आपको शक्ति, विकास, सुपरपावर, भविष्य की दुनिया और रोमांचक कहानियाँ पसंद हैं, तो सब्सक्राइब करें! ⚠️ सभी सामग्री अधिकृत AI वर्चुअल रचनाएँ हैं, जो केवल मनोरंजन और कला के लिए बनाई गई हैं। बिना अनुमति कॉपी करना प्रतिबंधित है। ⚠️ सभी पात्र और घटनाएँ काल्पनिक हैं। खतरनाक कार्यों की नकल न करें। #ChineseDrama #ChineseDramaHindiDubbed #Cdrama #CdramaHindiDubbed #HistoricalCdrama #FantasyCdrama #RomanticCdrama #Xianxia #ChineseFantasyDrama #CostumeDrama #HistoricalDrama #FantasyRomance #LoveStory #ImmortalLove #DemonGodDevilGod #TimeTravel #Reincarnation #SecondChanceLove #EnemiesToLovers #ForbiddenLove #Magic #Cultivation #HindiDubbedDrama #DramaInHindi #HindiDrama #TrendingCdrama #BestCdrama #AsianDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474957/3474957_720p.mp4</video:content_loc>
      <video:duration>3778</video:duration>
      <video:publication_date>2026-09-21T13:21:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣 Try Not to Laugh! The Funniest Moments Ever!</video:title>
      <video:description>Can you watch this video without laughing? 😂 These funny and unexpected moments will make it hard to keep a straight face. Enjoy the video and have a great laugh! #trynottolaugh #funnychallenge #funnyvideo #hilariousmoments #comedy #laughing #funnyclips #humor #entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474956/3474956_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T13:19:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rao Amaan</video:title>
      <video:description>✨Dua ki Tafseel caption hai me hai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474955/3474955_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T13:19:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ncmcf</video:title>
      <video:description>Vctyfff #Cccvvv</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474954/3474954_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T13:19:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus de Nazaréth 4</video:title>
      <video:description>Jesus de Nazareth</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474953/3474953_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:16:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>London Layers12</video:title>
      <video:description>This shouldn&apos;t look like this?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474952/3474952_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-21T13:16:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Giant Food Reactions: Huge Pancake, Massive Coffee &amp; Giant Mozzarella Surprise!</video:title>
      <video:description>Watch these hilarious and priceless reactions to some of the biggest food servings ever! From a massive strawberry pancake loaded with ice cream and chocolate, to an enormous coffee cup that needs two hands, and finally a giant mozzarella ball that left everyone shocked. Perfect for food lovers, reaction videos fans, and anyone who loves oversized restaurant portions. Which one would you try first? Drop your answer in the comments! #giantfood #oversizedfood #foodchallenge #giantpancake #hugecoffee #giantmozzarella #foodreaction #funnyfoodvideo #viralfood #bigportions #restaurantfood #foodievideo #mukbang #satisfyingfood #reactionvideo #giantdessert #foodcomedy #oversizedservings #foodsurprise #viralrestaurant</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474951/3474951_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T13:15:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>M.S FURNITURE</video:title>
      <video:description>Munshi #MSFURNITURE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474950/3474950_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:14:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The King Who Dreamed of United Madagascar 👑🇲🇬 — Andrianampoinimerina’s Incredible Vision</video:title>
      <video:description>King Andrianampoinimerina was the ruler who dreamed of a united Madagascar. In the late 18th century, Madagascar was divided among rival kingdoms and rulers. Andrianampoinimerina reunited much of Imerina, strengthened the kingdom, reorganized its administration, and laid the foundations for what would later become the Kingdom of Madagascar. His famous vision was simple but enormous: &quot;The sea is the boundary of my rice field.&quot; He died in 1810 before achieving that dream, but his son Radama I continued his expansion and conquered much of the island. This is the story of King Andrianampoinimerina, one of the most important rulers in Malagasy history — and the man who helped create the vision of a united Madagascar. #AndrianampoinimerinaMadagascarHistoryAfricanHistoryKingdomOfMadagascarKINGS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474949/3474949_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-21T13:14:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Don&apos;t make Bong-soon mad 😂 (police station edition)</video:title>
      <video:description>Don&apos;t make Bong-soon hyper. 😳💪 She&apos;s small, she&apos;s cute, and she&apos;s WAY stronger than she looks. 😂 Which Bong-soon scene is your favorite? Comment below 👇 Tag someone who needs a Bong-soon in their life. Follow for daily K-drama moments and edits. #StrongGirlBongSoon #BongSoonhyper #BongSoonfunnyscene #kdramaedit #kdramacomedy #ParkBoYoung #ParkHyungSik #Koreandrama #stronggirlkdrama #funnykdramamoments #kdramashorts #girlpowerkdrama #bestkdramascenes #kdramapolicestationscene #K-dramafans</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474948/3474948_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T13:14:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mandi di sungai</video:title>
      <video:description>mandi banreng di sungai #gadisdesa #cewekmanis #fyp #mandi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474947/3474947_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T13:13:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flagre o comportamento impressionante de um lagarto monitor em seu habitat natural.</video:title>
      <video:description>Flagre o comportamento impressionante de um lagarto monitor em seu habitat natural. #Flagreocomportamentoimpressionantedeumlagartomonitoremseuhabitatnatural</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474946/3474946_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:12:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Is not over yet</video:title>
      <video:description>The game is still on #Werecomingback🔙</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474945/3474945_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T13:12:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Umar Zaman Podcast</video:title>
      <video:description>Paranormal Activities By Umar Zaman Shah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474944/3474944_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T13:12:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>with clothes by viona</video:title>
      <video:description>#dance #fyp #tiktok #girl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474943/3474943_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T13:12:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Btth eps3</video:title>
      <video:description>btth s1 #donghua #anime #btth #Xiaoyan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474942/3474942_720p.mp4</video:content_loc>
      <video:duration>1123</video:duration>
      <video:publication_date>2026-09-21T13:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>viona again</video:title>
      <video:description>#fyp #tiktok #dance #girl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474941/3474941_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T13:11:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>happy viona dance</video:title>
      <video:description>#tiktok #dance #girl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474940/3474940_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T13:11:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hanif Maoj حنیف مَوج</video:title>
      <video:description>دمہ اور ڈسٹ الرجی کے مریض</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474939/3474939_720p.mp4</video:content_loc>
      <video:duration>114</video:duration>
      <video:publication_date>2026-09-21T13:11:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek cantik 29</video:title>
      <video:description>Cewek cantik #Hiburanshopping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474938/3474938_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T13:10:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story 138</video:title>
      <video:description>Story harian #Hiburanshopping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474937/3474937_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T13:10:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>درامد</video:title>
      <video:description>کسب درامد</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474936/3474936_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T13:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bhavya Sharma   ·</video:title>
      <video:description>Most Powerful Business For Genzz.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474935/3474935_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-21T13:10:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tetap semangat 12</video:title>
      <video:description>Tetap semangat #Hiburanshopping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474934/3474934_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T13:09:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ketika Semua Tidak Berjalan Sesuai Rencana 😂 | Funny Fails Compilation</video:title>
      <video:description>Nikmati kompilasi kejadian spontan dan momen gagal yang menghibur dalam satu video. Tonton sampai selesai untuk melihat berbagai kejadian menarik dan tak terduga! 😂 #FunnyMomentsFunnyFailsFunnyVideosEpicFailsKompilasiLucuMomenLucuFailCompilation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474933/3474933_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T13:09:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pak wifi network</video:title>
      <video:description>pak wifi network · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474932/3474932_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T13:09:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amanda lucu banget</video:title>
      <video:description>Amanda lucu banget #Hiburan #shopping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474931/3474931_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T13:09:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Born to drift 🔥 (BMW baby edit)</video:title>
      <video:description>Little dude, casually farming aura. 💖🏎️ Future drifter loading... 😂 Would you let him take the wheel someday? Comment below 👇 Tag a BMW fan who needs to see this. Follow for daily car edits and cute moments. #babyBMW #BMWedit #driftedit #BMWM4drift #caredit #babyincar #cutebaby #auraedit #littledude #futuredrifter #BMWlovers #carlovers #BMWdriftvideo #cuteandcool #automotiveshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474930/3474930_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:09:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Humans With Their Pet</video:title>
      <video:description>people and their unique pets that will make you smile. 🦎🐾 #otherswiththeirpet #petsoftiktok #relatable #reallife #cutepets #edit #shorts #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474929/3474929_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:08:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sundas khan</video:title>
      <video:description>khariancantt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474928/3474928_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T13:08:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Title: 😂 Bro Had ONE Job… And Still Failed! ⚽😭</video:title>
      <video:description>Description: He had a clear chance to score… but somehow turned it into the funniest moment of the match! 😂⚽😭 Watch till the end for the unexpected fail! 🤣🔥 #funnyfootball #footballfail #soccerfunny #funnysoccer #footballcomedy #soccerfail #hilariousfootball #footballbloopers #funnyfootballmoments #viralfootball #viralsoccer #footballshorts #soccershorts #footballreels #funnysportsvideo #footballmeme #soccermeme #footballentertainment #funnymatchmoment #ArenaXSports</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474927/3474927_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:07:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dress wanita 4</video:title>
      <video:description>Dress wanita terbaru #Hiburan #Shoping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474926/3474926_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T13:06:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amanda dan zac</video:title>
      <video:description>Amanda dan zac #Hiburan #shopping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474925/3474925_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T13:06:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ezaan Arts</video:title>
      <video:description>For S Name ❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474924/3474924_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-21T13:06:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funy Video 70</video:title>
      <video:description>#funny #comedy #viralfunnyvideos #funnyreels #sketchcomedy #funnymemes #funnyvideosdaily #funnyvideoclips #relatablefunny #funny-reels #popular #funny-videos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474923/3474923_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T13:05:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam goreng 2</video:title>
      <video:description>Mantap ayam goreng #Hiburan #shoping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474922/3474922_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T13:05:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Build Me Up Buttercup - The Foundations | Acoustic Version | Broad Way PH</video:title>
      <video:description>“Build Me Up Buttercup” by The Foundations reimagined as an Acoustic Version by Broad Way PH. This version gives the classic song a warm and heartfelt acoustic arrangement, featuring a more intimate sound while bringing a fresh perspective to this timeless hit. 🎸 Genre: Acoustic Cover 🎧 Style: Acoustic / Soft Rock / Reimagined ⚠️ Copyright Disclaimer: This video is a non-commercial cover created for entertainment purposes only. All rights belong to their respective owners. Subscribe to Broad Way PH for more reimagined songs, acoustic covers, rock versions, and creative genre transformations. #buildmeupbuttercup #thefoundationscover #acousticcover #acousticversion #softrockcover #reimaginedsongs #musiccover #broadwayph</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474921/3474921_720p.mp4</video:content_loc>
      <video:duration>216</video:duration>
      <video:publication_date>2026-09-21T13:04:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story 137</video:title>
      <video:description>Story harian #Hiburan #shopping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474920/3474920_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T13:04:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Purbaya Yudhi Sadewa Song lirik</video:title>
      <video:description>#PurbayaYudhiSadewaMusikvideoofficial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474918/3474918_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-09-21T13:03:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>She climbed it like it&apos;s nothing... his face says everything 😂</video:title>
      <video:description>So strong he forgot how to speak. 😳💪 Bong-soon climbs the wall and drags the tires like nothing, and he can&apos;t believe it. 😂 Which Bong-soon scene is your favorite? Comment below 👇 Tag someone who&apos;s secretly super strong 😂 Follow for daily K-drama moments and edits. #StrongGirlBongSoon #StrongGirlBong-soonfunnyscene #kdramafunnymoments #kdramaedit #ParkBoYoung #ParkHyungSik #Koreandrama #stronggirlkdrama #kdramacomedy #climbingwallscene #kdramashorts #funnydramaclips #K-dramafans #girlpowerkdrama #bestkdramascenes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474917/3474917_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T13:02:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buah yg bikin melek merem</video:title>
      <video:description>Indonesia buah di bikin rujak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474916/3474916_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T13:02:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bigg Boss season 20 episode 15</video:title>
      <video:description>Bigg Boss season 20 episode 15</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474915/3474915_720p.mp4</video:content_loc>
      <video:duration>4308</video:duration>
      <video:publication_date>2026-09-21T13:02:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A work of art that changes everything</video:title>
      <video:description>*A work of art that changes everything i love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474914/3474914_720p.mp4</video:content_loc>
      <video:duration>141</video:duration>
      <video:publication_date>2026-09-21T13:02:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mohammed Salman</video:title>
      <video:description>🕋 Makkah in the 1980s — A Glimpse Into the Past</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474912/3474912_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T13:01:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>টিভিএস বাইক</video:title>
      <video:description>টিভিএস বাইক</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474911/3474911_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T13:00:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tilawat Quran pak 8</video:title>
      <video:description>Time of the travel to Florida #Times</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474910/3474910_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T13:00:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rahul Kumar</video:title>
      <video:description>Mobility &amp; Flexibility.…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474909/3474909_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T13:00:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monkey funny,</video:title>
      <video:description>Komedi lucu monyet yg sedang duduk di warung kopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474907/3474907_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:59:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Koplo asik</video:title>
      <video:description>#Koplo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474906/3474906_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T12:59:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The beauty of Mount Merbabu</video:title>
      <video:description>Sunset at Mount Merbabu, Indonesia.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474905/3474905_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T12:59:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>viona oh viona</video:title>
      <video:description>#dance #girl #fyp #tiktok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474904/3474904_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T12:59:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lanterns (2026) Season 1 (Episode-6) Hindi-Dubbed-HBO-Max-Series</video:title>
      <video:description>Lanterns (2026) Season 1 (Episode-6) Hindi-Dubbed-HBO-Max-Series #Lanterns2026Season1Episode-6Hindi-Dubbed-HBO-Max-Series</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474903/3474903_720p.mp4</video:content_loc>
      <video:duration>3218</video:duration>
      <video:publication_date>2026-09-21T12:59:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Guia da nostalgia Relíquias dos anos 80 e 90! #Anos80 #anos90 #Antigo #Objetos #objetosantigos</video:title>
      <video:description>Você lembra desses objetos dos anos 80 e 90? Neste Shorts, reunimos as maiores relíquias e coisas antigas que marcaram a infância de quem viveu nessa época dourada da nostalgia. Se você reconheceu algum desses itens vintage, deixe nos comentários qual era o seu favorito!Capítulos e itens nostálgicos mostrados no vídeo.#shorts #nostalgia #anos80 #anos90 #coisasantigas #vintage #retro #infancia8090 #geracao90 #shortsbrasil #anos90anos80nostalgiavelhostemposinfancia90infancia80objetosantigoscoisasantigasretrotbtforyoufyshortsVelhaInfanciaCoisasDosAnos90GeraçãoXMillennialsCulturaPopColeçõesShortsBrasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474902/3474902_720p.mp4</video:content_loc>
      <video:duration>108</video:duration>
      <video:publication_date>2026-09-21T12:58:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sakar Rupa</video:title>
      <video:description>Tere bin nhi lagta dil mera ☺️💕🤌</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474901/3474901_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T12:58:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lomba makan kerupuk 3</video:title>
      <video:description>#MakanKerupuk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474900/3474900_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T12:57:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monyet nakal 2</video:title>
      <video:description>#Monyetnakal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474898/3474898_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T12:57:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hello 103</video:title>
      <video:description>#Hotsex</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474897/3474897_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T12:57:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Makan mie sedap</video:title>
      <video:description>#MakanMie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474896/3474896_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T12:56:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Cup of Tea</video:title>
      <video:description>Mrwhen Nice 2 #Fibspi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474895/3474895_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T12:55:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hourse Beautifull</video:title>
      <video:description>Dauev95 · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474893/3474893_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T12:54:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Woman&apos;s works</video:title>
      <video:description>Woman arts #Eoman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474892/3474892_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T12:54:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Pursuit of Happyness (2006) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Pursuit of Happyness (2006) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474891/3474891_720p.mp4</video:content_loc>
      <video:duration>7050</video:duration>
      <video:publication_date>2026-09-21T12:54:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Good Dinosaur (2015) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Good Dinosaur (2015) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474890/3474890_720p.mp4</video:content_loc>
      <video:duration>5619</video:duration>
      <video:publication_date>2026-09-21T12:54:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Dark Knight Rises (2012) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Dark Knight Rises (2012) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474889/3474889_720p.mp4</video:content_loc>
      <video:duration>9873</video:duration>
      <video:publication_date>2026-09-21T12:54:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Crew (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Crew (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474888/3474888_720p.mp4</video:content_loc>
      <video:duration>7393</video:duration>
      <video:publication_date>2026-09-21T12:54:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of Xander Cage (2017) Hindi Dubbed</video:title>
      <video:description>Return of Xander Cage (2017) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474887/3474887_720p.mp4</video:content_loc>
      <video:duration>6406</video:duration>
      <video:publication_date>2026-09-21T12:54:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Sthree Repu Raa (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>O Sthree Repu Raa (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474886/3474886_720p.mp4</video:content_loc>
      <video:duration>7658</video:duration>
      <video:publication_date>2026-09-21T12:54:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mechanic- Resurrection (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Mechanic- Resurrection (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474885/3474885_720p.mp4</video:content_loc>
      <video:duration>5919</video:duration>
      <video:publication_date>2026-09-21T12:54:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Logan (2017) Hindi Dubbed</video:title>
      <video:description>Logan (2017) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474884/3474884_720p.mp4</video:content_loc>
      <video:duration>8243</video:duration>
      <video:publication_date>2026-09-21T12:54:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kubo and the Two Strings (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Kubo and the Two Strings (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474883/3474883_720p.mp4</video:content_loc>
      <video:duration>6096</video:duration>
      <video:publication_date>2026-09-21T12:53:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jack Reacher- Never Go Back (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Jack Reacher- Never Go Back (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474882/3474882_720p.mp4</video:content_loc>
      <video:duration>7089</video:duration>
      <video:publication_date>2026-09-21T12:53:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harry Potter and the Sorcerer’s Stone (2001) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Harry Potter and the Sorcerer’s Stone (2001) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474881/3474881_720p.mp4</video:content_loc>
      <video:duration>9142</video:duration>
      <video:publication_date>2026-09-21T12:53:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harry Potter and the Prisoner of Azkaban (2004) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Harry Potter and the Prisoner of Azkaban (2004) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474880/3474880_720p.mp4</video:content_loc>
      <video:duration>8502</video:duration>
      <video:publication_date>2026-09-21T12:53:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harry Potter and the Order of the Phoenix (2007) Hindi Dubbed</video:title>
      <video:description>Harry Potter and the Order of the Phoenix (2007) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474879/3474879_720p.mp4</video:content_loc>
      <video:duration>8294</video:duration>
      <video:publication_date>2026-09-21T12:53:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Digital With Mehul</video:title>
      <video:description>Copy viral videos WITHOUT COPYRIGHT and create your descents channel..</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474878/3474878_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T12:53:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harry Potter and the Half-Blood Prince (2009) Hindi Dubbed</video:title>
      <video:description>Harry Potter and the Half-Blood Prince (2009) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474877/3474877_720p.mp4</video:content_loc>
      <video:duration>9211</video:duration>
      <video:publication_date>2026-09-21T12:53:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ear put some digital tools and dangerous of this</video:title>
      <video:description>Mrwhen Nice 2 Febspot video How to avoid from digital #Digitaltools</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474876/3474876_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-09-21T12:53:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harry Potter and the Goblet of Fire (2005) Hindi Dubbed</video:title>
      <video:description>Harry Potter and the Goblet of Fire (2005) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474875/3474875_720p.mp4</video:content_loc>
      <video:duration>9425</video:duration>
      <video:publication_date>2026-09-21T12:53:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harry Potter and the Deathly Hallows – Part 1 (2010) Hindi Dubbed</video:title>
      <video:description>Harry Potter and the Deathly Hallows – Part 1 (2010) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474874/3474874_720p.mp4</video:content_loc>
      <video:duration>8765</video:duration>
      <video:publication_date>2026-09-21T12:53:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harry Potter and the Chamber of Secrets (2002) Hindi Dubbed</video:title>
      <video:description>Harry Potter and the Chamber of Secrets (2002) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474873/3474873_720p.mp4</video:content_loc>
      <video:duration>9656</video:duration>
      <video:publication_date>2026-09-21T12:53:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gallowwalkers (2012) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Gallowwalkers (2012) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474872/3474872_720p.mp4</video:content_loc>
      <video:duration>5538</video:duration>
      <video:publication_date>2026-09-21T12:53:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Escape Plan (2013) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Escape Plan (2013) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474871/3474871_720p.mp4</video:content_loc>
      <video:duration>6929</video:duration>
      <video:publication_date>2026-09-21T12:53:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Day of the Mummy (2014) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Day of the Mummy (2014) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474870/3474870_720p.mp4</video:content_loc>
      <video:duration>4806</video:duration>
      <video:publication_date>2026-09-21T12:53:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Assassin’s Creed (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Assassin’s Creed (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474869/3474869_720p.mp4</video:content_loc>
      <video:duration>6931</video:duration>
      <video:publication_date>2026-09-21T12:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sandal throws</video:title>
      <video:description>Ggkk ok nb bjn #Ggclp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474868/3474868_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T12:53:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ہمارے دن رات کی محنت مظلوموں کے نام</video:title>
      <video:description>اؤ مل کر مظلوم مستحق لوگوں کا سہارا بنیں ٹی ایم انسانیت ہیلپ لائن ہر وقت ہر ٹائم مظلوموں کا ساتھ دے رہی ہے اپ بھی اپنا حصہ ملا ہے اور اپ کی چھوٹی سی کوشش کسی کے گھر کے چراغ بن سکتی ہے #ٹیایمانسانیتہلپلائن</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474867/3474867_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-21T12:53:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>London Travel Life</video:title>
      <video:description>LONDON❤️🇬🇧</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474866/3474866_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T12:53:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deeply words and speach</video:title>
      <video:description>Speaking of the travel to Florida for a while now #Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474865/3474865_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T12:52:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Selling item</video:title>
      <video:description>Ultra 3D Wallpaper …</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474864/3474864_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T12:52:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>To the skills of life successful</video:title>
      <video:description>How to successfully How earn money How to search earnings #Earnmoney</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474862/3474862_720p.mp4</video:content_loc>
      <video:duration>749</video:duration>
      <video:publication_date>2026-09-21T12:51:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imut bergoyang</video:title>
      <video:description>#Imut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474861/3474861_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T12:51:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Home Yoga Ball “Destroys” Pregnant Moms But Keeps Them Healthy! Try It Yourself</video:title>
      <video:description>Hey friends, I’ve already started using the yoga ball at home! Watch how these moves “destroy” the tension in a pregnant body. It’s light, safe, and you can do it alone in your room. Who’s pregnant and hasn’t tried the yoga ball yet? Save this and try it now! #YogaBallPregnancyPrenatalYogaPregnantWorkoutHomeYogaBallPregnancyTipsHealthyPregnancyYogaBallWorkoutMomToBePregnancyExercisePregnancyFitnessYogaBallChallengeExpectingMom</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474860/3474860_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-21T12:51:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GENERATION OF LOVE= SARANG-UI SEDAE= ÀI DE SHÌDÀI (爱的世代) Ep 11</video:title>
      <video:description>Dorama 11 Ep: Ep 11 #dorama #doramas #doramabrasil #doramadublado #doramacoreano #resumendedorama #doramasenespanol #doramasenminutos #doramasdubladosem #drama #cdrama #kdrama #dramas #dramacorto #shortdrama #shortsdrama #koreandrama #shortdramas #newdrama #doramasdubladosemportugues #kdramashorts #doramacurto #limedrama #lagodrama #doramaonline #newkoreandrama #ceodramas #newkdrama #asiandrama #dramaviral #dramachino #dramarecap #koreandrama2025 #doramasenespanollatinocompletas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474859/3474859_720p.mp4</video:content_loc>
      <video:duration>4165</video:duration>
      <video:publication_date>2026-09-21T12:50:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pakistani girl video</video:title>
      <video:description>Indian movie #Imdain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474858/3474858_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-21T12:49:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Italian girls dancing</video:title>
      <video:description>Mrwhen Nice 2 Febspot video of #Dance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474857/3474857_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T12:49:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Gursimar Arora Dance 10</video:title>
      <video:description>Indian Girl Gursimar Arora Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474856/3474856_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T12:48:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>La belle à ville.</video:title>
      <video:description>En france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474855/3474855_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T12:48:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Petition against detention order of Imran khan’s sisters, big action in LHC. Mohsin Naqvi talk. PTI.</video:title>
      <video:description>Petition against detention order of Imran khan’s sisters, big action in LHC. Mohsin Naqvi talk. PTI.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474854/3474854_720p.mp4</video:content_loc>
      <video:duration>588</video:duration>
      <video:publication_date>2026-09-21T12:47:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby n kitties lovely video ❤️ 2</video:title>
      <video:description>Baby n kitties lovely video ❤️ #Baby #cat #lovely</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474853/3474853_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:47:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main golf</video:title>
      <video:description>#Golf</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474852/3474852_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T12:47:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar ngetik</video:title>
      <video:description>#Belajarngetik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474851/3474851_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T12:46:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>یہ فصل امیدوں کی ہمدم #reelsviralシ #shorts #solangibha786</video:title>
      <video:description>یہ فصل امیدوں کی ہمدم #reelsviralシ #shorts #solangibha786 #یہفصلامیدوںکیہمدمreelsviralシshortssolangibha786</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474850/3474850_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T12:45:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DEUS FIEL</video:title>
      <video:description>Sem Deus nada somos #Deusfiel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474849/3474849_720p.mp4</video:content_loc>
      <video:duration>116</video:duration>
      <video:publication_date>2026-09-21T12:44:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;mPerfect</video:title>
      <video:description>Comedy Drama #Philippines</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474848/3474848_720p.mp4</video:content_loc>
      <video:duration>7900</video:duration>
      <video:publication_date>2026-09-21T12:43:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nikita Harivansh</video:title>
      <video:description>Your phone is causing that neck hump? Do this one stretch daily!…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474847/3474847_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T12:43:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tendangan bebas</video:title>
      <video:description>#Tendanganbebas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474846/3474846_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T12:42:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Creative Birthday Gift Ideas</video:title>
      <video:description>BIRTHDAY Gift Ideas 💌That Wow!💝__Creative Birthday Gift Ideas for Friends❤️ and Family #giftideasideascreative</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474845/3474845_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T12:42:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minum Es</video:title>
      <video:description>#Minumes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474844/3474844_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T12:42:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours (2026) S01 E04 Hindi Dubbed K DramaSeries</video:title>
      <video:description>A Love Other Than Yours (2026) S01 E04 Hindi Dubbed K DramaSeries #ALoveOtherThanYours2026S01E04HindiDubbedKDramaSeries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474843/3474843_720p.mp4</video:content_loc>
      <video:duration>3881</video:duration>
      <video:publication_date>2026-09-21T12:41:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ikan nakal</video:title>
      <video:description>#Ikannakal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474842/3474842_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T12:41:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Makan besar 3</video:title>
      <video:description>#Makanbesar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474841/3474841_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T12:41:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita bersepeda</video:title>
      <video:description>#Bersepeda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474840/3474840_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:40:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful magic lady</video:title>
      <video:description>Beautiful magic lady Watch and Enjoy #Magic #viralvideo #beautiful #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474839/3474839_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:40:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mknan indonesia</video:title>
      <video:description>Mknan indonesia tahu goreng</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474838/3474838_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T12:40:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ikan langka</video:title>
      <video:description>#IkanLanka</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474837/3474837_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T12:40:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 11 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 11 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474836/3474836_720p.mp4</video:content_loc>
      <video:duration>4348</video:duration>
      <video:publication_date>2026-09-21T12:40:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Prosecutor&apos;s Proposal (2026) Episode 1</video:title>
      <video:description>The Prosecutor&apos;s Proposal (2026) Episode 1</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474835/3474835_720p.mp4</video:content_loc>
      <video:duration>1179</video:duration>
      <video:publication_date>2026-09-21T12:39:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam kurus</video:title>
      <video:description>#AyamKurus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474834/3474834_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T12:39:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anna-Jean Klein</video:title>
      <video:description>Spend a rainy weekend with me at The Woodshed | Jordan River</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474833/3474833_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T12:39:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam gemoy dan seksi</video:title>
      <video:description>#Ayamgemoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474832/3474832_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T12:39:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Renovasi free fire and Naruto saippuden</video:title>
      <video:description>Renovasi free fire trend fashion Naruto saippuden #GamesfreefireandNarutosaippuden</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474831/3474831_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T12:39:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pasanyayam. Pergi ke pesta</video:title>
      <video:description>#Pestaayam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474830/3474830_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:38:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tergigit ular</video:title>
      <video:description>#Ularmenggigit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474829/3474829_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-21T12:38:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Intoduction Juni Fariska Tiktoker From Indonesian</video:title>
      <video:description>✅ https://tr.ee/nWFS3G611O ✅ https://tr.ee/f_cYC3dkY5 📂 https://tr.ee/mvk8UkFaIk 📂 https://tr.ee/cbEiYeVQuk 📂 https://tr.ee/lYRjwNC3vq 🤫 https://tr.ee/2NtDNXCZtp 🎁 https://tr.ee/iFV16Dj1yn #fyp #tiktok #girl #hijab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474828/3474828_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:37:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Green screen shot movie 🍿</video:title>
      <video:description>Green short Clip of movie #Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474827/3474827_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:37:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hira Chaudhary</video:title>
      <video:description>Rate my outfit ❣️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474826/3474826_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T12:37:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juni Fariska - Hijab Beauty Indonesia</video:title>
      <video:description>✅ https://tr.ee/nWFS3G611O ✅ https://tr.ee/f_cYC3dkY5 📂 https://tr.ee/mvk8UkFaIk 📂 https://tr.ee/cbEiYeVQuk 📂 https://tr.ee/lYRjwNC3vq 🤫 https://tr.ee/2NtDNXCZtp 🎁 https://tr.ee/iFV16Dj1yn #fyp #tiktok #hijab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474825/3474825_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:36:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Looks easy, fails instantly 😂 Imitation fails that hurt to watch 💀</video:title>
      <video:description>Everyone thinks they can copy it. Nobody can. 😂 These imitation fails will make you laugh out loud. Which one got you? Comment the number 👇 Tag a friend who &quot;learns instantly.&quot; 😂 Follow for daily funny fails. #imitationfails #funnyfails #trynottolaugh #failcompilation #funnyvideos #copyfail #lookseasyfail #funnyChinesevideos #epicfails #funnymoments #failsoftheweek #模仿翻車 #搞笑 #一學就廢 #翻車現場 #專治不開心</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474824/3474824_720p.mp4</video:content_loc>
      <video:duration>161</video:duration>
      <video:publication_date>2026-09-21T12:36:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hazrat Bilal</video:title>
      <video:description>Hazrat Bilal · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474823/3474823_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:36:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best TikTok vedio</video:title>
      <video:description>TikTok Vedio Febspot #Entreitemnt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474822/3474822_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T12:36:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny videos 475</video:title>
      <video:description>#funny #laugh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474821/3474821_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-21T12:36:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juni Fariska Hijab Beauty Tiktok</video:title>
      <video:description>✅ https://tr.ee/nWFS3G611O ✅ https://tr.ee/f_cYC3dkY5 📂 https://tr.ee/mvk8UkFaIk 📂 https://tr.ee/cbEiYeVQuk 📂 https://tr.ee/lYRjwNC3vq 🤫 https://tr.ee/2NtDNXCZtp 🎁 https://tr.ee/iFV16Dj1yn #tiktok #hijab #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474820/3474820_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:36:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rak mudeng</video:title>
      <video:description>Mbuh blas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474819/3474819_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-21T12:36:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kayleigh Ramsey</video:title>
      <video:description>3 more weeks till winter!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474818/3474818_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:36:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mbuh iki</video:title>
      <video:description>Pie toh kih</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474817/3474817_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-21T12:35:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The pizza night</video:title>
      <video:description>Couldn&apos;t eat anything again after eating this #PizzaNightwithfamily</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474816/3474816_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T12:35:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juni Fariska Tiktoker Beauty Hijab</video:title>
      <video:description>✅ https://tr.ee/nWFS3G611O ✅ https://tr.ee/f_cYC3dkY5 📂 https://tr.ee/mvk8UkFaIk 📂 https://tr.ee/cbEiYeVQuk 📂 https://tr.ee/lYRjwNC3vq 🤫 https://tr.ee/2NtDNXCZtp 🎁 https://tr.ee/iFV16Dj1yn #fyp #tiktok #hijab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474815/3474815_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:35:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngopi 26</video:title>
      <video:description>Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474814/3474814_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T12:35:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New York City Life</video:title>
      <video:description>Alicia Keys · Empire State of Mind (Part II) Broken Down</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474813/3474813_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T12:33:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sayuran Acar  Ini waktu yang tepat untuk sayuran acar, dan setelah musim dingin, sayuran acar terasa</video:title>
      <video:description>Sayuran Acar | Saatnya membuat sayuran acar. Sawi yang telah melewati musim dingin kini diasamkan menjadi &apos;Suancai&apos; yang asam dan gurih. Satu gigitan rasa asam yang familiar itu dapat mengusir kesepian akan negeri yang jauh dan menenangkan kerinduan yang terpendam di dalam hati.&quot; Pickled Vegetables | It&apos;s time for pickled vegetables. Mustard greens that have braved the winter are now being pickled into tart, savory &apos;Suancai.&apos; A single bite of that familiar tang can chase away the loneliness of a far-off land and soothe the yearnings deep within the heart.&quot; #SayuranAcar #Iniwaktuyangtepatuntuksayuranacar #dansetelahmusimdingin #sayuranacarterasaasamdansegar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474812/3474812_720p.mp4</video:content_loc>
      <video:duration>2299</video:duration>
      <video:publication_date>2026-09-21T12:33:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar sepeda</video:title>
      <video:description>Semoga terhibur dengan vidio ini #Komedi #lucu #funy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474811/3474811_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:33:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIY Turning real leaves</video:title>
      <video:description>DIY Turning real leaves into cement pots #diypots</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474810/3474810_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T12:33:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ZedVault #Explore, #Learn and #Grow</video:title>
      <video:description>It explains the benefits of learning AI especially for ones academic life and Continuous profession development CPD #Learn #GrowandExplore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474809/3474809_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T12:32:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Abdul Infotech</video:title>
      <video:description>Welcome to N-A Restoration Cars 🚗✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474808/3474808_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:32:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Bee Aggressive on Tall Tree”</video:title>
      <video:description>🐝🌳 Watch out! A swarm of aggressive bees takes over a tall tree! 😱 This incredible moment shows how protective bees can be when their colony is disturbed. Would you dare to get this close? 👀🔥 Nature can be beautiful… but sometimes, it can also be dangerous! 🐝⚠️ Follow for more amazing and unexpected moments from nature! 🌎✨ #TongueDelicious #Foodie #FoodLover #DeliciousFood #FoodPorn #Yummy #Tasty #FoodVideo #FoodShorts #ViralFood #FoodLovers #Mouthwatering #AmazingFood #StreetFood #FoodieLife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474807/3474807_720p.mp4</video:content_loc>
      <video:duration>304</video:duration>
      <video:publication_date>2026-09-21T12:31:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesia mobil kena banjir</video:title>
      <video:description>Indonesia mobil tak mati mesin kena air</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474806/3474806_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T12:31:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The excitement of school children</video:title>
      <video:description>Children jokingly play happily #School #vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474805/3474805_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T12:31:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That K-drama scene that lives in my head rent-free 😂</video:title>
      <video:description>Don&apos;t mess with girls. 😳🔥 You think you know how this ends... you don&apos;t. Watch till the last second 👀 What&apos;s your favorite K-drama comedy scene? Drop it below 👇 Tag a K-drama fan who needs to see this 😂 Follow for daily K-drama moments and edits. #kdrama #kdramaedit #koreandrama #funnykdramascene #kdramacomedy #koreandramascenes #dontmesswithgirls #kdramamoments #funnydramaclips #hospitalscenekdrama #bestkdramascenes #kdramashorts #koreancomedy #kdramafans #dramaedits</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474804/3474804_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T12:31:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Found a Sunken Submarine… Something Moved Inside 😳🌊</video:title>
      <video:description>A mysterious underwater discovery turns into a tense deep-sea exploration. A forgotten submarine rests beneath the ocean, covered in rust and marine growth. But when the diver reaches the open hatch, something moves in the darkness. Watch until the final reveal. 🌊🔦 Original underwater exploration concept with original visual and audio elements. #sunkensubmarine #underwatermystery #deepsea #oceanexploration #submarinewreck #underwaterdiscovery #scubadiving #deepocean #mysteriousocean #underwateradventure #marineexploration #abandonedsubmarine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474803/3474803_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T12:30:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nyantai karo</video:title>
      <video:description>Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474802/3474802_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T12:30:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 98</video:title>
      <video:description>Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474801/3474801_720p.mp4</video:content_loc>
      <video:duration>254</video:duration>
      <video:publication_date>2026-09-21T12:29:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan senja</video:title>
      <video:description>Keindahan ciptaan tuhan #Amerika #inggris #Australia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474800/3474800_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T12:29:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Penak ngopi 2</video:title>
      <video:description>Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474799/3474799_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T12:29:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pokok e ngopi</video:title>
      <video:description>Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474798/3474798_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T12:28:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bro thought it was easy... his ego got humbled instantly 💀</video:title>
      <video:description>POV: bro got humbled by his own ego. 💀 He thought it was easy... he thought wrong. 😭 Have you ever been this confident and this wrong? Tell me below 👇 Tag a friend whose ego is bigger than their skills 😂 Follow for more funny fails and humbling moments. #brogothumbled #humbledbyego #egocheck #funnyfail #gymfail #overconfidence #thoughtitwaseasy #POVhumbled #failcompilation #relatablefail #karmaisquick #instantregret #funnygymmoments #humblingmoments #waitforit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474797/3474797_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:27:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ashi Hussain</video:title>
      <video:description>Bartan ka name sun k mukar gya 😂😂😂</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474796/3474796_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T12:27:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474795</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474795/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Gunika Dance 7</video:title>
      <video:description>Indian Girl Gunika Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474795/3474795_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-21T12:27:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu18643</video:title>
      <video:description>Eu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474794/3474794_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T12:24:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Only backbenchers understand the last one 💀</video:title>
      <video:description>Everyone was smart until the last one. 😭 Only backbenchers will understand. Which one would you have tried? (Be honest 😂) Comment the number 👇 Tag your exam hall partner 😂 Follow for more school humor and relatable moments. #backbenchers #onlybackbenchersunderstand #examhall #examhumor #schoolhumor #studentlife #relatableschoolmoments #funnyexamscenes #exammemes #invigilator #smartstudents #lastbench #backbenchersvibes #schoolmemes #funnycompilation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474793/3474793_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-21T12:24:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Little Golden Fairy Says Good Morning And I Love You So Much - Good Morning Wishes ✨</video:title>
      <video:description>Good Morning! ✨ This cute little golden fairy has a special message for you: &quot;I love you so much&quot; 😍 Send this to someone you love this morning to make their day beautiful! Who will you send it to? Tag them below! 👇 Wishing you a magical and blessed morning! 🙏✨ More good morning wishes and beautiful fairy videos on my Febspot: https://www.febspot.com/ref/1219809/ #GoodMorning #GoodMorningWishes #Fairy #GoldenFairy #I love you #MorningGreeting #CuteFairy #goodmorning #goodmorningwishes #goldenfairy #cutefairy #goodmorningmessage #iloveyou #morninggreeting #fairyvideo #goodmorningvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474792/3474792_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T12:24:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lost To You (2026) Episode 12</video:title>
      <video:description>Lost To You (2026) Episode 12</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474791/3474791_720p.mp4</video:content_loc>
      <video:duration>2268</video:duration>
      <video:publication_date>2026-09-21T12:24:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Defesa civil</video:title>
      <video:description>Defesa civil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474790/3474790_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T12:23:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juni fariska tiktoker hijab</video:title>
      <video:description>✅ https://tr.ee/nWFS3G611O ✅ https://tr.ee/f_cYC3dkY5 📂 https://tr.ee/mvk8UkFaIk 📂 https://tr.ee/cbEiYeVQuk 📂 https://tr.ee/lYRjwNC3vq 🤫 https://tr.ee/2NtDNXCZtp 🎁 https://tr.ee/iFV16Dj1yn #hijab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474789/3474789_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T12:23:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desa ku indonesia</video:title>
      <video:description>Indonesia 🇲🇨🌅</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474788/3474788_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T12:22:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ventilation system</video:title>
      <video:description>These are direct drive fans imported from Turkiye</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474787/3474787_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T12:20:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Science experiments that break your brain 😳</video:title>
      <video:description>These physics moments look fake but they&apos;re real. 🤯🔬 Which experiment blew your mind? Comment the number 👇 (I can&apos;t get over the last one.) Tag someone who loves science and satisfying videos. Follow for daily science, experiments and mind-blowing facts. #physicsexperiments #scienceexperiments #physicsmoments #coolscience #satisfyingscience #mindblowingscience #sciencetricks #physicstricks #amazingexperiments #sciencecompilation #coolphysics #sciencefacts #weirdscience #experimentsathome #physicsismagic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474786/3474786_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-21T12:20:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>May Allah Shower Us With His Mercy</video:title>
      <video:description>Trust in Allah is the foundation of faith uy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474785/3474785_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:18:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jasmeen Ansari</video:title>
      <video:description>Following</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474784/3474784_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:17:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MahmalKhan</video:title>
      <video:description>Be super strict to your boundaries as a lady you should have look upon what is worth for you …. You are precious</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474783/3474783_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T12:17:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Les nains .</video:title>
      <video:description>Elle a cru la offert une bague .</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474782/3474782_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T12:17:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474781</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474781/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sydney Valdecantos</video:title>
      <video:description>Get in, loser 🍂</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474781/3474781_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:16:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474780</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474780/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bro was 1 second away from disaster 💀</video:title>
      <video:description>God really saved bro today. 😅🙏 He came SO close. Watch it twice, then tell me: lucky escape or perfect timing? 👇 Tag a friend who always gets away with it 😂 Follow for daily funny and viral moments. #Godreallysavebro #closecall #luckyescape #nearmiss #funnymoments #viralfunnyvideo #broescaped #funnyreaction #shockedreaction #funnycowvideo #animalfail #funnyedit #memereaction #unexpectedending #waitforit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474780/3474780_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T12:16:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 10 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 10 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474779/3474779_720p.mp4</video:content_loc>
      <video:duration>4087</video:duration>
      <video:publication_date>2026-09-21T12:15:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pie iki</video:title>
      <video:description>Mbuh iki</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474778/3474778_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T12:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naiyar Raza Ashrafi</video:title>
      <video:description>باپ کی سختی بری لگتی ہے</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474777/3474777_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T12:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagi viral kucing joget</video:title>
      <video:description>Lagi viral kucing joget #Viralfyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474776/3474776_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:15:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngopi 25</video:title>
      <video:description>Cantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474775/3474775_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T12:15:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuting sticker,  berkreasi</video:title>
      <video:description>Cuting sticker variasi #Cutingsticker #variasi #car #Automotif</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474774/3474774_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T12:15:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AREP ngopo</video:title>
      <video:description>Ngpi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474773/3474773_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T12:14:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>art_by_hassan4809</video:title>
      <video:description>trendingreels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474772/3474772_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T12:14:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474771</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474771/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lost To You (2026) Episode 11</video:title>
      <video:description>Lost To You (2026) Episode 11</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474771/3474771_720p.mp4</video:content_loc>
      <video:duration>1854</video:duration>
      <video:publication_date>2026-09-21T12:14:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngopi iki</video:title>
      <video:description>Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474770/3474770_720p.mp4</video:content_loc>
      <video:duration>89</video:duration>
      <video:publication_date>2026-09-21T12:14:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lost To You (2026) Episode 10</video:title>
      <video:description>Lost To You (2026) Episode 10</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474769/3474769_720p.mp4</video:content_loc>
      <video:duration>1787</video:duration>
      <video:publication_date>2026-09-21T12:14:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Which drawing is funnier than the real clip? 👀</video:title>
      <video:description>I ranked the funniest real-life moments, each turned into a drawing. 🎨😂 #1 made me lose it. Do you agree? Comment your own ranking 1 to 5 👇 #situationdraw #funnymomentsdrawing #rankingfunnyvideos #viralfailsdrawing #funnysketch #artoffunnymoments #drawingchallenge #funnyfails #comedyart #rankingseries #part3 #funnyclipsranked #sketchanimation #viralmoments #relatablehumor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474768/3474768_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T12:13:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Life Saver rescue video 📸</video:title>
      <video:description>#life #save #foryou #Rainbow</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474767/3474767_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:13:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>প্রকৃতির মাঝে নসিহত   ·</video:title>
      <video:description>There is no one like a mother in the world</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474766/3474766_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:13:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Taking Medicine Is Not Against Destiny</video:title>
      <video:description>Treatment does not fight Qadar—it is part of Qadar. Make du‘a. Seek treatment. Take precautions. Trust Allah, but do your part. Tawakkul is not doing nothing; it is taking the means while trusting the One who controls the outcome. #Treatment #Destiny #Means</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474765/3474765_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:11:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freefire 28</video:title>
      <video:description>Gameplay #FreeFireFreeFireBrasilGarenaFreeFireSCHICOFreeFireBooyahFreeFireMobileFreeFireGameFreeFireHeadshotFreeFireProFreeFireSquadFreeFireGameplayFreeFireAoVivoGamerBRJogoMobileFreeFireDicasFreeFireHighlights</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474764/3474764_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-21T12:11:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Martial arts teacher</video:title>
      <video:description>This is just a funny show to entertain the audience. #Funny #happy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474763/3474763_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T12:11:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Cici Diyana Real Good | Hijab Cici Diyana Show Up | Cici Good Real</video:title>
      <video:description>Cicigoodreal (Diyana) adalah seorang content creator yang dikenal luas lewat konten-konten kasualnya. Karakteristik utama dari penampilannya di publik adalah gaya berhijab yang khas serta pembawaannya yang dinilai memiliki vibes ramah atau dekat dengan keseharian audiens. Daya tarik visual dan interaksi yang ia bangun membuat banyak netizen penasaran, hingga tak sedikit akun re-upload atau basis penggemar (fanbase) yang ikut membagikan potongan video kegiatannya, baik saat melakukan swafoto (selfie) maupun melakukan eksklusif siaran langsung (live streaming). 👉 https://justpaste.it/go77f #fyp #tiktok #hijab #dance #thisciciigood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474762/3474762_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T12:09:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Penak ngopi</video:title>
      <video:description>Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474761/3474761_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-21T12:09:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Ekta Sharma Dance 31</video:title>
      <video:description>Indian Girl Ekta Sharma Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474760/3474760_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-21T12:09:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral Cat Referee Gives Chicken a Red Card! 🐱⚽️🐔</video:title>
      <video:description>Watch this hilarious viral moment as an adorable ginger cat dressed as a referee blows the whistle, gets challenged by a chicken, and decisively pulls out a red card! You won&apos;t want to miss the funny ending. Like, comment, and subscribe for more viral animal videos! #funnycatsviralanimalscatrefereechickenandcatfunnypetsredcardanimalhumorcutecatstrendingvideosshort</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474759/3474759_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T12:09:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Cici Diyana Real Good | Hot Hijab Cici Diyana | Cici Good Real</video:title>
      <video:description>Cicigoodreal (Diyana) adalah seorang content creator yang dikenal luas lewat konten-konten kasualnya. Karakteristik utama dari penampilannya di publik adalah gaya berhijab yang khas serta pembawaannya yang dinilai memiliki vibes ramah atau dekat dengan keseharian audiens. Daya tarik visual dan interaksi yang ia bangun membuat banyak netizen penasaran, hingga tak sedikit akun re-upload atau basis penggemar (fanbase) yang ikut membagikan potongan video kegiatannya, baik saat melakukan swafoto (selfie) maupun melakukan eksklusif siaran langsung (live streaming). 👉 https://justpaste.it/go77f #fyp #tiktok #hijab #dance #thisciciigood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474758/3474758_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:09:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>L’avion .</video:title>
      <video:description>L’avion en panne attiré par deux annes .</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474757/3474757_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T12:08:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pelangi 5</video:title>
      <video:description>Sore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474756/3474756_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T12:08:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏆 Bora caçar verificados! 96</video:title>
      <video:description>🎧 FONE FIFINE H9 — RECOMENDO PRA VOCÊ! 🔗 https://onelink.shein.com/53/62f00ud4axhp?ismg_ol=GIt6n7MVzkN_01_KOC-C ✅ Som potente, perfeito pra ouvir passos no FF ✅ Microfone incluso pra conversar com galera ✅ Confortável pra jogar horas sem incomodar ✅ Preço bom demais! 💡 Compre por esse link e me ajuda sem gastar nada a mais! Obrigado! 🐎🔥 ⚠️ Esse vídeo contém link de afiliado</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474755/3474755_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T12:08:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice video 802</video:title>
      <video:description>41515.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474754/3474754_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T12:08:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Cici Diyana Real Good | Hijab Cici Diyana | Cici Good Real</video:title>
      <video:description>Cicigoodreal (Diyana) adalah seorang content creator yang dikenal luas lewat konten-konten kasualnya. Karakteristik utama dari penampilannya di publik adalah gaya berhijab yang khas serta pembawaannya yang dinilai memiliki vibes ramah atau dekat dengan keseharian audiens. Daya tarik visual dan interaksi yang ia bangun membuat banyak netizen penasaran, hingga tak sedikit akun re-upload atau basis penggemar (fanbase) yang ikut membagikan potongan video kegiatannya, baik saat melakukan swafoto (selfie) maupun melakukan eksklusif siaran langsung (live streaming). 👉 https://justpaste.it/go77f #fyp #tiktok #hijab #dance #thisciciigood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474753/3474753_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:08:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice Porty</video:title>
      <video:description>41467.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474752/3474752_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T12:07:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice porty</video:title>
      <video:description>41466.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474751/3474751_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-21T12:07:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Gatherer&apos;s Adventure in Isekai - S01E02 (eng sub)</video:title>
      <video:description>hope u like watching it so, enjoy and suggest if you want me to upload any other movie #animeseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474750/3474750_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-09-21T12:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 9 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 9 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474749/3474749_720p.mp4</video:content_loc>
      <video:duration>4130</video:duration>
      <video:publication_date>2026-09-21T12:05:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The story of the past</video:title>
      <video:description>Memories of the past that we will always remember for memories because they cannot be repeated again #Moments #travel #natural</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474748/3474748_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T12:05:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zarnab queen</video:title>
      <video:description>cool morning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474747/3474747_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T12:05:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Se tudo estiver difícil louve a Deus</video:title>
      <video:description>Inscreva-se obg #Músicagospel #louvores #canção</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474746/3474746_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T12:04:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goyang 44</video:title>
      <video:description>Asekkk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474745/3474745_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-21T12:04:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing yang penurut</video:title>
      <video:description>Udah sepatutnya menurut ma orang tua Jangan macam macam ya #kucinglucu #kucingviral #sioyen #pecintakucing #funnycat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474744/3474744_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T12:04:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Gatherer&apos;s Adventure in Isekai - S01E01(eng sub)</video:title>
      <video:description>hope u like watching it so, enjoy and suggest if you want me to upload any other movie #animeseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474743/3474743_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-09-21T12:03:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dandutan ae</video:title>
      <video:description>Dangdutan ae</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474742/3474742_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T12:03:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 82</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474741/3474741_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-21T12:03:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 81</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474740/3474740_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-21T12:02:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 80</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474739/3474739_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-21T12:02:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Riya Anxarii</video:title>
      <video:description>Petrol😫🙌🏻</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474738/3474738_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T12:02:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 79</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474737/3474737_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-21T12:02:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Weather 38</video:title>
      <video:description>Nice weather ☁️🌡️ #weather</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474736/3474736_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T12:02:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pé de goiaba florindo</video:title>
      <video:description>Plantas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474735/3474735_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T12:01:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 78</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474734/3474734_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-21T12:01:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 77</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474733/3474733_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-21T12:01:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sindhi 6</video:title>
      <video:description>Funny video #travelforyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474732/3474732_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T12:01:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pé de uva 2</video:title>
      <video:description>Uvas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474731/3474731_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T12:01:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 76</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474730/3474730_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-21T12:01:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best moments of childhood</video:title>
      <video:description>Nowadays, it&apos;s not like before, when people cared about each other. Remembering the past #Papua #moment #natural #Papuancustoms</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474729/3474729_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T12:01:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 75</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474728/3474728_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-21T12:00:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pitaya 3</video:title>
      <video:description>Pitaya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474727/3474727_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T12:00:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 74</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474726/3474726_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-21T12:00:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 73</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474725/3474725_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-21T12:00:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terpaksa</video:title>
      <video:description>Terpaksa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474724/3474724_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-21T11:59:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474723</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474723/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>les aides au palestiniens</video:title>
      <video:description>les aides au palestiniens #lesaidesaupalestiniens</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474723/3474723_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-21T11:59:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 72</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474722/3474722_720p.mp4</video:content_loc>
      <video:duration>505</video:duration>
      <video:publication_date>2026-09-21T11:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Design With Priyanka</video:title>
      <video:description>✨ How to Create a Luxury Product Ad Design in Canva?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474721/3474721_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T11:59:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Weathering With You 2019 (eng sub)</video:title>
      <video:description>hope u like watching it so, enjoy and suggest if you want me to upload any other movie #animemovies</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474720/3474720_720p.mp4</video:content_loc>
      <video:duration>6734</video:duration>
      <video:publication_date>2026-09-21T11:59:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ajibb</video:title>
      <video:description>Sjibb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474719/3474719_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T11:59:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas frfr</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474718/3474718_720p.mp4</video:content_loc>
      <video:duration>496</video:duration>
      <video:publication_date>2026-09-21T11:59:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Produção de limão</video:title>
      <video:description>Plantas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474717/3474717_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:59:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngopoi</video:title>
      <video:description>Ngopoi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474716/3474716_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-21T11:59:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 71</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474715/3474715_720p.mp4</video:content_loc>
      <video:duration>478</video:duration>
      <video:publication_date>2026-09-21T11:58:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngopi 24</video:title>
      <video:description>Ngopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474714/3474714_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T11:58:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melão são caetano</video:title>
      <video:description>Plantas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474713/3474713_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 70</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474712/3474712_720p.mp4</video:content_loc>
      <video:duration>481</video:duration>
      <video:publication_date>2026-09-21T11:58:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 69</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474711/3474711_720p.mp4</video:content_loc>
      <video:duration>488</video:duration>
      <video:publication_date>2026-09-21T11:57:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 68</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474710/3474710_720p.mp4</video:content_loc>
      <video:duration>508</video:duration>
      <video:publication_date>2026-09-21T11:57:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474709</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474709/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 8 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 8 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474709/3474709_720p.mp4</video:content_loc>
      <video:duration>3814</video:duration>
      <video:publication_date>2026-09-21T11:57:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 67</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474708/3474708_720p.mp4</video:content_loc>
      <video:duration>440</video:duration>
      <video:publication_date>2026-09-21T11:57:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 66</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474707/3474707_720p.mp4</video:content_loc>
      <video:duration>467</video:duration>
      <video:publication_date>2026-09-21T11:56:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474706</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474706/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute smile 2</video:title>
      <video:description>Cute baby care</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474706/3474706_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T11:56:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 65</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474705/3474705_720p.mp4</video:content_loc>
      <video:duration>470</video:duration>
      <video:publication_date>2026-09-21T11:56:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 64</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474704/3474704_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-21T11:55:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute baby 307</video:title>
      <video:description>Sweet baby #cutesmile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474703/3474703_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:55:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 63</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474702/3474702_720p.mp4</video:content_loc>
      <video:duration>473</video:duration>
      <video:publication_date>2026-09-21T11:55:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas fr</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474701/3474701_720p.mp4</video:content_loc>
      <video:duration>476</video:duration>
      <video:publication_date>2026-09-21T11:54:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>عمر بال لائیو ایکشن سیریز عمر کو سپر سایان بنتے ہوئے دیکھو.</video:title>
      <video:description>آپ کی ہدایت کے مطابق، فیب سپورٹ (FabSport) پر اپ لوڈ کرنے کے لیے ویڈیو کا ٹائٹل، ماسٹر ڈسکرپشن، ہیش ٹیگز اور کمنٹ کے لیے تیار کردہ مواد درج ذیل ہے: ​1. ویڈیو ٹائٹل (Video Title) ​عمر بول لائیو ایکشن سیریز: عمر کو سپر سایان بنتے ہوئے دیکھو ​2. ماسٹر ڈسکرپشن (Master Description) ​اس شاندار لائیو ایکشن ویڈیو میں دیکھیں کہ کس طرح عمر سپر سایان کی طاقت حاصل کرتا ہے اور اس کا نیا روپ سامنے آتا ہے۔ ایک سنسنی خیز اور حیرت انگیز منظر جو آپ کو دنگ کر دے گا! ​اگر آپ کو یہ ویڈیو پسند آئے تو لائک کریں، اپنے دوستوں کے ساتھ شیئر کریں اور فیب سپورٹ پر مزید ایسی دلچسپ ویڈیوز کے لیے ہمیں فالو کریں۔ ​3. ماسٹر ہیش ٹیگز (Master Hashtags) ​#UmarBool #SuperSaiyan #LiveActionSeries #FabSport #AnimeInRealLife #EpicTransformation #ViralVideo ​4. ماسٹر کمنٹ (Master Comment for Copy-Paste) ​واہ کیا زبردست اور طاقتور منظر ہے! عمر کا یہ سپر سایان والا لائیو ایکشن روپ واقعی کمال کا ہے 🔥 آپ کو یہ ویڈیو کیسی لگی؟ اپنی رائے کا اظہار کمنٹ میں ضرور کریں! آپ کی ہدایات کے مطابق ماسٹر ڈسکرپشن کو اپ ڈیٹ کر دیا گیا ہے، جس میں آپ کے چینل کا نام Umar Hafiz Ali febspot اور سبسکرائب، لائک اور شیئر کرنے کی درخواست شامل کر دی گئی ہے: ​اپ ڈیٹ شدہ ماسٹر ڈسکرپشن (Updated Master Description) ​اس شاندار لائیو ایکشن ویڈیو میں دیکھیں کہ کس طرح عمر سپر سایان کی طاقت حاصل کرتا ہے اور اس کا نیا روپ سامنے آتا ہے۔ ایک سنسنی خیز اور حیرت انگیز منظر جو آپ کو دنگ کر دے گا! ​ہمارے چینل Umar Hafiz Ali febspot پر خوش آمدید! عمر حافیظ علی کے اس چینل کو سبسکرائب، لائک اور شیئر ضرور کریں تاکہ آپ کو مزید ایسی دلچسپ اور بہترین ویڈیوز ملتی رہیں۔ #MasterHashtags​UmarBoolSuperSaiyanLiveActionSeriesFabSportAnimeInRealLifeEpicTransformationViralVideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474700/3474700_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:54:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sad video 90</video:title>
      <video:description>Don&apos;t miss video end last watch #videosad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474699/3474699_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T11:54:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 62</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474698/3474698_720p.mp4</video:content_loc>
      <video:duration>588</video:duration>
      <video:publication_date>2026-09-21T11:54:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio lucu animasi kucing joget</video:title>
      <video:description>Vidio lucu kocak Animasi kucing joget #Lucu #Animasi #cat #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474697/3474697_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:54:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 61</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474696/3474696_720p.mp4</video:content_loc>
      <video:duration>611</video:duration>
      <video:publication_date>2026-09-21T11:53:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lililala</video:title>
      <video:description>Lililala</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474695/3474695_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-21T11:53:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 60</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474694/3474694_720p.mp4</video:content_loc>
      <video:duration>450</video:duration>
      <video:publication_date>2026-09-21T11:53:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iklas</video:title>
      <video:description>Iklas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474693/3474693_720p.mp4</video:content_loc>
      <video:duration>128</video:duration>
      <video:publication_date>2026-09-21T11:53:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 59</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474692/3474692_720p.mp4</video:content_loc>
      <video:duration>579</video:duration>
      <video:publication_date>2026-09-21T11:52:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Emang orang tua uda pikun</video:title>
      <video:description>Semoga terhibur dwngan vidio ini #Komedi #lucu #funy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474691/3474691_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T11:52:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 58</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474690/3474690_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-09-21T11:52:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 57</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474689/3474689_720p.mp4</video:content_loc>
      <video:duration>433</video:duration>
      <video:publication_date>2026-09-21T11:51:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cases Even The FBI Can&apos;t explain🙀</video:title>
      <video:description>🙀 #usa #history #alcatraz</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474688/3474688_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-21T11:51:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 56</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474687/3474687_720p.mp4</video:content_loc>
      <video:duration>516</video:duration>
      <video:publication_date>2026-09-21T11:51:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474686</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474686/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video lucu 161</video:title>
      <video:description>Anak-anak sedang duduk main kembang api #paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474686/3474686_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T11:51:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tradisioal</video:title>
      <video:description>bukan sekedar sodara. tp sebuah kisah #tradisional #keramahan #kesetiaan #perayaan #kebersamaan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474685/3474685_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T11:50:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frutas 55</video:title>
      <video:description>#Frutas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474684/3474684_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-21T11:50:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iseng 3</video:title>
      <video:description>Iseng</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474683/3474683_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T11:50:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Another day another river rafting</video:title>
      <video:description>Briefing for river raft #Manali #himachal #riverrafting #watersports #famous #popular #adventureactivities #corporateoffice</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474682/3474682_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T11:49:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghar o Jaidaad</video:title>
      <video:description>(Guide 43) Kitchen banwa rahe hain? Counter height, depth aur cabinet measurements sahi rakhein for a comfortable, modern kitchen.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474681/3474681_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T11:49:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funniest Barista Cat Ever Makes Morning Coffee! ☕🐱 #shorts</video:title>
      <video:description>Meet the most talented (and serious!) ginger cat barista in town! Watch this hilarious orange cat take control of the coffee machine, brew a fresh cup, stir it with a tiny spoon, and enjoy his morning brew like a total boss. If you love funny cat videos and cute animals, this viral pet moment will definitely make your day! Don&apos;t forget to like, subscribe, and share with fellow cat lovers! 🐾✨ #funnycatvideos #cuteorangecat #catbaristamakingcoffee #viralpetvideos #cuteanimals #gingercat #funnycatsshorts #catdrinkingcoffee #funnypetsUSA #trendinganimalvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474680/3474680_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T11:48:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 7 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 7 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474679/3474679_720p.mp4</video:content_loc>
      <video:duration>4204</video:duration>
      <video:publication_date>2026-09-21T11:48:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soul Land (Douluo Dalu) Season 1 Episode 22 English Subbed</video:title>
      <video:description>Soul Land (Douluo Dalu) Season 1 Episode 22 English Subbed #Tangsan #XiaoWu #DaiMuBai #Shrek #Douluo #Dalu #SoulLand #Donghua #Chinese #Anime #XiaoYan #Lindong #MuChen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474678/3474678_720p.mp4</video:content_loc>
      <video:duration>1265</video:duration>
      <video:publication_date>2026-09-21T11:48:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dr. Zoya Malic</video:title>
      <video:description>Samajhdar Aurat Ye Ghalti Kabhi Nahi Karti 🥀 Pati Patni Rishta!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474677/3474677_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T11:46:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Futsutsuka na Akujo dewa Gozaimasu ga: Suuguu Chouso Torikae Den Episodes 11</video:title>
      <video:description>Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474676/3474676_720p.mp4</video:content_loc>
      <video:duration>1430</video:duration>
      <video:publication_date>2026-09-21T11:45:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Last of river rafting</video:title>
      <video:description>One of the finest adventure of life, the river rafting #Manali #riverrafting #water #watersports #adventureactivities #traveling #dangerouswatersports #edgeofdeath #popular</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474675/3474675_720p.mp4</video:content_loc>
      <video:duration>266</video:duration>
      <video:publication_date>2026-09-21T11:45:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Girls Twerking Cute Girls Twerk in Panties</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #twerking #citygirlstwerk #twerkcitygirls #labontatwerking #speedbarbadostwerking #girls #ishowspeedfirsttwerkingdance #femaletwerkinginsoccergame #femalefootballtwerking #womentwerkinginfootballmatch #citygirls #labontaasoccergametwerking #citygirls2018 #labontatwerkingdancingvsangelcity #citygirlsyoutube #youtubecitygirls #citygirlsmusicvideo #citygirlsofficialmusicvideo #womenfootballtweaking #twerk #twerksongs #twerker #hottesttwerk #hottwerk #besttwerkmusic #twerkchallenge #twerksongs2017panties #pantiesbikini #pantieswomen #pantiesybrasieres #pantiesybrasieresletra #pantiesshorts #pantiestothesidetheweeknd #pantiesandbraset #bestperiodpantiesforheavyflow #braandpantiesforwomen #bestpantiesforwomen #braandpanties #bestperiodpanties #bestseamlesspanties #bestperiodpantiesinindia #babyletmeputyourpantiestotheside #bestdisposableperiodpanties #bestmaternitypantiesafterdelivery #pantiescatbattlecats #cottonpanties #carmesiperiodpanties #con</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474674/3474674_720p.mp4</video:content_loc>
      <video:duration>758</video:duration>
      <video:publication_date>2026-09-21T11:45:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Need for speed 9</video:title>
      <video:description>The real game in live action #Otomotif #car #race #sound</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474673/3474673_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-21T11:44:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fhgdsy</video:title>
      <video:description>Dghgfd</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474672/3474672_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:44:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fanny 52</video:title>
      <video:description>Catch me if you can</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474671/3474671_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T11:44:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coox Cauich</video:title>
      <video:description>Coox Cauich · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474670/3474670_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:42:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fine girl 4</video:title>
      <video:description>Always happy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474669/3474669_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T11:41:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita belidah panjang</video:title>
      <video:description>#Lidahpanjang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474668/3474668_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:41:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474667</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474667/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reeding</video:title>
      <video:description>Reading #Douyin #kids #baby #waner #funny #fyp #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474667/3474667_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T11:41:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pegawai indomaret</video:title>
      <video:description>#Pegawai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474666/3474666_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:41:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita cantik salto</video:title>
      <video:description>#Salto</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474665/3474665_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T11:40:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nijuuseiki Denki Mokuroku -Eureka Evrika- Episodes 12</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474664/3474664_720p.mp4</video:content_loc>
      <video:duration>1535</video:duration>
      <video:publication_date>2026-09-21T11:40:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beladiri Karate</video:title>
      <video:description>#Karate</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474663/3474663_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T11:40:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video indahnya alam</video:title>
      <video:description>Video keindahan kreasi alam semesta #Videoterindah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474662/3474662_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T11:40:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skill Yamal 2026</video:title>
      <video:description>Skill Yamal yang tak terhentikan di tahun 2026 #Fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474661/3474661_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T11:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kata kata mutiara 3</video:title>
      <video:description>kata kata mutiara perjalanan hidup #katakatamutiara</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474660/3474660_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T11:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buah terong langka</video:title>
      <video:description>#Buahlangka</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474659/3474659_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T11:39:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nobody was ready for this jump scare 😭</video:title>
      <video:description>Try NOT to flinch. 😱 The best jump scares, screams and priceless reactions in one video. Which one got you? Comment the scene 👇 Tag someone who screams at everything 😂 Follow for more funny moments and pranks. ⚠️ For entertainment purposes only. Don&apos;t try this at home. #scareprank #jumpscare #scareprankcompilation #funnypranks #scarypranks #bestpranks #prankreactions #jumpscarereactions #screamprank #halloweenprank #pranksgonewrong #funnyscaredreactions #trynottojump #prankvideos #viralpranks</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474658/3474658_720p.mp4</video:content_loc>
      <video:duration>138</video:duration>
      <video:publication_date>2026-09-21T11:39:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mancing mania 9</video:title>
      <video:description>#Mancing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474657/3474657_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T11:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tanko Dakup</video:title>
      <video:description>Your computer freezes? DON’T restart it yet.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474656/3474656_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T11:39:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Girls Twerking Girls Bouncing Butts in Panties</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #twerking #citygirlstwerk #twerkcitygirls #labontatwerking #speedbarbadostwerking #girls #ishowspeedfirsttwerkingdance #femaletwerkinginsoccergame #femalefootballtwerking #womentwerkinginfootballmatch #citygirls #labontaasoccergametwerking #citygirls2018 #labontatwerkingdancingvsangelcity #citygirlsyoutube #youtubecitygirls #citygirlsmusicvideo #citygirlsofficialmusicvideo #womenfootballtweaking #twerk #twerksongs #twerker #hottesttwerk #hottwerk #besttwerkmusic #twerkchallenge #twerksongs2017panties #pantiesbikini #pantieswomen #pantiesybrasieres #pantiesybrasieresletra #pantiesshorts #pantiestothesidetheweeknd #pantiesandbraset #bestperiodpantiesforheavyflow #braandpantiesforwomen #bestpantiesforwomen #braandpanties #bestperiodpanties #bestseamlesspanties #bestperiodpantiesinindia #babyletmeputyourpantiestotheside #bestdisposableperiodpanties #bestmaternitypantiesafterdelivery #pantiescatbattlecats #cottonpanties #carmesiperiodpanties #con</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474655/3474655_720p.mp4</video:content_loc>
      <video:duration>565</video:duration>
      <video:publication_date>2026-09-21T11:39:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mengambil susu sapi</video:title>
      <video:description>#Sususapi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474654/3474654_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:39:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Olahraga pengecil perut</video:title>
      <video:description>#Olahraga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474653/3474653_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T11:38:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💀 匚ㄖㄥㄖ几ㄚ ㄩ卩匚ㄖ爪丨几Ꮆ  乇卩丨丂ㄖᗪ乇丂. 👻</video:title>
      <video:description>Follow and visit our complete profile for more parts..💪 The new kdrama/movie colony episodes are here to watch with English and different subtitles....🔥 Come and see for more parts...🎥 #colony #colonyupcoming #upcomingepisodes #horrorcolony #horrorseries #webseries #upcomingwebseries #trendingnow #viralnow #horrorfan #scaryseries #mustwatch #bingewatch #newrelease #comingsoon #trendingseries #viralseries #horrorlovers #creepycolony #horrorgram</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474652/3474652_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T11:38:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>environmental safety  Bu</video:title>
      <video:description>This video features Superman joining neighborhood watch officers to keep the area safe from theft, robbery, and kissing. translate video ini menampilkan Superman menemani petugas hansip/siskamling menjaga keamanan lingkungan warga agar aman tidak ada pencurian,perampokan, ciuman #Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474651/3474651_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T11:38:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uhhb mantep banget kalo di goyangin</video:title>
      <video:description>Uhhb mantep banget kalo di goyangin #fyp #tiktok #dance #girl #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474650/3474650_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:38:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He who fight and run away live to fight another day</video:title>
      <video:description>Telling about one who runs from fighting to can not come back for another fight</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474649/3474649_720p.mp4</video:content_loc>
      <video:duration>151</video:duration>
      <video:publication_date>2026-09-21T11:38:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Light Of Faith</video:title>
      <video:description>The Ancient 4.500-Year-Old Tunic at the Egyptian Museum A rare glimpse into earlyظ uman craftsmanship, culture, and daily life preserved through thous…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474648/3474648_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T11:38:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar ilmu pedang</video:title>
      <video:description>#Ilmupedang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474647/3474647_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:38:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berlatih beladiri</video:title>
      <video:description>#Beladiri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474646/3474646_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:37:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gilgit Baltistan Explorer</video:title>
      <video:description>کون کون ان کو جانتے ہو اور کیوں یہ لوگ اس طرح گھوم رہے ہیں ؟</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474645/3474645_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T11:37:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>এবারে নতুন</video:title>
      <video:description>এবারে নতুন</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474644/3474644_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T11:37:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Too Much Cum!😳</video:title>
      <video:description>10 days of total retention and no fap? That Twitter video was insane... the sheer volume is actually wild!😳🥛</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474643/3474643_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-21T11:36:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Celana dalam terbesar</video:title>
      <video:description>#Celanadalam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474642/3474642_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:36:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Azur Lane Bisoku Zenshin! Ni!! Episodes 2 Episodes 12</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474641/3474641_720p.mp4</video:content_loc>
      <video:duration>510</video:duration>
      <video:publication_date>2026-09-21T11:36:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CC Luk</video:title>
      <video:description>This morning, I saw this diligent and hardworking colleague downstairs at our clinic in Tsim Sha Tsui. He was very careful in cleaning up small items</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474640/3474640_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T11:36:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Santet film Indonesia</video:title>
      <video:description>#FilmIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474639/3474639_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-21T11:36:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ahhh enak banget goyangannya</video:title>
      <video:description>ahhh enak banget goyangannya #dance #tiktok #girl #hot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474638/3474638_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:36:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enak banget goyangannya ihh</video:title>
      <video:description>Enak banget goyangannya ihh #dance #tiktok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474637/3474637_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:35:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>พารัก สร้างบ้าน</video:title>
      <video:description>This is the kind of kitchen that I never get tired of no matter how many times I look at.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474636/3474636_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T11:35:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita manis jemur pakaian</video:title>
      <video:description>#Jemurpakaian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474635/3474635_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:35:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main lumpur</video:title>
      <video:description>#Mainlumpur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474633/3474633_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:35:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sayonara Lara Episodes 12</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474632/3474632_720p.mp4</video:content_loc>
      <video:duration>1440</video:duration>
      <video:publication_date>2026-09-21T11:35:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Marseille vs PSG  1:2 | 20. 09. 2026 | Ligue 1</video:title>
      <video:description>Marseille vs PSG 1:2 | 20. 09. 2026 | Ligue 1 Subscribe: https://t.me/FGhighlights</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474631/3474631_720p.mp4</video:content_loc>
      <video:duration>671</video:duration>
      <video:publication_date>2026-09-21T11:35:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474630</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474630/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AC Milan vs Lecce  3:0 | 20. 09. 2026 | Serie A</video:title>
      <video:description>AC Milan vs Lecce 3:0 | 20. 09. 2026 | Serie A Subscribe: https://t.me/FGhighlights</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474630/3474630_720p.mp4</video:content_loc>
      <video:duration>514</video:duration>
      <video:publication_date>2026-09-21T11:35:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juventus vs Atalanta  2:0 | 20. 09. 2026 | Serie A</video:title>
      <video:description>Juventus vs Atalanta 2:0 | 20. 09. 2026 | Serie A Subscribe: https://t.me/FGhighlights</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474629/3474629_720p.mp4</video:content_loc>
      <video:duration>506</video:duration>
      <video:publication_date>2026-09-21T11:34:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lars Mittank Disappearance</video:title>
      <video:description>Where&apos;s lars mittank now? #larsmittank #disappearance #bulgaria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474628/3474628_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T11:34:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Babi yang mantap</video:title>
      <video:description>#Babipemburu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474627/3474627_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T11:34:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Putri duyung 2</video:title>
      <video:description>#Putriduyung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474626/3474626_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:34:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beti ki ehmiyat</video:title>
      <video:description>Lesson</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474625/3474625_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T11:33:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474624</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474624/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video fantastis indahnya</video:title>
      <video:description>Video ini hanya kreasi hiasan saji liwat kreasi #Videoindahkreasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474624/3474624_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T11:33:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aeitmaad Properties</video:title>
      <video:description>peace_bringer01 · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474623/3474623_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T11:32:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nungguin chat dari dia</video:title>
      <video:description>nungguin chat #nungguinchatdaridia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474622/3474622_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T11:32:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Justifiable Defense (2025) Episode 3 Eng Sub</video:title>
      <video:description>Justifiable Defense (2025) - CHINESE DRAMA Senior prosecutor Duan Hong Shan from the city prosecutor&apos;s office is handling a case involving a &quot;woman who killed her husband due to domestic violence.&quot; Young prosecutor Fang Ling Yuan from the provincial prosecutor&apos;s office is assigned to assist in the investigation. During the process of handling the case, they discovered a connection between it and the &quot;excessive self-defense on campus&quot; incident experienced by Li Mu Feng, Mei Zheng, and Jiang Ting, which Duan Hong Shan handled fourteen years ago. Grounded in facts and guided by the law, the two prosecutors, considering &quot;natural justice, human sentiment, and national law,&quot; ultimately provide a definitive resolution to the case. Justifiable Defense, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #JustifiableDefense #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474621/3474621_720p.mp4</video:content_loc>
      <video:duration>2452</video:duration>
      <video:publication_date>2026-09-21T11:31:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Because Its All For You (2026) Episode 5 Eng Sub</video:title>
      <video:description>Because Its All For You (2026) JAPAN DRAMA In the middle of her wedding reception, at the very height of happiness, the bride, Sayaka, is poisoned by someone. According to Sakuraba, the photographer who was at the wedding, it appears that poison had been mixed into the champagne. Could it be that the culprit is among the guests who attended the wedding?! The groom, Hayashida Kazuomi, and Sakuraba set out to find the perpetrator, but one after another, the hypocrisy of the suspects, including Sayaka’s best friend and her mother, comes to light… And then, glimpses of Sayaka’s pitch-black past begin to surface as well…? Every single person who appears in this story is a “hypocrite,” and “shocking truths” are revealed one after another. Because Its All For You, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #BecauseItsAllForYou #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474620/3474620_720p.mp4</video:content_loc>
      <video:duration>1396</video:duration>
      <video:publication_date>2026-09-21T11:31:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muhammad Riaz</video:title>
      <video:description>Riaz it&apos;s works please #Shakot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474619/3474619_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-21T11:31:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>shayra mittal</video:title>
      <video:description>Wafa World 🥀 ❤️‍🩹 🥺 💞 love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474618/3474618_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T11:31:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Girls Twerking Big Butts Girls Twerk</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #twerking #citygirlstwerk #twerkcitygirls #labontatwerking #speedbarbadostwerking #girls #ishowspeedfirsttwerkingdance #femaletwerkinginsoccergame #femalefootballtwerking #womentwerkinginfootballmatch #citygirls #labontaasoccergametwerking #citygirls2018 #labontatwerkingdancingvsangelcity #citygirlsyoutube #youtubecitygirls #citygirlsmusicvideo #citygirlsofficialmusicvideo #womenfootballtweaking #twerk #twerksongs #twerker #hottesttwerk #hottwerk #besttwerkmusic #twerkchallenge #twerksongs2017</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474617/3474617_720p.mp4</video:content_loc>
      <video:duration>599</video:duration>
      <video:publication_date>2026-09-21T11:30:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iran l ایران</video:title>
      <video:description>Sometimes…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474616/3474616_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T11:30:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kreasi yg indah</video:title>
      <video:description>Video kreasi indah alam olusi #Videoygindah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474615/3474615_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T11:29:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Punjab Safe Cities Authority 6</video:title>
      <video:description>رکشہ کی گاڑی کو ٹکر</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474614/3474614_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T11:29:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tobrut mulus piyama tidur</video:title>
      <video:description>Tobrut mulus piyama tidur enak buat di tidurin #dance #girlbeauty #tiktok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474613/3474613_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:29:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POV: you&apos;re doing great until the universe says &quot;not today&quot;</video:title>
      <video:description>Me trying to look cool in public: 😎 Embarrassment: &quot;not today&quot; 😭 We&apos;ve all been there. What&apos;s your most embarrassing public moment? Tell me below 👇 Tag a friend who is the main character until this exact moment 😂Follow for daily relatable moments. #relatable #embarrassingmoment #funnyfail #metryingtolookcool #maincharactermoment #awkwardmoment #poolfail #fashionfail #publicembarrassment #some #relatablehumor #funnyshorts #failcompilation #aestheticedits #karmaisquick</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474612/3474612_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T11:26:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DB Copper Case</video:title>
      <video:description>the mysterious disappearance of db cooper #case #mysterious #dbcooper</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474611/3474611_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-21T11:26:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Suku pedalaman mood</video:title>
      <video:description>#SukuDayak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474610/3474610_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T11:25:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Girls Twerking Big Bouncing Butts Twerk</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #twerking #citygirlstwerk #twerkcitygirls #labontatwerking #speedbarbadostwerking #girls #ishowspeedfirsttwerkingdance #femaletwerkinginsoccergame #femalefootballtwerking #womentwerkinginfootballmatch #citygirls #labontaasoccergametwerking #citygirls2018 #labontatwerkingdancingvsangelcity #citygirlsyoutube #youtubecitygirls #citygirlsmusicvideo #citygirlsofficialmusicvideo #womenfootballtweaking #twerk #twerksongs #twerker #hottesttwerk #hottwerk #besttwerkmusic #twerkchallenge</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474609/3474609_720p.mp4</video:content_loc>
      <video:duration>749</video:duration>
      <video:publication_date>2026-09-21T11:25:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam berotot</video:title>
      <video:description>#Ayberotot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474608/3474608_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T11:25:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the moment 3</video:title>
      <video:description>#MLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474607/3474607_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T11:24:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Film jadul 2</video:title>
      <video:description>#Filmjadul</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474606/3474606_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T11:24:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam mau jaln ke mall</video:title>
      <video:description>#Ayam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474605/3474605_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:24:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Confident Female Model Walking the Runway | Stylish Fashion Walk</video:title>
      <video:description>#femalemodel #fashionwalk #runwaywalk #catwalk #fashionmodel #modelwalking #stylishmodel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474604/3474604_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T11:24:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rambut panjang terurai</video:title>
      <video:description>#Rambutpanjang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474603/3474603_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:23:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju pink</video:title>
      <video:description>#Bajupink</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474602/3474602_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T11:23:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POV: you looked away for 5 seconds</video:title>
      <video:description>Blink and your toddler has bought a game, unplugged your phone and started &quot;cooking noodles&quot; 😭 Which one is the most relatable? Comment the number 👇 (I&apos;m team &quot;locked the cat in the cabinet.&quot;) Tag a parent who needs to see this 😂 #toddlerchaos #funnytoddlers #kidschaos #toddlerlife #relatableparents #parentinghumor #funnykids #toddlerfails #funnybabyvideos #toddlersbelike #momlife #dadlife #kidsbeingkids #toddlermeme #parentingfails #funnyfamilyvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474601/3474601_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-21T11:22:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gendong Ben yang Super Berat Sambil Dikejar Sammy!</video:title>
      <video:description>Gendong Ben yang Super Berat Sambil Dikejar Sammy!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474600/3474600_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T11:21:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Older_Man_Kicked_Out_Of_First_Class_By_A_Karen</video:title>
      <video:description>Older_Man_Kicked_Out_Of_First_Class_By_A_Karen #Travel #Paris #France #USA #Canada #UK #Earnings #drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474599/3474599_720p.mp4</video:content_loc>
      <video:duration>490</video:duration>
      <video:publication_date>2026-09-21T11:21:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Misi Penyelamatan Ben yang Terkurung!</video:title>
      <video:description>Misi Penyelamatan Ben yang Terkurung!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474598/3474598_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-21T11:21:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>منہاس شہید کی برسی</video:title>
      <video:description>راشد منہاس شہید کی برسی پر راجپوت کمیونٹی کی تقریب. #شہید #راشدمنہاس</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474597/3474597_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T11:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>COMEDY »WHAT’S HE DOING</video:title>
      <video:description>Please try watch this funny comedy video » I’m sure it will blow your minds off na make your day.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474596/3474596_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T11:19:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This dog is done with karaoke night 👀</video:title>
      <video:description>He was just trying to nap. Then the singing started. 😭 Watch the dog&apos;s face at the end, that look says everything. Would you sit through this or leave the room? Tell me below 👇 Follow for daily funny pet moments 🐶 #funnydog #dogreaction #dogsideeye #doghatessinging #dogreactstosinging #funnydogvideo #funnyanimals #cutedog #pethumor #relatabledog #dogmeme #karaokedog #dogfunnyface #animalreactions #funnypets2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474595/3474595_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T11:19:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indahnya alam kreasi</video:title>
      <video:description>Video ini sebuah kreasi halusinasi #Kreasiindahnyaalam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474594/3474594_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:17:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Did you like my b🤩🤩bs</video:title>
      <video:description>#Japanesedance #Japanesegirlsdance #Japanreels #dancereels #hotdance #dancevideo #Japanesedancevideo #trendingdance #viralreels #Instagramreels #dancetrend #Japanvibes #beautifuldance #energeticdance #trendingreels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474592/3474592_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:16:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita manis 2</video:title>
      <video:description>#Maniswanita</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474591/3474591_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:15:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asik berjoget</video:title>
      <video:description>#Berjoget</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474590/3474590_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T11:15:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When the Salesman Tests His Own Product 🤣</video:title>
      <video:description>POV: when bro&apos;s marketing skills are unbeatable 💀 He doesn&apos;t just say the chair is strong, he stands on it 😭🔥 Some things can&apos;t be taught, you learn them by experience. Would you buy from him? Comment below 👇 Follow for more! #marketingskillsunbeatable #streetsellermarketing #funnysalesdemo #productdemonstration #salesmanfunny #marketinglevel999 #saleshustlefunny #streetvendorskills #proofofquality #funnyhustlevideo #relatablesalesmemes #viralsalesvideo #marketingskillsfunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474589/3474589_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T11:15:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiga wanita cantik</video:title>
      <video:description>#Wanitacantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474588/3474588_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T11:15:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aerobik 4</video:title>
      <video:description>#Aerobik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474586/3474586_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T11:14:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pantai yang panjang</video:title>
      <video:description>#Pantai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474585/3474585_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:14:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anak sekolah 2</video:title>
      <video:description>#Anaksekolah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474584/3474584_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:13:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asik banget goyang</video:title>
      <video:description>#Joget</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474583/3474583_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T11:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju putih mempesona</video:title>
      <video:description>#Bajuputih</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474582/3474582_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T11:12:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dua hitam manis</video:title>
      <video:description>#Hitammanis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474581/3474581_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T11:12:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita gemoy</video:title>
      <video:description>#Gemoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474580/3474580_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T11:12:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cara menurunkan bambu dari perbukitan</video:title>
      <video:description>cara menurunkan bambu dari perbukitan #caramenurunkanbambudariperbukitan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474579/3474579_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T11:11:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bersandar di pohon pisang</video:title>
      <video:description>#Pohonpisang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474578/3474578_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T11:11:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju doraemon</video:title>
      <video:description>#Fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474577/3474577_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:11:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Helm yang mantap</video:title>
      <video:description>#Helm</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474575/3474575_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T11:10:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ternyata pohon juga bisa terkena kanker lo</video:title>
      <video:description>ternyata pohon juga bisa terkena kanker lo #ternyatapohonjugabisaterkenakankerlo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474574/3474574_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T11:10:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asik bergoyang</video:title>
      <video:description>#Goyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474573/3474573_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T11:10:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Obrigado todos vocês pela garra garra!</video:title>
      <video:description>Foi, no dia que vim buscar a minha mulher ,na casa dos pais,dela.. o kuduro agradece #viagemparísfrança</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474572/3474572_720p.mp4</video:content_loc>
      <video:duration>163</video:duration>
      <video:publication_date>2026-09-21T11:08:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Three dancer</video:title>
      <video:description>Three dancer #Funny #douyin #kids #viral #fyp #reels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474571/3474571_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T11:08:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jadilah Diri Sendiri</video:title>
      <video:description>Pernahkah kamu merasa lelah berpura-pura menjadi sosok yang sempurna demi memenuhi ekspektasi orang lain? Di tengah hiruk-pikuk tuntutan profesional dan kehidupan modern, kita sering kali tanpa sadar memakai &quot;topeng&quot;. Video animasi 3D cinematic pendek ini mengangkat kisah Kirana—seorang CEO muda yang terlihat memiliki segalanya, namun menyadari bahwa puncak kesuksesan terasa hampa jika kita kehilangan jati diri. Sebuah pengingat visual yang emosional tentang pentingnya kesehatan mental, menemukan work-life balance, dan keberanian untuk memimpin dengan hati. Waktu kita di dunia ini terlalu berharga untuk dihabiskan menjadi versi yang diinginkan orang lain. ✨ &quot;Waktumu singkat, hiduplah dengan jati diri, bukan bayangan orang lain.&quot; #Caramenjadidirisendiridanlebihpercayadiri #Videomotivasisingkatuntukbangkitdariketerpurukan #Katakatamotivasihiduptentangwaktudanjatidiri #Animasimotivasikehidupanyangmenyentuhhati #Caramenyeimbangkankarirdankebahagiaanpribadi #Berhentipeduliomonganoranglain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474570/3474570_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-21T11:08:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aqsa Pervaiz Hot Big Melons Make Horney</video:title>
      <video:description>Aqsa Pervaiz Hot Big Melons Make Horney cam star model #aqsa #pervaiz #model #cam #hot #big #melons</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474569/3474569_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T11:08:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pixel Blade</video:title>
      <video:description>#roblox</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474568/3474568_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T11:08:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Verdade 3</video:title>
      <video:description>Muintos homens começam sempre com o pé errado e são previsível</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474567/3474567_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-21T11:07:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Princess 9</video:title>
      <video:description>Princess #Douyin #kids #baby #animasi #fyp #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474565/3474565_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T11:06:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek Tobrut Joged Asyik</video:title>
      <video:description>Cewek Tobrut Joged Asyik #dance #beauty #girl #tobrut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474564/3474564_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T11:06:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aqsa Pervaiz Hot in Red Dress</video:title>
      <video:description>Aqsa Pervaiz Hot in Red Dress Pakistani model cam star #Aqsa #Pervaiz #Hot #Red #Dress #Pakistani #model #cam #star</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474563/3474563_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T11:06:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 Try Not to Laugh! Funniest Moments You’ve Ever Seen 🤣</video:title>
      <video:description>Get ready to laugh! 😂 This video is packed with funny, unexpected, and hilarious moments that will definitely make your day better. Watch until the end and share it with your friends who love funny videos! 🤣 #funnyvideo #trynottolaugh #funnymoments #hilarious #comedy #funnyclips #laugh #laughing #viralvideo #funnyfails #comedyvideo #hilariousmoments #entertainment #funnycompilation #unexpectedmoments #humor #bestfunnyvideos #laughoutloud #trendingvideo #funnycontent</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474562/3474562_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T11:06:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>São lembranças..</video:title>
      <video:description>O kuduro e a música que mas e consumida em Angola 🇦🇴🙏. ouvem #viagemfrança</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474561/3474561_720p.mp4</video:content_loc>
      <video:duration>220</video:duration>
      <video:publication_date>2026-09-21T11:05:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Impossible  Clutch 😈 One Tap Headshot 🔥 Free Fire Max Gameplay _ NatorX FF</video:title>
      <video:description>Impossible Clutch 😈 One Tap Headshot 🔥 Free Fire Max Gameplay _ NatorX FF</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474560/3474560_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T11:05:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Justifiable Defense (2025) Episode 2 Eng Sub</video:title>
      <video:description>Justifiable Defense (2025) - CHINESE DRAMA Senior prosecutor Duan Hong Shan from the city prosecutor&apos;s office is handling a case involving a &quot;woman who killed her husband due to domestic violence.&quot; Young prosecutor Fang Ling Yuan from the provincial prosecutor&apos;s office is assigned to assist in the investigation. During the process of handling the case, they discovered a connection between it and the &quot;excessive self-defense on campus&quot; incident experienced by Li Mu Feng, Mei Zheng, and Jiang Ting, which Duan Hong Shan handled fourteen years ago. Grounded in facts and guided by the law, the two prosecutors, considering &quot;natural justice, human sentiment, and national law,&quot; ultimately provide a definitive resolution to the case. Justifiable Defense, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #JustifiableDefense #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474559/3474559_720p.mp4</video:content_loc>
      <video:duration>2490</video:duration>
      <video:publication_date>2026-09-21T11:05:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Because Its All For You (2026) Episode 4 Eng Sub</video:title>
      <video:description>Because Its All For You (2026) JAPAN DRAMA In the middle of her wedding reception, at the very height of happiness, the bride, Sayaka, is poisoned by someone. According to Sakuraba, the photographer who was at the wedding, it appears that poison had been mixed into the champagne. Could it be that the culprit is among the guests who attended the wedding?! The groom, Hayashida Kazuomi, and Sakuraba set out to find the perpetrator, but one after another, the hypocrisy of the suspects, including Sayaka’s best friend and her mother, comes to light… And then, glimpses of Sayaka’s pitch-black past begin to surface as well…? Every single person who appears in this story is a “hypocrite,” and “shocking truths” are revealed one after another. Because Its All For You, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #BecauseItsAllForYou #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474558/3474558_720p.mp4</video:content_loc>
      <video:duration>1402</video:duration>
      <video:publication_date>2026-09-21T11:04:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute kittens being overdramatic</video:title>
      <video:description>Compilation of kittens acting like total drama queens. They are small, they are loud, and theyy officialy have zero chill. If you love tiny kittens with big personalities, this video is for you! Dont forget to Subscribe! #FunnyCatscatvideosFunnyCatMoments</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474557/3474557_720p.mp4</video:content_loc>
      <video:duration>301</video:duration>
      <video:publication_date>2026-09-21T11:02:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Conquistas</video:title>
      <video:description>Na vida aqui ser determinado</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474556/3474556_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T11:01:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>100m men s1</video:title>
      <video:description>Ifam oordegem #100mbelgique</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474555/3474555_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T11:00:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hear this my people</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474554/3474554_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T11:00:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>True love never die</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474553/3474553_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T10:59:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This one sweet me</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474552/3474552_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T10:58:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A shop for killers ep 4 Hindi dubbed</video:title>
      <video:description>A shop for killers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474551/3474551_720p.mp4</video:content_loc>
      <video:duration>2649</video:duration>
      <video:publication_date>2026-09-21T10:58:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A shop for killers ep 3 Hindi dubbed</video:title>
      <video:description>A shop for killers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474550/3474550_720p.mp4</video:content_loc>
      <video:duration>3746</video:duration>
      <video:publication_date>2026-09-21T10:58:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 6 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 6 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474549/3474549_720p.mp4</video:content_loc>
      <video:duration>4473</video:duration>
      <video:publication_date>2026-09-21T10:57:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MS FURNITURE 2</video:title>
      <video:description>Munshi #MSFURNITURE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474548/3474548_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T10:57:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I love this 9</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474547/3474547_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T10:57:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😳😳😳😳😳</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474546/3474546_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-09-21T10:57:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TOY STORY 5</video:title>
      <video:description>TOY STORY 5</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474545/3474545_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-21T10:56:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good morning guys 9</video:title>
      <video:description>#Uk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474544/3474544_720p.mp4</video:content_loc>
      <video:duration>128</video:duration>
      <video:publication_date>2026-09-21T10:56:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kalung yang indah</video:title>
      <video:description>#Kalung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474543/3474543_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:55:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju hitam manis menawan</video:title>
      <video:description>#Bajuhitam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474542/3474542_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T10:55:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mencuci ember</video:title>
      <video:description>#Mencuci</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474541/3474541_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T10:54:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>revamp masha</video:title>
      <video:description>#MLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474540/3474540_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T10:54:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita manis</video:title>
      <video:description>#Wanita</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474539/3474539_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T10:54:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju berpita seksi</video:title>
      <video:description>#Bajutidur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474538/3474538_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T10:54:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita berbaju ungu</video:title>
      <video:description>#Ungu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474537/3474537_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:53:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Celana loreng</video:title>
      <video:description>#Fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474536/3474536_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T10:52:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥😎👑😎🔥</video:title>
      <video:description>The truth power ⛮ Last in the end #Thatshopeisforsure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474535/3474535_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-21T10:52:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>STAY HOPEFUL</video:title>
      <video:description>This is just to encourage and boost your faith and hope in your struggle to was life. That no matter what remain strong in God in whatev You’re doing to survive’ and never give up » just one day your story will change for good.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474534/3474534_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T10:52:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“When Paint Turns Into an Adorable Penguin! 🐧🎨”</video:title>
      <video:description>Have you ever seen paint turn into a penguin? 😍🐧 A tiny tube of paint magically creates the cutest little penguin that will leave you amazed! ✨ A surreal, satisfying AI video you’ll want to watch until the end! 😂</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474533/3474533_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T10:52:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Air terjun yang mantap</video:title>
      <video:description>#Airterjun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474532/3474532_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T10:52:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gadis berkerudung seksi</video:title>
      <video:description>#Seksi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474531/3474531_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T10:51:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Si putih mempesona</video:title>
      <video:description>#Mempesona</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474530/3474530_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T10:51:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bantal guling</video:title>
      <video:description>#Bantalguling</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474529/3474529_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T10:51:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chhup Gaya Full Song _ Hum Aapke Dil Mein Rehte Hain _Anuradha Paudwal,Kumar Sanu _Anil Kapoor,Kajol</video:title>
      <video:description>Chhup Gaya Full Song _ Hum Aapke Dil Mein Rehte Hain _Anuradha Paudwal,Kumar Sanu _Anil Kapoor,Kajol-1080.mp4 #ChhupGayaFullSong_HumAapkeDilMeinRehteHain_AnuradhaPaudwal #KumarSanu_AnilKapoor #Kajol-1080mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474528/3474528_720p.mp4</video:content_loc>
      <video:duration>360</video:duration>
      <video:publication_date>2026-09-21T10:51:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju warna warni yang mantap</video:title>
      <video:description>#Fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474527/3474527_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T10:50:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sungai berbatu</video:title>
      <video:description>#Sungai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474526/3474526_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T10:50:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caxito, com Zedu Kiss pai dos kandondo</video:title>
      <video:description>O kuduro agradece! A qui e numa das província de Angola 🇦🇴 #ViagemFrança</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474525/3474525_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-21T10:50:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Girls Twerking Big Bouncing Girls Twerking</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #twerking #citygirlstwerk #twerkcitygirls #labontatwerking #speedbarbadostwerking #girls #ishowspeedfirsttwerkingdance #femaletwerkinginsoccergame #femalefootballtwerking #womentwerkinginfootballmatch #citygirls #labontaasoccergametwerking #citygirls2018 #labontatwerkingdancingvsangelcity #citygirlsyoutube #youtubecitygirls #citygirlsmusicvideo #citygirlsofficialmusicvideo #womenfootballtweaking #twerk #twerksongs #twerker #hottesttwerk #hottwerk #besttwerkmusic #twerkchallenge #twerksongs2017</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474524/3474524_720p.mp4</video:content_loc>
      <video:duration>599</video:duration>
      <video:publication_date>2026-09-21T10:49:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kaho Naa Pyaar Hai _ Hrithik Roshan &amp; Ameesha Patel _ Kumar Sanu</video:title>
      <video:description>Chand Sitare Phool Aur Khushboo❤️ _ Kaho Naa Pyaar Hai _ Hrithik Roshan &amp; Ameesha Patel _ Kumar Sanu-1080.mp4 #ChandSitarePhoolAurKhushboo❤️_KahoNaaPyaarHai_HrithikRoshanAmeeshaPatel_KumarSanu-1080mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474523/3474523_720p.mp4</video:content_loc>
      <video:duration>322</video:duration>
      <video:publication_date>2026-09-21T10:49:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kreasi nan indah</video:title>
      <video:description>Video ini hanya fantasi ilustrasi halusinasi tentang keindahan maya #Indahnyakreasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474522/3474522_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T10:49:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>真人线上游戏娱乐🔗sts5626.com</video:title>
      <video:description>真人在线娱乐，现场直播真人体育 真人游戏🔗235322.com 联系钉钉@sts996 #线上游戏，真人体育</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474521/3474521_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T10:49:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lágrimas 2</video:title>
      <video:description>Muita gente chorar Eles lamentá</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474520/3474520_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T10:48:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mujhse Dosti Karoge _ Hrithik Roshan, Kareena Kapoor,</video:title>
      <video:description>Andekhi Anjaani _ Full Song _ Mujhse Dosti Karoge _ Hrithik Roshan, Kareena Kapoor, Rani Mukerji-1080.mp4 #AndekhiAnjaani_FullSong_MujhseDostiKaroge_HrithikRoshan #KareenaKapoor #RaniMukerji-1080mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474519/3474519_720p.mp4</video:content_loc>
      <video:duration>373</video:duration>
      <video:publication_date>2026-09-21T10:48:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>In_Your_Dreams_(2025)_Hindi_Dubbed_Movie</video:title>
      <video:description>hope u like watching it so, enjoy and suggest if you want me to upload any other movie #cartoonmovies</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474518/3474518_720p.mp4</video:content_loc>
      <video:duration>5473</video:duration>
      <video:publication_date>2026-09-21T10:47:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Justifiable Defense (2025) Episode 1 Eng Sub</video:title>
      <video:description>Justifiable Defense (2025) - CHINESE DRAMA Senior prosecutor Duan Hong Shan from the city prosecutor&apos;s office is handling a case involving a &quot;woman who killed her husband due to domestic violence.&quot; Young prosecutor Fang Ling Yuan from the provincial prosecutor&apos;s office is assigned to assist in the investigation. During the process of handling the case, they discovered a connection between it and the &quot;excessive self-defense on campus&quot; incident experienced by Li Mu Feng, Mei Zheng, and Jiang Ting, which Duan Hong Shan handled fourteen years ago. Grounded in facts and guided by the law, the two prosecutors, considering &quot;natural justice, human sentiment, and national law,&quot; ultimately provide a definitive resolution to the case. Justifiable Defense, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #JustifiableDefense #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474517/3474517_720p.mp4</video:content_loc>
      <video:duration>2231</video:duration>
      <video:publication_date>2026-09-21T10:46:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>IN BETWEEN 2 BREAKFAST</video:title>
      <video:description>He woke up this morning and behold him was two breakfast served before him, a pretty woman dancing so sexy before him and a served meal. Which one should he go for as a wise and smart guy? Let’s find out » and I’m sure this will make your day!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474516/3474516_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T10:46:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Bona Fide Killer (2026) Episode 9 Eng Sub</video:title>
      <video:description>A Bona Fide Killer (2026) - KOREAN DRAMA Yoo Bo Na appears to be an ordinary working mother in her 30s, juggling family life with her husband and daughter. But behind her everyday facade, she is &quot;Kingfisher,&quot; a legendary sniper who hunts down ruthless criminals that have escaped the law. After returning from a three-year childcare leave, Bo Na resumes her dangerous double life, struggling to balance motherhood, marriage, and her deadly mission. As her investigative journalist husband Kwon Tae Seong unknowingly inches closer to discovering Kingfisher&apos;s true identity, and determined detective Lee Dong Jin relentlessly pursues the elusive vigilante, Bo Na finds herself trapped between family, justice, and survival. With the help of her loyal ally Kim Bong Pal, she must navigate a world where one mistake could destroy both her secret life and the family she cherishes. A Bona Fide Killer, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, koreandrama, dramakorean, koreanromance, romancekorean, movie, moviekorean, koreanmovie #ABonaFideKiller #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #koreandrama #dramakorean #koreanromance #romancekorean #movie #moviekorean #koreanmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474515/3474515_720p.mp4</video:content_loc>
      <video:duration>3958</video:duration>
      <video:publication_date>2026-09-21T10:46:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 5 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 5 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474514/3474514_720p.mp4</video:content_loc>
      <video:duration>4403</video:duration>
      <video:publication_date>2026-09-21T10:46:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>جواهردوزی 2</video:title>
      <video:description>کارهای هنری من را ببینید #جواهردوزی</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474513/3474513_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T10:45:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>দিনের জন্য তৈরি হই 👕🎒 | বাংলা শিশুদের গান | Bengali Nursery Rhymes | Lili Kids World</video:title>
      <video:description>🌞 দিনের জন্য তৈরি হই! 🎒 লিলি, রিকু, বানি আর টেডির সঙ্গে গেয়ে ওঠো একটি মজার ও আনন্দের বাংলা শিশুদের গান! এই গানে শিশুরা সকালে ঘুম থেকে ওঠা, তৈরি হওয়া, জুতো পরা, ব্যাগ নেওয়া এবং হাসি-খুশি মনে নতুন দিন শুরু করার মতো সহজ দৈনন্দিন কাজ শিখতে পারবে। 👕👟🎒 মজার সুর ও রঙিন অ্যানিমেশনের মাধ্যমে ছোট্ট শিশুদের জন্য দৈনন্দিন রুটিন শেখাকে আরও আনন্দদায়ক করে তোলা হয়েছে। 🌈🎵 🎵 গানের নাম: দিনের জন্য তৈরি হই 🌈 চ্যানেল: Lili Kids World 👧 লিলি • 👦 রিকু • 🐰 বানি • 🧸 টেডি এই ভিডিওটি উপযোগী: ছোট শিশুদের জন্য বাংলা গান প্রি-স্কুল শিশুদের গান সকালের দৈনন্দিন রুটিন তৈরি হওয়ার রুটিন শিশুদের শেখার গান বাংলা নার্সারি রাইমস শিশুদের মজার গান ও ছড়া এমন আরও সুন্দর শিশুদের গান, ছড়া ও শেখার ভিডিও দেখতে Lili Kids World-এ Subscribe করুন। ❤️🌈 শিখি • গাই • হাসি! #দিনেরজন্যতৈরিহইবাংলা #শিশুদেরগানবাংলা #বাচ্চাদেরগানবাংলা #নার্সারিরাইমসবাংলাছড়া #শিশুদেরগান #বাচ্চাদেরগান #শিশুদেরমজারগান #বাংলাশিক্ষামূলকগান #বাচ্চাদেরশেখারগান #সকালেররুটিন #সকালেরগান #শিশুদেরজন্যতৈরিহওয়ারগান #স্কুলেরপ্রস্তুতিরগান #প্রিস্কুলবাংলাগান #ছোটদেরবাংলাগান #Bengalikidssongs #Bengalinursery #rhymesBengali #songsfortoddlers #Bengalipreschoolsongs #kidslearningsongs #Bengalimorningroutinesong #BengaliLiliKidsWorld #LiliKidsWorldBengali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474512/3474512_720p.mp4</video:content_loc>
      <video:duration>122</video:duration>
      <video:publication_date>2026-09-21T10:45:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Olahraga di tempat yang nyaman</video:title>
      <video:description>#Olahraga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474511/3474511_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T10:44:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The floor is wet</video:title>
      <video:description>The floor is wet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474510/3474510_720p.mp4</video:content_loc>
      <video:duration>284</video:duration>
      <video:publication_date>2026-09-21T10:44:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story 136</video:title>
      <video:description>Bantu suport tanks #Afrika #paris #as</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474509/3474509_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T10:44:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LEO_2023_English_Full_Movie</video:title>
      <video:description>hope u like watching it so, enjoy and suggest if you want me to upload any other movie #movies</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474508/3474508_720p.mp4</video:content_loc>
      <video:duration>9695</video:duration>
      <video:publication_date>2026-09-21T10:43:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A shop for killers ep 2 Hindi dubbed</video:title>
      <video:description>A shop for killers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474507/3474507_720p.mp4</video:content_loc>
      <video:duration>3213</video:duration>
      <video:publication_date>2026-09-21T10:43:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>金沙娱乐线上体育 游戏🔗235322.com</video:title>
      <video:description>金沙娱乐线上体育 真人体育🔗235322.com 联系✈️@qingnin996 #金沙娱乐</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474506/3474506_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T10:42:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 669</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE GARDEN PART 669 #HOST #AMERIKA #BEAUTIFUL #SEXY #GARDEN #PART669</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474505/3474505_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T10:42:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Decorative pot for plants</video:title>
      <video:description>Decorative pot for plants #decorativepot #useful #gadget #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474504/3474504_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T10:40:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ketika hp bapak rusak</video:title>
      <video:description>#Ketikapulangsekolah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474503/3474503_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-21T10:40:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ab Tere Dil Mein Hum Aa Gaye</video:title>
      <video:description>Ab Tere Dil Mein Hum Aa Gaye -4K _ Kumar Sanu, Alka Yagnik _ Akshay Kumar, Madhuri Dixit _ Aarzoo-1088.mp4 #AbTereDilMeinHumAaGaye-4K_KumarSanu #AlkaYagnik_AkshayKumar #MadhuriDixit_Aarzoo-1088mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474502/3474502_720p.mp4</video:content_loc>
      <video:duration>387</video:duration>
      <video:publication_date>2026-09-21T10:40:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Letoke</video:title>
      <video:description>Dance viral tiktok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474500/3474500_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T10:40:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 668</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE GARDEN PART 668 #HOST #AMERIKA #BEAUTIFUL #SEXY #GARDEN #PART668</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474499/3474499_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T10:39:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Salmos 68.18 / Psalm 68:18 / Psaumes 68.18 / Salmos 68:18 / 詩篇 68:18 Shīpiān 68:18</video:title>
      <video:description>Neste vídeo, lembramos as promessas do Senhor Ele as cumpre e da dons aos homens. In this video, we recall the Lord&apos;s promises; He fulfills them and gives gifts to men. Dans cette vidéo, nous rappelons les promesses du Seigneur : Il les accomplit et fait des dons aux hommes. En este video recordamos las promesas del Señor: Él las cumple y da dones a los hombres. 在這段影片中，我們重溫主的應許；祂必成就這些應許，並將恩賜給世人。 Zài zhè duàn yǐngpiàn zhōng, wǒmen chóng wēn zhǔ de yīngxǔ; tā bì chéngjiù zhèxiē yīngxǔ, bìng jiāng ēncì gěi shìrén. #oSenhorsubiuaoalto #oSenhordardons #oSenhorreina #oSenhoréSoberano #oSenhoréinegualável #oSenhortriunfa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474498/3474498_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T10:39:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ketika orang kaya berantem w</video:title>
      <video:description>#Ketikaorangkayaberantemw</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474497/3474497_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T10:38:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>murid cewe kalo jadi ketua kelas</video:title>
      <video:description>#muridcewekalojadiketuakelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474496/3474496_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T10:38:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mohabbatein _ Shah Rukh Khan</video:title>
      <video:description>Aankhein Khuli Song _ Mohabbatein _ Shah Rukh Khan, Aishwarya Rai _ Lata Mangeshkar, Udit Narayan-1080.mp4 #AankheinKhuliSong_Mohabbatein_ShahRukhKhan #AishwaryaRai_LataMangeshkar #UditNarayan-1080mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474495/3474495_720p.mp4</video:content_loc>
      <video:duration>536</video:duration>
      <video:publication_date>2026-09-21T10:37:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>圣淘沙娱乐，线上体育游戏</video:title>
      <video:description>圣淘沙娱乐，线上体育游戏 #圣淘沙娱乐，线上体育游戏</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474494/3474494_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T10:37:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MS FURNITURE</video:title>
      <video:description>Munshi #MSFURNITURE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474493/3474493_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-21T10:37:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Because Its All For You (2026) Episode 3 Eng Sub</video:title>
      <video:description>Because Its All For You (2026) JAPAN DRAMA In the middle of her wedding reception, at the very height of happiness, the bride, Sayaka, is poisoned by someone. According to Sakuraba, the photographer who was at the wedding, it appears that poison had been mixed into the champagne. Could it be that the culprit is among the guests who attended the wedding?! The groom, Hayashida Kazuomi, and Sakuraba set out to find the perpetrator, but one after another, the hypocrisy of the suspects, including Sayaka’s best friend and her mother, comes to light… And then, glimpses of Sayaka’s pitch-black past begin to surface as well…? Every single person who appears in this story is a “hypocrite,” and “shocking truths” are revealed one after another. Because Its All For You, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #BecauseItsAllForYou #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474492/3474492_720p.mp4</video:content_loc>
      <video:duration>1397</video:duration>
      <video:publication_date>2026-09-21T10:37:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ketika orang miskin berantem</video:title>
      <video:description>#Ketikaorangmiskinberantem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474491/3474491_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-21T10:37:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fairway Of Love (2026) Episode 3 Eng Sub</video:title>
      <video:description>Fairway Of Love (2026) Nana, the daughter of a golf course tycoon, is suddenly called back from studying fashion in Europe to save the business from crisis. There, she meets Pro Vee, a former skilled golf pro who is now the resident golf pro. Pro Vee is strict, demanding, and displeased that Nana knows nothing about golf, the sport she loves and is so dedicated to. The two must cooperate to save Nana&apos;s father&apos;s golf course, leading to a deep and romantic relationship. However, things aren&apos;t as simple as they should be. A major obstacle hindering Nana and Pro Vee&apos;s goals is Pro Jin, another highly skilled golf pro from a rival golf course. This often leads to verbal clashes with Belle, Nana&apos;s father&apos;s secretary, who is sent to assist and be Nana&apos;s right-hand woman. Fairway Of Love, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #FairwayOfLove #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474490/3474490_720p.mp4</video:content_loc>
      <video:duration>3257</video:duration>
      <video:publication_date>2026-09-21T10:37:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 667</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ON THE BEACH HAWAII PART 667 #HOST #AMERIKA #BEAUTIFUL #SEXY #BEACH #HAWAII #PART667</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474489/3474489_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-21T10:37:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tale of lady ok ep 4 Hindi dubbed</video:title>
      <video:description>The tale of lady ok episode 4 Hindi dubbed K-drama (season 1) #TheTaleofLadyOk #sageukkdrama #historicalkdrama #revengekdrama #femaleleadkdrama #LimJiYeon #Joseonkdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474488/3474488_720p.mp4</video:content_loc>
      <video:duration>5103</video:duration>
      <video:publication_date>2026-09-21T10:37:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A shop for killers ep 1 Hindi dubbed</video:title>
      <video:description>A shop for killers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474487/3474487_720p.mp4</video:content_loc>
      <video:duration>2969</video:duration>
      <video:publication_date>2026-09-21T10:36:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ketika orang kaya berantem</video:title>
      <video:description>#Ketikaorangkayaberantem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474486/3474486_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-21T10:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Massive Mutton Nalli Biryani Feast! 🍖 Juicy Lamb Shank</video:title>
      <video:description>Welcome to an incredible food Mukbang! In this video, I&apos;m devouring a massive platter of flavorful Biryani topped with tender Mutton Nalli (marrow shank), boiled eggs, naan, and refreshing raita. Watch the full video to experience the rich flavors and satisfying ASMR eating sounds! ​If you enjoyed this video, please LIKE, SHARE, and SUBSCRIBE for more mouth-watering food content! ❤️✨ #Massivemuttonnallibiryanimukbang​Juicymuttonshankeatingshow​ASMRmuttonbiryanieating​Muttonmarrowshankfeast​Viralfoodshortsmukbang​Bigplatterbiryanieatingchallenge</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474485/3474485_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T10:34:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474484</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474484/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>​FAÇA ESSA ORAÇÃO ANTES DE COMEÇAR O SEU DIA! 🙏🔥</video:title>
      <video:description>Não comece o seu dia sem antes falar com Deus! 🙏✨ ​Faça essa oração de gratidão e peça a proteção e a sabedoria divina para guiarem os seus passos durante o dia todo. ​💬 Comente &quot;AMÉM&quot; se você confia e entrega o seu dia nas mãos do Senhor! ✈️ Compartilhe com quem precisa ouvir essa mensagem de paz hoje. #reflexaocomdeus #deusnocomando #oraçãodamanhã #oracaododia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474484/3474484_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-21T10:33:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love love love 4</video:title>
      <video:description>It&apos;s good to love, love is good</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474483/3474483_720p.mp4</video:content_loc>
      <video:duration>161</video:duration>
      <video:publication_date>2026-09-21T10:32:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nervoso e Kiss pai dos kandondo &amp; DJ Beijinhaproduz</video:title>
      <video:description>Estamos a fazer acontecer.. #Viagem #parís #França</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474482/3474482_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T10:32:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>圣淘沙娱乐，线上体育游戏🔗235322.com</video:title>
      <video:description>真人娱乐，体育足球 游戏🔗sts5626.com 联系✈️@qingnin996 #圣淘沙娱乐平台</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474481/3474481_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T10:31:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>آ ستانہ عالیہ کھریپڑ شریف حبیب اباد</video:title>
      <video:description>آ ستانہ عالیہ کھریپڑ شریف حبیب آبا د #آستانہعالیہکھریپڑشریفحبیبآباد</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474480/3474480_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T10:31:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CLIP] a day in my life gay viral</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474479/3474479_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:31:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474478</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474478/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Listening to music 2</video:title>
      <video:description>This video contains an old man who is enjoying listening to music. #Musik #song #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474478/3474478_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T10:31:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>day in my life bareng abang dikosan edisi libur sekolah</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474477/3474477_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T10:31:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>a day in my life  zaefier part 3</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474476/3474476_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T10:31:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>a day in my live yg lagi viral nih part 4</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474475/3474475_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T10:31:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A day in my life Gay viral</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474473/3474473_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T10:31:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>a day in my life gay viral video twitter 2</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474472/3474472_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T10:31:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>a day in my life gay viral video twitter</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474471/3474471_720p.mp4</video:content_loc>
      <video:duration>102</video:duration>
      <video:publication_date>2026-09-21T10:31:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>a day in my life lagi viral</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474470/3474470_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-21T10:31:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FULL a day in my life viral</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474469/3474469_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T10:31:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hanya video a day in my life</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474468/3474468_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:31:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474467</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474467/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bro ada yg punya video full &quot;A day in my life&quot; Kah?</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474467/3474467_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:30:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mushoku Tensei Ⅲ: Isekai Ittara Honki Dasu Episodes 13</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474465/3474465_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-09-21T10:29:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It’s Okay to Not Be Okay (2020) | Hindi Dubbed K-Drama | Full Episode 1</video:title>
      <video:description>It’s Okay to Not Be Okay ek emotional romantic K-drama hai, jisme romance, healing, mystery aur family drama ka perfect combination hai. Hindi dubbed episodes ke liye follow/subscribe karein aur naye episodes ke updates paate rahein. #ItsOkaytoNotBeOkayHindiDubbed #ItsOkaytoNotBeOkayHindi #KoreanDramaHindiDubbed #KDramaHindiDubbed #ItsOkaytoNotBeOkayFullEpisode #KimSooHyun #SeoYeJi #KoreanSeriesHindi #RomanticKDrama #EmotionalKDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474464/3474464_720p.mp4</video:content_loc>
      <video:duration>4485</video:duration>
      <video:publication_date>2026-09-21T10:29:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cara berpakaian</video:title>
      <video:description>#Berpakaian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474463/3474463_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T10:28:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The beautiful mermaid</video:title>
      <video:description>*The beautiful mermaid is hot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474462/3474462_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T10:28:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goyang asik 7</video:title>
      <video:description>#Bergoyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474461/3474461_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:28:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Música de Fernandinho</video:title>
      <video:description>Música de Fernandinho</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474460/3474460_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T10:27:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474459</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474459/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju pink mempesona</video:title>
      <video:description>#Mempesona</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474459/3474459_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T10:27:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474458</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474458/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata motivasi,semoga manfaat ✨</video:title>
      <video:description>Vibes pegunungan #Perjalanan #pegunungan #katakata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474458/3474458_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T10:27:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474457</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474457/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita cantik berpose</video:title>
      <video:description>#Berpise</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474457/3474457_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T10:26:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474456</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474456/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goodbye Friend.</video:title>
      <video:description>Goodbye Friend. Be careful on the way. #GoodbyeFriend</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474456/3474456_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T10:26:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474455</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474455/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Topi yang bagus</video:title>
      <video:description>#Topi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474455/3474455_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:26:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474454</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474454/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Velho da Porteira Que Entrava no Meu Quarto | Relato Assombroso</video:title>
      <video:description>Toda noite, um velho de chapéu de palha aparecia sentado na porteira do sítio. Meu pai ficou apavorado quando descobriu quem ele era: um homem morto havia trinta anos. Depois disso, o fantasma deixou de ficar lá fora e começou a surgir dentro do meu quarto. Essa é uma história de terror real, narrada em primeira pessoa, sobre um segredo de família enterrado debaixo de uma casa antiga no interior. Ninguém acreditou em mim, e até hoje eu não sei explicar tudo o que aconteceu naquele sítio. Se você gosta de relatos assombrosos e histórias inexplicáveis, se inscreve no canal, deixa seu like e comenta se já viveu algo parecido. Ative o sininho para não perder o próximo relato. #históriadeterror #terrorreal #relatoassombroso #aconteceucomigo #fatosverídicos #velhodaporteira #fantasma #casaantiga #históriasombria #terrornosítio #contosmacabros #relatossobrenaturais #presençanoquarto #históriasinexplicáveis #terrorrural</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474454/3474454_720p.mp4</video:content_loc>
      <video:duration>1560</video:duration>
      <video:publication_date>2026-09-21T10:26:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanita bergoyang</video:title>
      <video:description>#Bergoyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474453/3474453_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:25:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474452</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474452/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sekai Saikyou no Kouei Episodes 12</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474452/3474452_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-09-21T10:25:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474451</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474451/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gadis cantik 9</video:title>
      <video:description>#Gadiscantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474451/3474451_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:23:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474450</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474450/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantic weather🥰😘</video:title>
      <video:description>How&apos;s weather in your city? #travelusacanadafrance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474450/3474450_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T10:23:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer episode 3 Hindi dubbed K-drama</video:title>
      <video:description>Lawless lawyer episode 3 Hindi dubbed K-drama #Lawlesslawyer #Hindidubbed #K-drama #Action #Law #Romance #Thriller #comedy #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474449/3474449_720p.mp4</video:content_loc>
      <video:duration>3889</video:duration>
      <video:publication_date>2026-09-21T10:23:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rambut terurai</video:title>
      <video:description>#Rambutpanjang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474448/3474448_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T10:22:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuz or if you think of it, the</video:title>
      <video:description>&quot;Hey, he&apos;s just a course seller, right? #Hey #hesjustacourseseller #right</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474447/3474447_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-21T10:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474446</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474446/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Si putih yang cantik</video:title>
      <video:description>#Bajuputih</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474446/3474446_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T10:21:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dandelion in the Garden of Light 🌼✨</video:title>
      <video:description>A dandelion flower stands gracefully amid a sea of colorful lights, sparkling like fragments of stars. Each seed seems to carry a tiny light, drifting gently with the breeze and creating a magical, imaginative atmosphere. The delicate flower, combined with vibrant splashes of color against the dark background, evokes the feeling of a fantasy garden filled with hope and wonder.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474445/3474445_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:21:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baju renang</video:title>
      <video:description>#Bajurenang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474444/3474444_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T10:21:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Glowwithkaji very sexy dance video girl showing her back with dance move doing workout watch now.</video:title>
      <video:description>Glowwithkaji very sexy dance video girl showing her back with dance move doing workout watch now. #Glowwithkaji #very #sexy #dance #video #girl #showing #her #back #with #dancemove #doingworkout #watchnow #sex #fuck #xxx #xvideos #movies #clips #sexmovies #sexclips #supermodel #sexydance #hotgirl #beautifulsexydance #workout #sexybody #sexygirl #beautifulass #sexyass #wantdick #porn #pornvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474443/3474443_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T10:21:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Birds 🐦</video:title>
      <video:description>Nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474442/3474442_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T10:21:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 97</video:title>
      <video:description>Hiburan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474441/3474441_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T10:21:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gadis berkerudung 3</video:title>
      <video:description>#Fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474440/3474440_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:20:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um, but yeah, I don&apos;t buy as much</video:title>
      <video:description>10, 20k a week on clothes #10 #20kaweekonclothes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474439/3474439_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-21T10:20:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Si cantik bergoyang 2</video:title>
      <video:description>#Joget</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474438/3474438_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:20:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ini Dia Video A Day in My Life yang Lagi Viral,. Ramai di TikTok</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474437/3474437_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T10:20:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Day in My Life Goes Viral on TikTok 2</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474436/3474436_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T10:20:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Day in My Life Goes Viral on TikTok</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474435/3474435_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T10:20:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>queen mahik</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474434/3474434_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T10:20:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>[Official-VIDEO]™ a day in my life viral 2</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474433/3474433_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T10:20:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>[Official-VIDEO]™ a day in my life viral</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474432/3474432_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T10:20:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kimi no Koto ga Daidaidaidaidaisuki na 100-nin no Kanojo 3rd Season Episodes 12</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474431/3474431_720p.mp4</video:content_loc>
      <video:duration>1430</video:duration>
      <video:publication_date>2026-09-21T10:20:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video viral &quot;A Day in My Life&quot; karya Zaefier 3</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474430/3474430_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:20:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video viral &quot;A Day in My Life&quot; karya Zaefier 2</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474429/3474429_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:20:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video viral &quot;A Day in My Life&quot; karya Zaefier</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474428/3474428_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:20:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Day In My Life Viral Link</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474427/3474427_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A day in my life viral zaefier part 2</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474426/3474426_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T10:19:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Day In My Life Viral Tiktok Terbaru</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474425/3474425_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:19:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>[Full] day in my life viral zaefier</video:title>
      <video:description>A Day In My Life Viral Tiktok Terbaru✅ https://shorten.tv/Xg-MI #viral #link #video #terbaru #fyp #masukberandayoutube #viralvideo #mobilelegends #freefire #day in my life VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. Kasus ini kini dalam penanganan pihak kepolisian untuk proses lebih lanjut. VIDEO “A DAY IN MY LIFE” VIRAL, 2 PRIA DIAMANKAN Video yang memperlihatkan dua pria melakukan tindakan asusila di lahan terbuka di Desa Purasari, Kecamatan Leuwiliang, Kabupaten Bogor, viral di media sosial. Rekaman tersebut kemudian menjadi perhatian masyarakat dan ditindaklanjuti pihak kepolisian. Kasat Reskrim Polres Bogor AKP Anggi Eko Prasetyo membenarkan bahwa polisi telah mengamankan kedua pria yang terlihat dalam video tersebut. setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp Kedua Pelaku botyy di Video Viral &quot;A Day In My Life&quot; Disebut Telah Berhasil Ditangkap Tim Polres Bogor #zaefier setelah yang uwes yank kini terbitlah a day in my life gamau kalah #dayinmylife #viral #2cowok #masukberanda #fyp #kasirindomaret #kasircantik #indomaret #lylia #indomaretviral #coolmax #foryoupage #kasirviral #viralkasir #kasirindomaretviral #viralkasirindomaret #fyp #masukberanda Kasir indomaret blunder clmx Kakak dan keponakan bermain 1vs3🥰 #kasirindomaret #jejey #lylia #fyp #MLBB #4u #ffxml #keponakan #1vs3 #ponakan Ponakan 1 vs 3 yg la</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474424/3474424_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T10:19:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Double Coverage</video:title>
      <video:description>Connecticut, call 888-789-7777 or visit ccpg #Connecticut #call888-789-7777orvisitccpg</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474423/3474423_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T10:19:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny</video:title>
      <video:description>#Funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474422/3474422_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T10:18:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cycling 7</video:title>
      <video:description>#Cycling</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474421/3474421_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T10:18:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fidarabia 13</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474420/3474420_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T10:17:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kuroneko to Majo no Kyoushitsu Episodes 24</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474419/3474419_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-09-21T10:16:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer episode 2 Hindi dubbed K-drama</video:title>
      <video:description>Lawless lawyer episode 2 hindi dubbed K-drama #Lawlesslawyer #Hindidubbed #K-drama #Action #Law #Romance #Thriller #comedy #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474418/3474418_720p.mp4</video:content_loc>
      <video:duration>3737</video:duration>
      <video:publication_date>2026-09-21T10:14:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Old gen vs new gen</video:title>
      <video:description>Old gen vs new gen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474417/3474417_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T10:13:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kuda yang pintar</video:title>
      <video:description>#Kudapintar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474416/3474416_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T10:13:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474415</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474415/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tetsunabe no Jan! Episodes 12</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474415/3474415_720p.mp4</video:content_loc>
      <video:duration>1436</video:duration>
      <video:publication_date>2026-09-21T10:13:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 wanita cantik</video:title>
      <video:description>#Wanitacantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474414/3474414_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T10:12:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rok hitam manis</video:title>
      <video:description>#Rokhitam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474413/3474413_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T10:12:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bandara yang cantik</video:title>
      <video:description>#Bandara</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474412/3474412_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T10:11:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>APOLLO HAS FALLEN | Official Trailer | STUDIOCANAL</video:title>
      <video:description>APOLLO HAS FALLEN | Official Trailer | STUDIOCANAL #APOLLOHASFALLEN</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474411/3474411_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-21T10:11:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Suasana camping</video:title>
      <video:description>#Camping</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474410/3474410_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T10:10:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lawless lawyer episode 1 Hindi dubbed K-drama</video:title>
      <video:description>Lawless lawyer episode 1 Hindi dubbed K-drama #Lawlesslawyer #Hindidubbed #K-drama #Action #Law #Romance #Thriller #comedy #trending #Koreandramahindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474409/3474409_720p.mp4</video:content_loc>
      <video:duration>3823</video:duration>
      <video:publication_date>2026-09-21T10:10:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kolam renang 2</video:title>
      <video:description>#Kolamrenang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474408/3474408_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kaos oblong</video:title>
      <video:description>#Kaosoblong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474407/3474407_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T10:09:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ice Queen Beloved Captive Dove (2026) Eng Sub</video:title>
      <video:description>The Ice Queen Beloved Captive Dove (2026) Eng Sub The Ice Queen Beloved Captive Dove, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #TheIceQueenBelovedCaptiveDove #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474406/3474406_720p.mp4</video:content_loc>
      <video:duration>2592</video:duration>
      <video:publication_date>2026-09-21T10:09:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soul Land (Douluo Dalu) Season 1 Episode 21 English Subbed</video:title>
      <video:description>Soul Land (Douluo Dalu) Season 1 Episode 21 English Subbed #Tangsan #XiaoWu #DaiMuBai #Shrek #Douluo #Dalu #SoulLand #Donghua #Chinese #Anime #XiaoYan #Lindong #MuChen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474405/3474405_720p.mp4</video:content_loc>
      <video:duration>1267</video:duration>
      <video:publication_date>2026-09-21T10:09:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Because Its All For You (2026) Episode 2 Eng Sub</video:title>
      <video:description>Because Its All For You (2026) JAPAN DRAMA In the middle of her wedding reception, at the very height of happiness, the bride, Sayaka, is poisoned by someone. According to Sakuraba, the photographer who was at the wedding, it appears that poison had been mixed into the champagne. Could it be that the culprit is among the guests who attended the wedding?! The groom, Hayashida Kazuomi, and Sakuraba set out to find the perpetrator, but one after another, the hypocrisy of the suspects, including Sayaka’s best friend and her mother, comes to light… And then, glimpses of Sayaka’s pitch-black past begin to surface as well…? Every single person who appears in this story is a “hypocrite,” and “shocking truths” are revealed one after another. Because Its All For You, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #BecauseItsAllForYou #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474404/3474404_720p.mp4</video:content_loc>
      <video:duration>1392</video:duration>
      <video:publication_date>2026-09-21T10:08:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474403</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474403/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orgen Tunggal</video:title>
      <video:description>#OrgenTunggal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474403/3474403_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T10:08:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gubuk di pinggir sawah</video:title>
      <video:description>#Gubuk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474402/3474402_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T10:07:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Ganpati visarjan</video:title>
      <video:description>Ganpati visarjan mein sab log aap hamare Maharashtra mein jaate Hain India mein yah tyohar bahut dhumdham Se manate Hain please subscribe my channel. #DhanganGanpati</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474401/3474401_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T10:07:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>شہزاد نے اللہ کو حاضر ناظر رکھ کر عثمان کو اٹھ لاکھ روپے معاف کیے.mp4</video:title>
      <video:description>آپ کی فراہم کردہ تمام تفصیلات (شہزاد جٹ، عثمان، اور گواہ میاں طاہر کے فون نمبرز اور مقام) کو شامل کرتے ہوئے ڈسکرپشن، ہیش ٹیگز اور کمنٹ کا مکمل مسودہ تیار ہے۔ آپ اسے براہِ راست کاپی پیسٹ کر سکتے ہیں: ​1. ویڈیو کی ڈسکرپشن (Description) - کاپی پیسٹ کرنے کے لیے ​عنوان: عثمان کے 8 لاکھ روپے معاف کرنے کا اعلان - شہزاد جٹ | گواہ میاں طاہر (اچھرہ) ​تفصیل: بسم اللہ الرحمن الرحیم۔ اس ویڈیو میں آپ دیکھ سکتے ہیں کہ شہزاد جٹ صاحب نے اللہ کو حاضر و ناظر جان کر عثمان کے 8 لاکھ روپے مکمل طور پر معاف کر دیے ہیں۔ انسانیت، بھائی چارے اور معاف کرنے کی یہ ایک بہت ہی شاندار اور قابلِ تحسین مثال ہے۔ ​اس معاملے سے جڑے تمام افراد کی معلومات درج ذیل ہیں: ​🔹 معاف کرنے والے (شہزاد جٹ): 📞 فون نمبر: 03224720825 ​🔹 عثمان: 📞 فون نمبر: 03234823025 ​🔹 گواہ (میاں طاہر - اچھرہ): 📞 فون نمبر: 03214156572 ​اس ویڈیو کو زیادہ سے زیادہ لائک اور شیئر کریں تاکہ یہ نیک پیغام اور مثبت سوچ دوسروں تک بھی پہنچ سکے۔ شکریہ! ​2. بہترین ہیش ٹیگز (Hashtags) ​#ShahzadJutt #Usman #MiaTahir #IchhraLahore #FinancialForgiveness #HumanityFirst #ViralVideoPakistan #KindnessMatters #SocialGood #TrendingNow #03224720825 #03234823025 #03214156572 ​3. کمنٹ (Comment) کے لیے کاپی پیسٹ ٹیکسٹ ​&quot;ماشاءاللہ! شہزاد جٹ صاحب کا یہ فیصلہ دل کو چھو لینے والا اور انتہائی قابلِ ستائش ہے۔ اللہ کی رضا کے لیے اتنی بڑی رقم معاف کرنا ہر کسی کا کام نہیں۔ میاں طاہر صاحب اس کے گواہ ہیں۔ اللہ پاک شہزاد بھائی کے اس نیک عمل کو اپنی بارگاہ میں قبول فرمائے اور ان کے رزق میں بے پناہ برکت عطا فرمائے۔ آمین! 👏💯&quot; #آپکیفراہمکردہتمامتفصیلاتشہزادجٹ،عثمان،اورگواہمیاںطاہرکےفوننمبرزاورمقامکوشاملکرتےہوئےڈسکرپشن،ہیشٹیگزاورکمنٹکامکملمسودہتیارہے۔آپاسےبراہِراستکاپیپیسٹکرسکتےہیں​1ویڈیوکیڈسکرپشنDescription-کاپیپیسٹکرنےکےلیے​عنوانعثمانکے8لاکھروپےمعافکرنےکااعلان-شہزادجٹگواہمیاںطاہراچھرہ​تفصیلبسماللہالرحمنالرحیم۔اسویڈیومیںآپدیکھسکتےہیںکہشہزادجٹصاحبنےاللہکوحاضروناظرجانکرعثمانکے8لاک</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474400/3474400_720p.mp4</video:content_loc>
      <video:duration>175</video:duration>
      <video:publication_date>2026-09-21T10:06:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Peace 🕊️ 2</video:title>
      <video:description>No more hatred. No more tears. Let peace be the language of humanity... 🤍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474399/3474399_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:06:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Assim ,foi a sentada dos amigos! Angola 🇦🇴...</video:title>
      <video:description>Tudo pelo kuduro, um dia seremos lembrados na cultura Angolana 🇦🇴🙏 #Viagem #parís #França</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474398/3474398_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-09-21T10:05:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474397</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474397/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Dj Scratches with Drums  How to Mix at A Party Nonstop Dj mixing</video:title>
      <video:description>Click the link to convert your laptop into a pro dj controller #dj #nonstop #bestdj</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474397/3474397_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T10:05:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fyp _film _movie(MP4)</video:title>
      <video:description>fyp _film _movie(MP4 #sexy #usa #film</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474396/3474396_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T10:05:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hitman 2 Korean movie Hindi dubbed</video:title>
      <video:description>Hitman 2 Korean movie Hindi dubbed #Hitman2 #Koreanmovie #Hindidubbed #Action #Adventure #Thriller #Comedy #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474395/3474395_720p.mp4</video:content_loc>
      <video:duration>7107</video:duration>
      <video:publication_date>2026-09-21T10:05:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Messi 104</video:title>
      <video:description>Messi world cup performance #Football</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474394/3474394_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-21T10:04:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Water Bottle mic Performance😎</video:title>
      <video:description>No mic? Use a water bottle. 100% vibes, 0% shame 😂 #Anjay #FunnyBottlemic #Sunglassesguy #Viralcomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474393/3474393_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T10:04:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Extreme Helicopter Pool Jump | Photorealistic 3D Animation (10 Sec)</video:title>
      <video:description>Watch this jaw-dropping 10-second hyper-realistic 3D animation of an extreme stuntman diving from a hovering helicopter straight into a small swimming pool! Created with cutting-edge photorealistic AI rendering, every detail—from the wind physics to the water splash—looks 100% real. ​🚀 Tools Used: AI Video Generator / 3D Animation 🔔 Subscribe for more unreal high-action AI visual experiences! #3DAnimation #PhotorealisticAIVideo #HelicopterPoolJump #ExtremeStuntAnimation #HyperRealistic3D #UnrealEngine5render #AIGeneratedVideo #HighActionShortVideo #Cinematic3DAnimation #WaterSplashVFX</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474392/3474392_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T10:03:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bibir merah</video:title>
      <video:description>#Bibirmerah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474391/3474391_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:03:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ritmo e Alma ꒰⁠⑅⁠ᵕ⁠༚⁠ᵕ⁠꒱⁠˖⁠♡</video:title>
      <video:description>Tired of Being Tired #musicBlues</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474390/3474390_720p.mp4</video:content_loc>
      <video:duration>279</video:duration>
      <video:publication_date>2026-09-21T10:03:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😱 1HP Clutch_ 😈 Impossible Headshot 🔥 Free Fire Max Gameplay _ NatorX FF _shorts</video:title>
      <video:description>😱 1HP Clutch_ 😈 Impossible Headshot 🔥 Free Fire Max Gameplay _ NatorX FF _shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474389/3474389_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T10:03:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan yang indah 12</video:title>
      <video:description>#Pemandangan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474388/3474388_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T10:02:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAUDADES  DEMAIS!!</video:title>
      <video:description>Tanta saudade que não cabe no peito . É tão difícil viver sem ti ,diáriamente luto para seguir em frente sorrindo mas o meu coração chora em silêncio ,tantas coisa já aconteceram e eu não pude dividir contigo pessoalmente mas eu te contei tudo e ate sorri olhando para as estrelas porque sei que a que mais brilha quando olho és tu olhando aí de cima Amo-te para sempre #Amor #saudade #luto #perda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474387/3474387_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T10:02:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video 987</video:title>
      <video:description>Telegram channel link 👉👉 https://t.me/gjvdyibsd12/2178</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474386/3474386_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T10:01:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>healing 9</video:title>
      <video:description>healing, jalan jalan ke bukit #healing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474385/3474385_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T10:01:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Creative AS Letter Logo Design Tutorial | Step-by-Step Guide for Beginners</video:title>
      <video:description>#Logo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474384/3474384_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T10:01:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video 986</video:title>
      <video:description>Telegram channel link 👉👉👉https://t.me/gjvdyibsd12/2178</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474383/3474383_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T10:00:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474382</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474382/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O kuduro agradece..</video:title>
      <video:description>Ha vida do artista,e mesmo assim! Fé,foco; i determinação.. #Viagem #parís #França</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474382/3474382_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-21T10:00:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HP yang mantap</video:title>
      <video:description>#Hpbagus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474381/3474381_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T10:00:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Learning..Where are you going?</video:title>
      <video:description>HOW TO SAY?? -Where are you going? With 3 different countries language,, INDONESIA, PHILIPPINES AND PAPUA NEW GUINEA #LANGUAGE #CULTURE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474380/3474380_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T10:00:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rambut panjang</video:title>
      <video:description>#Rambutpanjang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474379/3474379_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T09:59:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pasangan yang romantis 2</video:title>
      <video:description>#Romantis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474378/3474378_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T09:58:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why is Alexandra Daddario known as the sexiest woman in America #fyp #usa #foryou #alexandradaddario</video:title>
      <video:description>Why is Alexandra Daddario known as the sexiest woman in America #fyp #usa #foryou #alexandradaddario #fyp #usa #foryou #alexandradaddario #sexy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474377/3474377_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-21T09:58:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474376</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474376/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Celana levis</video:title>
      <video:description>#Celanalevis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474376/3474376_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-21T09:57:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lemari ya bagus</video:title>
      <video:description>#Lemari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474375/3474375_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T09:56:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kate Sharma showing her sexy body looking super hot and sexy in swim dress showing her boobs and nip</video:title>
      <video:description>Kate Sharma showing her sexy body looking super hot and sexy in swim dress showing her boobs and nipples watch now. #KateSharma #showing #her #sexy #body #looking #super #hot #and #in #swim #dress #boobs #nipples #watchnow #sex #fuck #xxx #xvideos #porn #pornstar #sexvideos #sexmovies #sexclips #bollywoodsexyactress #songs #movies #likemendick #supersexyboobs #supersexypussy #beautifulnipples #videos #clips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474374/3474374_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T09:54:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Last Online Motorcycle Taxi Passenger</video:title>
      <video:description>The Last Online Motorcycle Taxi Passenger #HORROR #OnlineMotorcycle #OJOL #NIGHTMARE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474373/3474373_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-21T09:54:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474371</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474371/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>90s Super Hit Song 18</video:title>
      <video:description>Best movie Kabhi Khushi Kabhi Gham</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474371/3474371_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T09:51:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Girl 268</video:title>
      <video:description>So hot Look</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474369/3474369_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T09:50:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Get Stronger Abs With This Killer Routine</video:title>
      <video:description>Get ready to feel the burn! 🔥💪 This intense ab workout targets your core with powerful exercises designed to challenge your abs, build strength, and improve core stability. No complicated equipment needed—just bring your energy and push yourself through every move! 🔥 Keep your form controlled 💪 Stay consistent ⏱️ Follow the routine to the end 🏆 Feel stronger with every workout</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474368/3474368_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T09:49:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral Video Create</video:title>
      <video:description>💔_** *মানুষের সবচেয়ে বড় ক্ষতি মানুষই করে থাকে, যে যত বেশি আপন, তার দেওয়া আঘাত তত গভীর..!!🥹❤️‍🩹* #Viralreelsfebspotcreator</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474366/3474366_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T09:48:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ledies rose clothes 2</video:title>
      <video:description>Amazing ledies clothes #Ledies #cloths</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474365/3474365_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T09:48:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ritmo e Alma♥⁠╣⁠[⁠-⁠_⁠-⁠]⁠╠⁠♥</video:title>
      <video:description>Nem todos mundo é seu amigo #musicsong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474364/3474364_720p.mp4</video:content_loc>
      <video:duration>211</video:duration>
      <video:publication_date>2026-09-21T09:48:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to Get Rid of Under-Eye Bags Naturally?</video:title>
      <video:description>Watch this video and learn simple, practical ways to reduce the appearance of under-eye bags and puffiness. 👀✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474362/3474362_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T09:47:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Because Its All For You (2026) Episode 1 Eng Sub</video:title>
      <video:description>Because Its All For You (2026) JAPAN DRAMA In the middle of her wedding reception, at the very height of happiness, the bride, Sayaka, is poisoned by someone. According to Sakuraba, the photographer who was at the wedding, it appears that poison had been mixed into the champagne. Could it be that the culprit is among the guests who attended the wedding?! The groom, Hayashida Kazuomi, and Sakuraba set out to find the perpetrator, but one after another, the hypocrisy of the suspects, including Sayaka’s best friend and her mother, comes to light… And then, glimpses of Sayaka’s pitch-black past begin to surface as well…? Every single person who appears in this story is a “hypocrite,” and “shocking truths” are revealed one after another. Because Its All For You, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #BecauseItsAllForYou #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474361/3474361_720p.mp4</video:content_loc>
      <video:duration>1401</video:duration>
      <video:publication_date>2026-09-21T09:46:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Swimming Pool by the Sea</video:title>
      <video:description>Enjoy the ultimate luxury of a stunning swimming pool overlooking the sea. Experience breathtaking ocean views, modern design, and a relaxing tropical atmosphere. #SwimmingPool #LuxuryPool #OceanView #SeasideVilla #ModernLuxury #TropicalVilla #InfinityPool #DreamHome #LuxuryArchitecture #PoolDesign #BeachHouse #ModernVilla #HomeInspiration #LuxuryLiving #CoastalLiving</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474360/3474360_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T09:45:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Mob Heiress And Her Teacher (2026) Eng Sub</video:title>
      <video:description>The Mob Heiress And Her Teacher (2026) Eng Sub The Mob Heiress And Her Teacher, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #TheMobHeiressAndHerTeacher #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474359/3474359_720p.mp4</video:content_loc>
      <video:duration>2270</video:duration>
      <video:publication_date>2026-09-21T09:45:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474358</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474358/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Plonga</video:title>
      <video:description>Plongo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474358/3474358_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T09:44:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>足球，真人视讯，真人体育游戏🔗sts5626.com</video:title>
      <video:description>金鳞体育，真人体育 娱乐🔗235322.com 联系✈️@qingnin996 #足球体育线上体育，真人实战</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474357/3474357_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T09:44:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juliet &amp; Juliet (2026) Episode 3 Eng Sub</video:title>
      <video:description>Juliet &amp; Juliet (2026) Blue, the only daughter of the Monchaitrakul household, moves to a provincial convent school where she meets Tokyo, the youngest daughter of Sia Po, a powerful local figure of the Khongpirum family. Love blossoms between them, but it&apos;s a forbidden love, as their long-feuding families are locked in a power struggle. When heirs of two feuding families become one another&apos;s first love, will it end in love or tragedy? Juliet &amp; Juliet, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #JulietJuliet #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474356/3474356_720p.mp4</video:content_loc>
      <video:duration>3138</video:duration>
      <video:publication_date>2026-09-21T09:44:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474355</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474355/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vinstc</video:title>
      <video:description>Vinfyijb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474355/3474355_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T09:43:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>মাজার শরীফ</video:title>
      <video:description>মাজার শরীফ</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474354/3474354_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T09:43:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exploring the Beauty of South Sulawesi, Indonesia 🇮🇩</video:title>
      <video:description>A travel video exploring various interesting places in South Sulawesi, Indonesia. During this journey, I enjoyed beautiful landscapes, beach scenery, ocean views, and memorable experiences while exploring different areas of South Sulawesi. A journey to discover the beauty of Indonesia and capture memorable moments along the way. #SouthSulawesiIndonesiaSulawesiSelatanTravelTravelVlogIndonesiaTravelExploreIndonesiaSouthSulawesiTravelWisataIndonesiaWisataSulawesiTravelIndonesiaExploreSouthSulawesiBeachNatureAdventureHolidayTourismExploreTravelPhotographyBeautifulIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474353/3474353_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T09:42:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why is Angelina Jolie regarded as the sexiest action star in Hollywood#fyp #usa #foryou #angelinajol</video:title>
      <video:description>Why is Angelina Jolie regarded as the sexiest action star in Hollywood#tiktok #fyp #usa #foryou #angelinajolie #fyp #usa #foryou #angelinajolie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474352/3474352_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-21T09:41:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIY Flowers</video:title>
      <video:description>Tulilps Flowers Tutorial #DIYCraft</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474351/3474351_720p.mp4</video:content_loc>
      <video:duration>111</video:duration>
      <video:publication_date>2026-09-21T09:41:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tensura-sion</video:title>
      <video:description>#tensura #sion #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474350/3474350_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-09-21T09:40:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>siang kakak</video:title>
      <video:description>cewek cantiikkk #cewekbatik #cewekcantik #cewekmanis #cute</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474349/3474349_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T09:40:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>withdrawal</video:title>
      <video:description>withdrawal that four free YouTube viewings can be paid #watchYouTubeforfree #watchYouTubepaidindollars #watchYouTubefor15seconds</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474348/3474348_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-21T09:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BATTLE BETWEEN ANTS AND SCORPION</video:title>
      <video:description>War between Ants and scorpions</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474347/3474347_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T09:39:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474346</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474346/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours Episode 4 English Subtitles Korean Drama 2026</video:title>
      <video:description>Other name: 너 말고 다른 연애 Description: A realistic and relatable romance that depicts the emotional waves and fractures in relationships experienced by long-time lovers standing at the crossroads of marriage as they unexpectedly encounter new people. The honest and intense emotions of four men and women, a couple who have been together for over ten years and the new individuals who suddenly appear in their lives intersect delicately throughout the story. Namgung Ho, an office worker who becomes entangled in an unexpected emotional whirlwind after confronting the wavering feelings of the lover he cherishes, makes a bold proposal. Lee Mi Do shines the brightest on film sets. Even with a bare face and a shabby T-shirt, her stunning figure can’t be hidden. When she frowns and gets angry, her charisma explodes, even becoming more sensual. She has a boyfriend, but she’s thrown into confusion after meeting a new love interest. (Source: Korean = Naver || Translation = MyDramaList) Native Title: 너 말고 다른 연애 Also Known As: Neo Malgo Dareun Yeonae , Not You, Another Love Country: Korean Status: Ongoing Released: 2026 Genre: Drama, melodrama, Romance #Othername너말고다른연애DescriptionArealisticandrelatableromancethatdepictstheemotionalwavesandfracturesinrelationshipsexperiencedbylong-timeloversstandingatthecrossroadsofmarriageastheyunexpectedlyencounternewpeopleThehonestandintenseemotionsoffourmenandwomen #acouplewhohavebeentogetherforovertenyearsandthenewindividualswhosuddenlyappearintheirlivesintersectdelicatelythroughoutthestoryNamgungHo #anofficeworkerwhobecomesentangledinanunexpectedemotionalwhirlwindafterconfrontingthewaveringfeelingsoftheloverhecherishes #makesaboldproposalLeeMiDoshinesthebrightestonfilmsetsEvenwithabarefaceandashabbyT-shirt #herstunningfigurecan’tbehiddenWhenshefrown</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474346/3474346_720p.mp4</video:content_loc>
      <video:duration>3881</video:duration>
      <video:publication_date>2026-09-21T09:38:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Four American female singers with the most attractors #nickiminaj #mileycyrus #fyp</video:title>
      <video:description>Four American female singers with the most attractors #nickiminaj #mileycyrus #fyp #usa #trending #nickiminaj #mileycyrus #fyp #usa #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474344/3474344_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-21T09:37:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fairway of Love Episode 3 English Subtitles Thailand Latest Romantic Drama</video:title>
      <video:description>Other name: รักออกรอบ Description: Nana, the daughter of a golf course tycoon, is suddenly called back from studying fashion in Europe to save the business from crisis. There, she meets Pro Vee, a former skilled golf pro who is now the resident golf pro. Pro Vee is strict, demanding, and displeased that Nana knows nothing about golf, the sport she loves and is so dedicated to. The two must cooperate to save Nana’s father’s golf course, leading to a deep and romantic relationship. However, things aren’t as simple as they should be. A major obstacle hindering Nana and Pro Vee’s goals is Pro Jin, another highly skilled golf pro from a rival golf course. This often leads to verbal clashes with Belle, Nana’s father’s secretary, who is sent to assist and be Nana’s right-hand woman. Native Title: รักออกรอบ Also Known As: Rak Ok Rop Country: Thailand Status: Ongoing Released: 2026 Genre: Comedy, Romance #OthernameรักออกรอบDescriptionNana #thedaughterofagolfcoursetycoon #issuddenlycalledbackfromstudyingfashioninEuropetosavethebusinessfromcrisisThere #shemeetsProVee #aformerskilledgolfprowhoisnowtheresidentgolfproProVeeisstrict #demanding #anddispleasedthatNanaknowsnothingaboutgolf #thesportshelovesandissodedicatedtoThetwomustcooperatetosaveNana’sfather’sgolfcourse #leadingtoadeepandromanticrelationshipHowever #thingsaren’tassimpleastheyshouldbeAmajorobstaclehinderingNanaandProVee’sgoalsisProJin #anotherhighlyskilledgolfprofromarivalgolfcourseThisoftenleadstoverbalclasheswithBelle #Nana’sfather’ssecretary #whoissenttoassistandbeNana’sright-handwomanNativeTitleรักออกรอบAlsoKnownAsRakOkRopCountryThailandStatusOngoingReleased2026GenreComedy #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474343/3474343_720p.mp4</video:content_loc>
      <video:duration>3257</video:duration>
      <video:publication_date>2026-09-21T09:36:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474342</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474342/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>adian girl</video:title>
      <video:description>cewe asia yang sedang berjoget #grils #dance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474342/3474342_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T09:36:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When You Left | Emotional Sad Song | Heartbreaking Love Song</video:title>
      <video:description>“When You Left” is an emotional sad song about losing someone you deeply loved and trying to live with the memories they left behind. A heartfelt song about loneliness, heartbreak, memories, and the pain of letting someone go. Listen with headphones and feel every emotion. If you enjoy emotional and sad songs, subscribe for more original music. #music #Englishsadsong #newsong2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474341/3474341_720p.mp4</video:content_loc>
      <video:duration>178</video:duration>
      <video:publication_date>2026-09-21T09:36:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Your Third the Series Episode 9 English Subtitles 2026 Drama Romantic Thailand</video:title>
      <video:description>Other name: ที่สามของเธอ Description: Jam is the right-hand man to Sib, a high-powered executive at a top-tier corporation. For the sake of career advancement, he goes above and beyond in his duties. His latest assignment is to locate and retrieve his artistic, angsty younger brother who has quite literally disappeared off the grid. Oh, and he has exactly two weeks to do it. Tracking down Sam is hard enough. Getting him to willingly return? Nearly impossible. Jam is this close to losing it. (Source: Meb) ~~ Adapted from the novel “Your Third” (ที่สามของเธอ) bu LAILA. Native Title: ที่สามของเธอ Also Known As: Thi Sam Khong Thoe Country: Thailand Status: Ongoing Released: 2026 Genre: Comedy, Drama, Romance #YourThirdtheSeriesEpisode9EnglishSubtitles2026DramaRomanticThailand</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474340/3474340_720p.mp4</video:content_loc>
      <video:duration>2789</video:duration>
      <video:publication_date>2026-09-21T09:35:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Push up 5</video:title>
      <video:description>This push-up workout designed for yourself #Gymwomengirlspush-up</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474339/3474339_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T09:34:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Duty First Kiss Later Episode 9  English Subtitles Latest Series 2026 Japanese</video:title>
      <video:description>Other name: キスは捜査のあとで Description: Takoi is a kindhearted, unmarried detective in his forties assigned to the Criminal Affairs Division of the peaceful, semi-rural Yamanomichi Police Station. A non-career officer, he is well-loved by people of all ages in the local community. Constantly at odds with him is Shiono, a handsome junior officer in his twenties from the Community Safety Division who is on the fast-track career path. The two clash over the smallest things every day, and to make matters worse, they are also neighbors in the police dormitory. Just when their relationship seems destined to remain a nightmare, everything changes after Takoi is unexpectedly set up on a marriage meeting. (Source: Japanese = cmoa.jp || Translation = MyDramaList) ~~ Adapted from the web manga “Kiss wa Sosa no Ato de” (キスは捜査のあとで) by Su (すう). Native Title: キスは捜査のあとで Also Known As: Kiss wa Sosa no Ato de , Kisu wa Sousa no Ato de Country: Japanese Status: Ongoing Released: 2026 Genre: Comedy, Romance #DutyFirstKissLaterEpisode9EnglishSubtitlesLatestSeries2026Japanese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474338/3474338_720p.mp4</video:content_loc>
      <video:duration>1369</video:duration>
      <video:publication_date>2026-09-21T09:33:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>On My Own Hustle | Dark Motivational Reel</video:title>
      <video:description>I&apos;m on my own hustle. I don&apos;t care what society says—I ain&apos;t ever stoppin&apos;. Keep grinding in silence and let your success speak. ​💬 Comment &quot;UNSTOPPABLE&quot; if you&apos;re building your own path! 🔔 Subscribe/Follow for more daily dark motivational content. #GrindSetAttitudeStatusMotivationShortsReels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474337/3474337_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T09:33:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tom Thinks He’s Won… Then THIS Happens! 😂💥 | Tom &amp; Jerry</video:title>
      <video:description>Tom gets confident during another confrontation, but celebrating early is rarely a good idea in the Tom &amp; Jerry universe! 🐱😂 Watch the situation flip in seconds and deliver another exaggerated cartoon payoff. 😂💥 TOM CELEBRATED WAY TOO EARLY! Just wait for the moment everything turns against him! 🚨🐱 TOM THINKS HE FINALLY WON! 😂 That confident smile says everything. But there’s one rule Tom should know by now: NEVER celebrate too early! 🤣 Seconds later... 💥 TOTAL DISASTER. 👇 Did you see it coming? Tom becomes confident that things are finally going his way, only for the situation to turn against him in classic slapstick fashion. #TomAndJerryTomCatJerryMouseTomFunnyCartoonFailFunnyCartoonCartoonComedyClassicCartoonsSlapstickComedyFunnyVideosCartoonClipsWatchTillEnd</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474336/3474336_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T09:32:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATE24 The Border Episode 8 English Subtitles Latest Series 2026 Japanese</video:title>
      <video:description>Other name: 大空港～GATE24～ Description: Smuggling, forged passports, human trafficking, terrorism—international crime is becoming increasingly sophisticated and severe. Standing as the nation’s final line of defense against such threats are airport Immigration and Customs, which work to stop them at the border. In recent years, the number of foreign visitors to Japan has surged, placing unprecedented strain on airport operations. To enable faster and more coordinated responses, a special unit reporting directly to the Cabinet Secretariat is established, eliminating traditional bureaucratic barriers. Its name is GATE24 (Global Airport Task Enforcement). However, reality falls far short of the grand vision. With airport operations divided among numerous government agencies, GATE24 struggles to gain cooperation from other departments and is often treated as an unwanted burden by frontline staff. To make matters worse, the unit is assigned to a small inspection booth located far from the main gates, handling mostly charter and small aircraft flights. Its position is little more than that of a “reserve team” for airport inspections. Despite these challenges, GATE24 begins its mission. As its members clash over laws, regulations, and human concerns while confronting complex cases at the border, they gradually overcome institutional barriers and grow into professionals standing on the front line of Japan’s borders. (Source: Japanese = TV Asahi || Translation = MyDramaList) Native Title: 大空港～GATE24～ Also Known As: Daikuko: GATE24 , Daikuukou: GATE24 , だいくうこう ゲートにじゅうよん Country: Japanese Status: Ongoing Released: 2026 Genre: Crime #GATE24TheBorderEpisode8EnglishSubtitlesLatestSeries2026Japanese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474335/3474335_720p.mp4</video:content_loc>
      <video:duration>2700</video:duration>
      <video:publication_date>2026-09-21T09:31:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stand up for Love Episode 14 (English Subtitles) 2026 Latest Chinese Drama</video:title>
      <video:description>Other name: 为爱正名 Description: Jiang Lai donates a kidney for love, only to be cruelly betrayed by the person she loves. She is even framed as “mentally unstable” and nearly killed to silence her. After narrowly escaping death, she changes her face and assumes the identity of Zhao Ke. Joining forces with the mysterious Zhao Mai, she returns and carefully sets one trap after another, turning the tables on those who wronged her. Amid intertwined love and hatred, she uncovers the long-buried truth and finally seeks the justice that has long been denied to her. (Source: Chinese = Tencent Video || Translation = MyDramaList) Native Title: 为爱正名 Also Known As: Love Is the Right Name , Wei Ai Zheng Ming , Yi Ai Zheng Ming , 以愛正名 , 以爱正名 , 為愛正名 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama, Romance #StandupforLoveEpisode14EnglishSubtitles2026LatestChineseDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474334/3474334_720p.mp4</video:content_loc>
      <video:duration>640</video:duration>
      <video:publication_date>2026-09-21T09:30:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stand up for Love Episode 13 (English Subtitles) 2026 Latest Chinese Drama</video:title>
      <video:description>Other name: 为爱正名 Description: Jiang Lai donates a kidney for love, only to be cruelly betrayed by the person she loves. She is even framed as “mentally unstable” and nearly killed to silence her. After narrowly escaping death, she changes her face and assumes the identity of Zhao Ke. Joining forces with the mysterious Zhao Mai, she returns and carefully sets one trap after another, turning the tables on those who wronged her. Amid intertwined love and hatred, she uncovers the long-buried truth and finally seeks the justice that has long been denied to her. (Source: Chinese = Tencent Video || Translation = MyDramaList) Native Title: 为爱正名 Also Known As: Love Is the Right Name , Wei Ai Zheng Ming , Yi Ai Zheng Ming , 以愛正名 , 以爱正名 , 為愛正名 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama, Romance #StandupforLoveEpisode13EnglishSubtitles2026LatestChineseDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474333/3474333_720p.mp4</video:content_loc>
      <video:duration>638</video:duration>
      <video:publication_date>2026-09-21T09:29:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Revenge From A Wife Episode 9 (English Subtitles) 2026 Latest Chinese Drama</video:title>
      <video:description>Other name: 妾本草芥 Description: After her husband is brutally murdered by a powerful consort, a grieving woman disguises herself as a physician and infiltrates the imperial city to build an intelligence network and seek revenge. Native Title: 妾本草芥 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #RevengeFromAWifeEpisode9EnglishSubtitles2026LatestChineseDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474331/3474331_720p.mp4</video:content_loc>
      <video:duration>508</video:duration>
      <video:publication_date>2026-09-21T09:28:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474330</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474330/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Moon This Beautiful, Real Or A Dream? 🌕✨</video:title>
      <video:description>Sometimes we forget how beautiful the moon really is 🌕✨ From a snowy village under the aurora, to a tropical coastal road under the galaxy... Which team are you? Team Snow or Team Beach? Comment below 👇 🎧 Use headphones for healing vibes #beautifulfullmoon #aestheticmoonscenery #supermoon4k #auroraborealisvillage #tropicalnightroad #galaxymoon #healingnightview #moonlightoverocean #snowyvillagenight</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474330/3474330_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T09:28:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Revenge From A Wife Episode 8 (English Subtitles) 2026 Latest Chinese Drama</video:title>
      <video:description>Other name: 妾本草芥 Description: After her husband is brutally murdered by a powerful consort, a grieving woman disguises herself as a physician and infiltrates the imperial city to build an intelligence network and seek revenge. Native Title: 妾本草芥 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #RevengeFromAWifeEpisode8EnglishSubtitles2026LatestChineseDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474329/3474329_720p.mp4</video:content_loc>
      <video:duration>439</video:duration>
      <video:publication_date>2026-09-21T09:28:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Revenge From A Wife Episode 7 (English Subtitles) 2026 Latest Chinese Drama</video:title>
      <video:description>Other name: 妾本草芥 Description: After her husband is brutally murdered by a powerful consort, a grieving woman disguises herself as a physician and infiltrates the imperial city to build an intelligence network and seek revenge. Native Title: 妾本草芥 Country: Chinese Status: Ongoing Released: 2026 Genre: Drama #RevengeFromAWifeEpisode7EnglishSubtitles2026LatestChineseDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474328/3474328_720p.mp4</video:content_loc>
      <video:duration>495</video:duration>
      <video:publication_date>2026-09-21T09:27:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rivals turned lovers marry couple (प्रतीद्वंधी बने प्रेमी शादी जोडा )</video:title>
      <video:description>Rivals turned lovers marry couple (प्रतीद्वंधी बने प्रेमी शादी जोडा ) #ChineseDrama #ChineseDramaHindiDubbed #Cdrama #CdramaHindiDubbed #HistoricalCdrama #FantasyCdrama #RomanticCdrama #Xianxia #ChineseFantasyDrama #CostumeDrama #HistoricalDrama #FantasyRomance #LoveStory #ImmortalLove #DemonGodDevilGod #TimeTravel #Reincarnation #SecondChanceLove #EnemiesToLovers #ForbiddenLove #Magic #Cultivation #HindiDubbedDrama #DramaInHindi #HindiDrama #TrendingCdrama #BestCdrama #AsianDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474327/3474327_720p.mp4</video:content_loc>
      <video:duration>3671</video:duration>
      <video:publication_date>2026-09-21T09:26:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Mad Monk Subdue Demons Episode 23 (English Subtitles) 2026 Latest Drama</video:title>
      <video:description>Other name: 济公之降龙除妖 Description: A wandering monk battling demons and supernatural chaos must confront an old love and his own attachments while striving to protect the mortal world. Native Title: 济公之降龙除妖 Also Known As: The Mad Monk: Subdue Demons of Dragon’s Fall Country: Chinese Status: Completed Released: 2026 Genre: Drama #TheMadMonkSubdueDemonsofDragonsFallEpisode23EnglishSubtitles2026LatestDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474326/3474326_720p.mp4</video:content_loc>
      <video:duration>1030</video:duration>
      <video:publication_date>2026-09-21T09:25:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Breastfeeding_twins_is_no_joke!!_Baaaabe!!_#breastfeeding_#twins_#momlife</video:title>
      <video:description>Breastfeeding_twins_is_no_joke!!_Baaaabe!!_#breastfeeding_#twins_#momlife #Travel #Paris #France #USA #Canada #UK #Earnings #music #cooking</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474325/3474325_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T09:25:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>keindahan gunung di indonesia</video:title>
      <video:description>lautan awan yang di ambil dari gunung prau #mountain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474324/3474324_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T09:25:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Parasites Heart Episode 5 (English Subtitles) 2026 Latest Netflix Drama Thailand</video:title>
      <video:description>Other name: หัวใจกาฝาก Description: Bound by an unexpected marriage, Hathaya and Ramil are outcasts in their families—but that won’t deter them from saving their kin to prove their worth. (Source: Netflix) ~~ Adapted from the novel “Wiman Sai” (วิมานทราย) by Chuwong Chayachinda (ชูวงศ์ ฉายะจินดา). Native Title: หัวใจกาฝาก Also Known As: Huachai Kafak , Huajai Kafak Country: Thailand Status: Ongoing Released: 2026 Genre: Drama, Romance #AParasitesHeartEpisode5EnglishSubtitles2026LatestDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474323/3474323_720p.mp4</video:content_loc>
      <video:duration>3091</video:duration>
      <video:publication_date>2026-09-21T09:24:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The last passenger of the night Taxi</video:title>
      <video:description>The last passenger of the night Taxi #horror #mystic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474322/3474322_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T09:24:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exciting action of bears with nanny grandfather</video:title>
      <video:description>bear with nanny grandfather playing together #bearandgrandfather</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474321/3474321_720p.mp4</video:content_loc>
      <video:duration>476</video:duration>
      <video:publication_date>2026-09-21T09:24:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>certainly chokary</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474320/3474320_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T09:23:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474319</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474319/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spadikam acting</video:title>
      <video:description>Spadikam acting entertainment please supporting #moviesactingSpadikam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474319/3474319_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T09:23:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>圣淘沙娱乐平台，乐鱼体育，国际足球线上体育🔗sts5626.com</video:title>
      <video:description>乐鱼体育 线上娱乐 🔗235322.com 联系 ✈️qingnin996 #乐鱼体育，线上娱乐</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474318/3474318_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-21T09:23:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>টিভিএস এ টাংকি</video:title>
      <video:description>টিভিএস এঅ্যাটাংকি</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474317/3474317_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T09:22:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Traveled through time and became an ordinary officer (टाइम ट्रेवल कर मामूली अफसर बना)</video:title>
      <video:description>टाइम ट्रेवल कर मामूली अफसर बना! मौत की धमकी मिली, आधुनिक तकनीक से लोहे का जहाज बनाया! - समय को पीछे ले जाना #ChineseDrama #ChineseDramaHindiDubbed #Cdrama #CdramaHindiDubbed #HistoricalCdrama #FantasyCdrama #RomanticCdrama #Xianxia #ChineseFantasyDrama #CostumeDrama #HistoricalDrama #FantasyRomance #LoveStory #ImmortalLove #DemonGodDevilGod #TimeTravel #Reincarnation #SecondChanceLove #EnemiesToLovers #ForbiddenLove #Magic #Cultivation #HindiDubbedDrama #DramaInHindi #HindiDrama #TrendingCdrama #BestCdrama #AsianDrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474316/3474316_720p.mp4</video:content_loc>
      <video:duration>4162</video:duration>
      <video:publication_date>2026-09-21T09:21:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jerry Meets an Adorable Tiny Mouse… Too Cute! 😂🐭❤️</video:title>
      <video:description>Jerry gets an unexpectedly adorable companion in this charming cartoon sequence! 🐭❤️ From playful interactions to tiny-mouse mischief, this clip brings a softer and funnier side to the classic animated world. 🐭❤️ JERRY ISN’T THE TINIEST MOUSE ANYMORE! This little character completely steals the scene! 🥹🐭 THIS MIGHT BE THE CUTEST JERRY MOMENT! ❤️ Jerry is already tiny... Then an even smaller mouse appears! 🐭 The interaction between these two is impossible not to smile at. 😊 👇 Rate the cuteness from 1–10! Jerry shares the scene with an adorable smaller mouse in a playful and charming classic cartoon moment. #TomAndJerryJerryMouseCuteMouseCuteCartoonAdorableAnimalsFunnyCartoonCartoonComedyClassicCartoonsJerryFunnyCartoonClipsAnimationCartoonNostalgia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474315/3474315_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T09:19:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comedy 355</video:title>
      <video:description>Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474314/3474314_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T09:19:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jerry Hides Right Under Tom’s Nose… Can Tom Find Him? 😂👀</video:title>
      <video:description>Jerry uses furniture and tiny hiding spaces to stay one step ahead while Tom searches the room! 🐭🐱😂 Watch the clever mouse sneak between tables, cabinets, and obstacles as another chase begins. 🤫🐭 DON’T MOVE, JERRY! Tom is WAY closer than he realizes! 😂 👀🐭 CAN YOU SPOT JERRY BEFORE TOM DOES? 😂 Jerry is hiding. Tom is searching. 🐱 And they’re much closer to each other than Tom realizes! One tiny movement and... THE CHASE IS ON! 🤣 👇 Did you spot Jerry immediately? Jerry uses tiny hiding spaces around the room to avoid Tom in another clever game of cartoon hide-and-seek. #TomAndJerryJerryMouseTomCatHideAndSeekJerryVsTomFunnyCartoonCartoonComedyClassicCartoonsJerryFunnyFunnyVideosCartoonClipsAnimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474313/3474313_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-21T09:18:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours . KDRAMA EPISODE 4 IN HINDI . 1080P RESOLUTION</video:title>
      <video:description>A love other than yours ep 4 . most romantic , cathoic and intence scene</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474312/3474312_720p.mp4</video:content_loc>
      <video:duration>3881</video:duration>
      <video:publication_date>2026-09-21T09:18:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Experience the adrenaline-pumping action of a helicopter-assisted police chase through the streets o</video:title>
      <video:description>#PoliceChaseHelicopterChaseLosAngelesLAPDNightLifeDroneFootageCityLightsUrbanDramaLAViewsActionFootageExploreLATravelCaliforniaInstaTravelDroneShotsNightViews</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474311/3474311_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T09:18:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474310</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474310/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crypto Market Pulse: Sept 21 Bull Run</video:title>
      <video:description>On September 21, 2026, the crypto market is heating up: Bitcoin holds strong above $81,800, showing resilience after weeks of volatility. Ethereum climbs nearly 3%, boosting DeFi momentum. Altcoins like NEAR (+17.5%) and Avalanche (+16.3%) are leading the charge, while Venom skyrocketed 76% in 24 hours. The Fear &amp; Greed Index sits at 70 (Greed), signaling bullish sentiment across traders. In this 8‑minute explainer, we break down today’s price action, highlight the top gainers and losers, and analyze what this bullish surge means for traders and long‑term investors. Stay tuned for insights that cut through the noise and help you ride the wave. #crypto</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474310/3474310_720p.mp4</video:content_loc>
      <video:duration>530</video:duration>
      <video:publication_date>2026-09-21T09:17:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jerry Finds a GIANT Hot Dog in the Desert! 😂🌭🐭</video:title>
      <video:description>Jerry’s outdoor adventure gets deliciously strange when a giant hot dog enters the picture! 🌭🐭😂 From racing across the landscape to an unexpected encounter with Tom, this colorful sequence delivers classic cartoon absurdity. 🌭😳 THAT HOT DOG IS ALMOST BIGGER THAN JERRY! And somehow Tom is involved too! 😂 🌭🐭 JERRY JUST FOUND THE BIGGEST SNACK OF HIS LIFE! 😂 Tiny mouse. GIANT hot dog. 🌭 And Tom isn&apos;t far away... 🐱 You already know Jerry isn&apos;t getting a peaceful meal! 🤣 👇 Could Jerry finish that whole thing? Jerry encounters an oversized hot dog during an outdoor adventure before Tom inevitably becomes part of the action. #TomAndJerryJerryMouseTomCatHotDogFunnyFoodCartoonAdventureFunnyCartoonCartoonComedyClassicCartoonsFunnyVideosCartoonClipsAnimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474309/3474309_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T09:16:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love U Lots Episode 6</video:title>
      <video:description>Love U Lots Episode 6 #LoveULotsEpisode6 #LOVEULOTS #FILIPINOMOVIES #MUSTWATCH #TRENDING #VIRALTODAY #FYP #PINOYMOVIES #TAGALOGMOVIES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474308/3474308_720p.mp4</video:content_loc>
      <video:duration>3965</video:duration>
      <video:publication_date>2026-09-21T09:15:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>彼女にはそれができるだろうか？</video:title>
      <video:description>ああ、一体何が起こるんだろう？</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474307/3474307_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-21T09:15:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sea and mountain</video:title>
      <video:description>cool atmosphere on the beach with grass green and lush trees #sea #nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474306/3474306_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T09:15:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>开云体育，线上体验sts5626.com</video:title>
      <video:description>开云体育，线上体验 极致享受 真人视讯🔗235322.com ✈️qingnin996 #线上体育，足球</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474305/3474305_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T09:14:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi S15E16 20th September 2026 Hindi 720p WEB-DL.</video:title>
      <video:description>Khatron Ke Khiladi Season 15 (Darr Ka Naya Daur) premiered on August 1, 2026, hosted by Rohit Shetty and filmed in Cape Town, featuring new and returning contestants facing intense stunts every Saturday and Sunday. #KhatronKeKhiladiS15</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474304/3474304_720p.mp4</video:content_loc>
      <video:duration>4376</video:duration>
      <video:publication_date>2026-09-21T09:13:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tom Works at a Restaurant… This Goes Hilariously Wrong! 😂🍽️</video:title>
      <video:description>Tom finds himself serving food alongside other cartoon characters, but keeping things professional isn&apos;t exactly his specialty! 🍽️🐱😂 Watch this restaurant scene turn into another entertaining comedy of mistakes. 🍽️😂 WHO HIRED TOM?! This restaurant shift is already heading toward complete disaster! 👨‍🍳🐱 TOM HAS A NEW JOB… WHAT COULD POSSIBLY GO WRONG? 😂 Customers? ✅ Food? ✅ Tom trying to behave professionally? That’s where things get complicated! 🤣 👇 Would you eat at a restaurant where Tom works? Tom takes on restaurant duties, but serving food and avoiding chaos prove to be two very different challenges. #TomAndJerryTomCatRestaurantComedyFoodComedyFunnyCartoonCartoonComedyClassicCartoonsTomFunnyFunnyVideosCartoonClipsAnimationFunnyMoments</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474303/3474303_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T09:13:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Os filhos de Angola 🇦🇴, o kuduro agradece</video:title>
      <video:description>Olha nós somos artista, músicos, o nosso dia dia foi assim!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474302/3474302_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-21T09:12:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Third Person (2026) Episode 2 Eng Sub</video:title>
      <video:description>Third Person (2026) Third Person, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #ThirdPerson #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474301/3474301_720p.mp4</video:content_loc>
      <video:duration>3284</video:duration>
      <video:publication_date>2026-09-21T09:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nature 47</video:title>
      <video:description>A relaxed and cool atmosphere in the countryside. #naturlovers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474300/3474300_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T09:11:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quotes 130</video:title>
      <video:description>Quotes #Quotes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474299/3474299_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-21T09:11:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m a hacker😱    (jokes)</video:title>
      <video:description>This is just a joke so don&apos;t take it seriously #Hackertermux</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474298/3474298_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T09:10:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>真人视讯，乐游体育，🔗sts5626.com</video:title>
      <video:description>真人线上直播如身临其境般 华纳娱乐平台🔗235322.com 联系✈️qingnin999 #华纳娱乐平台，</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474297/3474297_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T09:10:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lamine Yamal, wonderkids from spain</video:title>
      <video:description>Lamine Yamal, wonderkids from spain #sports #spain #football #lamineyamal #barcelona</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474296/3474296_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T09:10:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Engine machinery Cruise ship</video:title>
      <video:description>All engine located on this area #engineering</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474295/3474295_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T09:09:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Apple seeds remover</video:title>
      <video:description>Apple seeds remover #seedsremover #useful #gadget #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474294/3474294_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T09:08:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doa Pagi di Ujung Pematang</video:title>
      <video:description>Menikmati ketenangan pagi di tengah hamparan persawahan. Embun pagi, hijaunya tanaman padi, dan aktivitas para petani menjadi gambaran sederhana tentang kehidupan yang penuh perjuangan dan rasa syukur. Di balik setiap bulir padi, ada kerja keras, doa, dan harapan. Semoga setiap langkah para petani selalu diberikan kesehatan, rezeki yang berlimpah, dan hasil panen yang baik. 🙏🌾 #DoaPagi #Persawahan #Petani #Sawah #PemandanganAlam #SuasanaPedesaan #KehidupanDesa #PetaniIndonesia #KeindahanIndonesia #DuniaKita</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474293/3474293_720p.mp4</video:content_loc>
      <video:duration>221</video:duration>
      <video:publication_date>2026-09-21T09:08:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Raining 13</video:title>
      <video:description>Rainy Day #Rain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474292/3474292_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-21T09:08:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute cat kitten and puppy playing</video:title>
      <video:description>Cute cat kitten and puppy playing So fun video Must watch and Enjoy #Cutecat #kitten #puppy #viral #trending #funwith</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474291/3474291_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T09:07:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>West Coast</video:title>
      <video:description>New Grid extension #PowerSupply</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474290/3474290_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T09:07:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 You Won’t Believe What Happens Next! Funny Moments</video:title>
      <video:description>Sometimes the funniest moments happen when we least expect them! 😂 Watch these hilarious and unexpected moments and enjoy some good laughs. #unexpectedmoments #funnyvideo #funnymoments #hilariousvideo #comedy #funnyclips #viralmoments #humor #laugh #entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474289/3474289_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T09:07:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Candy 🍬 floor satisfying</video:title>
      <video:description>#satisfying ASMR video #ai floor satisfying</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474288/3474288_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T09:05:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi S15E15 19th September 2026 Hindi 720p WEB-DL</video:title>
      <video:description>Khatron Ke Khiladi Season 15 (Darr Ka Naya Daur) premiered on August 1, 2026, hosted by Rohit Shetty and filmed in Cape Town, featuring new and returning contestants facing intense stunts every Saturday and Sunday. #KhatronKeKhiladiS15</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474287/3474287_720p.mp4</video:content_loc>
      <video:duration>4464</video:duration>
      <video:publication_date>2026-09-21T09:05:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The blue wishper 13</video:title>
      <video:description>J unhi help ✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474286/3474286_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-21T09:05:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A caminhada</video:title>
      <video:description>Dias vão,dias vem! I tudo entreguemos nas mãos de Jeová #Viagem #parís #França #Portugal #Moçambique</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474284/3474284_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T09:05:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tom &amp; Jerry Get an EVICTION Notice?! Their Reaction Is Hilarious 😂🏠</video:title>
      <video:description>Tom and Jerry suddenly have a much bigger problem than their usual rivalry: a lease notice! 🏠🐱🐭😂 Watch the pair react as paperwork and household trouble create an unusual twist on their classic cartoon chaos. 📄😳 TOM &amp; JERRY JUST GOT SOME VERY BAD NEWS! Look at that notice… this changes EVERYTHING! 😂 🚨🏠 TOM &amp; JERRY HAVE A NEW PROBLEM… AND THEY CAN’T CHASE IT AWAY! 😂 Forget the cat-and-mouse battle for a second. There’s paperwork involved. 📄😳 And judging by their reactions... THIS IS SERIOUS! 🤣 👉 Watch how they deal with it! Tom and Jerry encounter an unexpected lease-related problem that adds a completely different kind of trouble to their household rivalry. #TomAndJerryTomCatJerryMouseFunnyCartoonCartoonComedyClassicCartoonsFunnyVideosCartoonHouseCartoonClipsFunnyMomentsAnimationCartoonNostalgia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474283/3474283_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T09:04:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strawberry 🍓 floor satisfying</video:title>
      <video:description>Room transformation video #asmr video #satisfying video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474282/3474282_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T09:04:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jerry Sneaks Into the Birdhouse… Then Trouble Arrives! 😂🏠</video:title>
      <video:description>Jerry explores a colorful birdhouse, but he isn&apos;t the only tiny character around! 🐭🐦😂 What begins as a quiet outdoor adventure quickly develops into another playful cartoon encounter. 🏠🐭 JERRY FOUND A NEW HIDEOUT! But someone else already lives there! 😂 🐭🏠 JERRY JUST FOUND THE PERFECT LITTLE HOUSE… OR DID HE? 😂 Perfect size? ✅ Safe from Tom? Maybe. Already occupied? That could be a problem! 🐦🤣 👇 Would this be the perfect Jerry hideout? Jerry explores a tiny birdhouse and encounters its feathered residents in this colorful outdoor cartoon sequence. #TomAndJerryJerryMouseBirdhouseFunnyBirdCartoonAnimalsFunnyCartoonCartoonComedyClassicCartoonsJerryFunnyFunnyVideosCartoonClipsAnimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474281/3474281_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T09:03:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Long March Begins_ Aleema Khan Arrested as Crackdown on PTI _ Adiala Gate Opens for Imran Khan.m</video:title>
      <video:description>The Long March Begins_ Aleema Khan Arrested as Crackdown on PTI _ Adiala Gate Opens for Imran Khan.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474280/3474280_720p.mp4</video:content_loc>
      <video:duration>653</video:duration>
      <video:publication_date>2026-09-21T09:02:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daha 17 17. Bölüm باغی قسط 1</video:title>
      <video:description>Daha 17 17. Bölüm باغی قسط 1 #Daha1717Bölüm</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474279/3474279_720p.mp4</video:content_loc>
      <video:duration>8535</video:duration>
      <video:publication_date>2026-09-21T09:02:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>She Gave Birth to a Dragon _ The Mothers Monster _ Full Fantasy Movie 4K.mp4</video:title>
      <video:description>She Gave Birth to a Dragon _ The Mothers Monster _ Full Fantasy Movie 4K.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474278/3474278_720p.mp4</video:content_loc>
      <video:duration>1709</video:duration>
      <video:publication_date>2026-09-21T09:02:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474277</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474277/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Plant growth satisfying ASMR 2</video:title>
      <video:description>#lemon growth #plant growth video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474277/3474277_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T09:02:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours ep 4 (Hindi) 720p</video:title>
      <video:description>new k drama I Hindi dubbed watch and enjoy guys ^_^</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474276/3474276_720p.mp4</video:content_loc>
      <video:duration>3882</video:duration>
      <video:publication_date>2026-09-21T09:01:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tom Chases Jerry… Then a Woodpecker Joins the Chaos! 😂🐦</video:title>
      <video:description>Tom already has enough trouble dealing with Jerry, but things become even crazier when a determined woodpecker gets involved! 🐱🐭🐦 Watch this fast-moving outdoor adventure packed with chasing and classic cartoon chaos. 🐦😂 TOM HAS ANOTHER PROBLEM NOW! Jerry wasn’t enough, so a woodpecker joined the action! 🚨🐱 TOM IS SERIOUSLY OUTNUMBERED! 😂 Jerry is already hard enough to catch. 🐭 Now add one VERY determined bird. 🐦 Tom’s day just went from bad to worse! 🤣 👉 Watch the chaos unfold! Tom’s pursuit becomes considerably more complicated when Jerry and a lively woodpecker turn the situation into outdoor cartoon chaos. #TomAndJerryTomCatJerryMouseWoodpeckerFunnyBirdCartoonChaseFunnyCartoonCartoonComedyClassicCartoonsFunnyVideosCartoonClipsAnimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474275/3474275_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T09:01:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hanuman ansh full movie - full hindi movie | hanuman ansh</video:title>
      <video:description>#Hanumanansh #neemkaroli #babaneemkaroli #hanuman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474274/3474274_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-21T09:01:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat story video</video:title>
      <video:description>#cat story #ca video #funny cat videos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474273/3474273_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-09-21T09:00:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Proteger</video:title>
      <video:description>Um história do filho É protegido pela mãe #Proteger #filho #mãe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474272/3474272_720p.mp4</video:content_loc>
      <video:duration>122</video:duration>
      <video:publication_date>2026-09-21T08:59:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A_Love_Other_Than_Yours_[Hindi]_480P_S01_E04.mp4</video:title>
      <video:description>K.drama #Series</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474271/3474271_720p.mp4</video:content_loc>
      <video:duration>3881</video:duration>
      <video:publication_date>2026-09-21T08:59:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Fate of the Furious (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Fate of the Furious (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474270/3474270_720p.mp4</video:content_loc>
      <video:duration>8157</video:duration>
      <video:publication_date>2026-09-21T08:59:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jerry Meets a GIANT Lion… But He’s Not Scared! 😂🦁🐭</video:title>
      <video:description>Jerry is used to facing Tom, but this time his opponent is considerably bigger! 🐭🦁😂 Watch the fearless little mouse come face-to-face with a huge lion in this hilarious cartoon encounter. 🦁😳 JERRY… THAT’S NOT TOM! Look at the size difference, and Jerry STILL isn’t backing down! 😂 🦁🚨 JERRY HAS A MUCH BIGGER PROBLEM THAN TOM! 😂 Tiny Jerry: 🐭 GIANT lion: 🦁 Jerry’s fear level? Apparently ZERO! 🤣 This little mouse has more confidence than anyone! 👇 Would you run or stand your ground? Jerry comes face-to-face with a giant lion and proves that being the smallest character doesn&apos;t necessarily mean being the most frightened. #TomAndJerryJerryMouseCartoonLionFunnyAnimalsJerryFunnyFunnyCartoonCartoonComedyClassicCartoonsFunnyVideosCartoonClipsAnimationCartoonAdventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474269/3474269_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-21T08:59:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>siang siang gabut</video:title>
      <video:description>cewek cantik joget #cewekcantik #cewekdaster #cewekimut #fyypp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474268/3474268_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T08:59:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fruit satisfying ASMR</video:title>
      <video:description>#asmr #satisfying video#epoxy floor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474267/3474267_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T08:59:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rings (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Rings (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474266/3474266_720p.mp4</video:content_loc>
      <video:duration>6131</video:duration>
      <video:publication_date>2026-09-21T08:58:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Expendables 3 Hindi Dubbed (2014) Full Movie Watch online HD</video:title>
      <video:description>The Expendables 3 Hindi Dubbed (2014) Full Movie Watch online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474265/3474265_720p.mp4</video:content_loc>
      <video:duration>7588</video:duration>
      <video:publication_date>2026-09-21T08:58:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2-2-3-3-2</video:title>
      <video:description>#MLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474264/3474264_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T08:58:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>سافٹ اسٹیٹ وجود میں آ چکی؟ پچھلا گیر لگ گیا _ عمران خان کیلئے اسکرپٹ بدل دیا گیا؟.mp4</video:title>
      <video:description>سافٹ اسٹیٹ وجود میں آ چکی؟ پچھلا گیر لگ گیا _ عمران خان کیلئے اسکرپٹ بدل دیا گیا؟.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474263/3474263_720p.mp4</video:content_loc>
      <video:duration>945</video:duration>
      <video:publication_date>2026-09-21T08:58:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tom Walks Straight Into Jerry’s Trap… Instant Regret! 😂🐭</video:title>
      <video:description>Jerry proves once again that brains can beat size! 🐭😂 Tom thinks he has the upper hand, but Jerry’s clever setup turns the situation completely around. Watch this classic Tom &amp; Jerry moment packed with tricks, reactions, and slapstick comedy. 🪤😂 TOM WALKED RIGHT INTO IT! Jerry knew exactly what he was doing from the beginning! 🚨🐭 TOM HAS NO IDEA HE’S WALKING INTO A TRAP! 😂 Jerry has a plan. Tom is getting closer. 🐱 And everything is going EXACTLY how Jerry wants it! Then Tom realizes his mistake... 🤣 👇 Who’s smarter: Tom or Jerry? Jerry sets up another clever trick for Tom, and the confident cat realizes the danger a little too late. #TomAndJerryJerryMouseTomCatJerryTricksTomFunnyCartoonCartoonComedyClassicCartoonsTomAndJerryFunnySlapstickComedyFunnyVideosCartoonClipsAnimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474262/3474262_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-21T08:57:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi S15E14 13th September 2026 Hindi 720p WEB-DL</video:title>
      <video:description>Khatron Ke Khiladi Season 15 (Darr Ka Naya Daur) premiered on August 1, 2026, hosted by Rohit Shetty and filmed in Cape Town, featuring new and returning contestants facing intense stunts every Saturday and Sunday. #KhatronKeKhiladiS15</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474261/3474261_720p.mp4</video:content_loc>
      <video:duration>4356</video:duration>
      <video:publication_date>2026-09-21T08:57:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Transformers- The Last Knight (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Transformers- The Last Knight (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474260/3474260_720p.mp4</video:content_loc>
      <video:duration>9279</video:duration>
      <video:publication_date>2026-09-21T08:56:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Taking of Pelham 123 (2009) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Taking of Pelham 123 (2009) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474259/3474259_720p.mp4</video:content_loc>
      <video:duration>6355</video:duration>
      <video:publication_date>2026-09-21T08:56:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Lost Village (2017) Hindi Dubbed</video:title>
      <video:description>The Lost Village (2017) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474258/3474258_720p.mp4</video:content_loc>
      <video:duration>5386</video:duration>
      <video:publication_date>2026-09-21T08:56:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Hitman’s Bodyguard (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Hitman’s Bodyguard (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474257/3474257_720p.mp4</video:content_loc>
      <video:duration>7097</video:duration>
      <video:publication_date>2026-09-21T08:56:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Four Warriors (2015) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Four Warriors (2015) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474256/3474256_720p.mp4</video:content_loc>
      <video:duration>5506</video:duration>
      <video:publication_date>2026-09-21T08:56:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Expendables 2 (2012) Hindi Dubbed</video:title>
      <video:description>The Expendables 2 (2012) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474255/3474255_720p.mp4</video:content_loc>
      <video:duration>6162</video:duration>
      <video:publication_date>2026-09-21T08:55:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Boss Baby (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>The Boss Baby (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474254/3474254_720p.mp4</video:content_loc>
      <video:duration>5851</video:duration>
      <video:publication_date>2026-09-21T08:55:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😍🔥😎👌</video:title>
      <video:description>Until all is over watch out for us #Wecanchangethegame</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474253/3474253_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T08:55:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pirates of the Caribbean Dead Men Tell No Tales (2017) Hindi Dubbed</video:title>
      <video:description>Pirates of the Caribbean Dead Men Tell No Tales (2017) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474252/3474252_720p.mp4</video:content_loc>
      <video:duration>7747</video:duration>
      <video:publication_date>2026-09-21T08:55:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pirates of the Caribbean – Dead Man’s Chest (2006) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Pirates of the Caribbean – Dead Man’s Chest (2006) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474251/3474251_720p.mp4</video:content_loc>
      <video:duration>9082</video:duration>
      <video:publication_date>2026-09-21T08:55:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pirates of the Caribbean – At World’s End (2007) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Pirates of the Caribbean – At World’s End (2007) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474250/3474250_720p.mp4</video:content_loc>
      <video:duration>10113</video:duration>
      <video:publication_date>2026-09-21T08:55:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mr queen ep5</video:title>
      <video:description>#Mrqueenep5</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474249/3474249_720p.mp4</video:content_loc>
      <video:duration>2437</video:duration>
      <video:publication_date>2026-09-21T08:55:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mom&apos;s prayers</video:title>
      <video:description>Your mom prays for you every time #Africaugandambale</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474248/3474248_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T08:53:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi S15E13 12th September 2026 Hindi 720p WEB-DL</video:title>
      <video:description>Khatron Ke Khiladi Season 15 (Darr Ka Naya Daur) premiered on August 1, 2026, hosted by Rohit Shetty and filmed in Cape Town, featuring new and returning contestants facing intense stunts every Saturday and Sunday. #KhatronKeKhiladiS15</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474247/3474247_720p.mp4</video:content_loc>
      <video:duration>4352</video:duration>
      <video:publication_date>2026-09-21T08:53:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>真人体育，🔗235322.com</video:title>
      <video:description>圣淘沙娱乐平台 圣淘沙🔗235322.com 联系✈️qingnin999 真人体育娱乐 #真人体育，真人视讯</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474246/3474246_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T08:52:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>House for sell 3</video:title>
      <video:description>House for sell #Travel #viral #trending #reels #explore #discover #ticktok #youtube #insta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474245/3474245_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-09-21T08:52:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RONALDO HIGH COMPLEX GOALS</video:title>
      <video:description>RONALDO HIGH COMPLEX GOALS #ronaldo #goals #footballs #worldcup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474244/3474244_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T08:51:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing 347</video:title>
      <video:description>Amazing #Travel #viral #trending #reels #explore #discover #ticktok #youtube #insta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474243/3474243_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T08:51:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aduuuh kasian istrinya</video:title>
      <video:description>Semoga terhibur dwngan vidio ini #Komedi #funy #lucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474242/3474242_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T08:51:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menjadi wanita harus tetap semangat 💪🏻</video:title>
      <video:description>Mekipun kita tak beruntung mereka kita harus tegar menjalaninya #Selamatsiang👋🏻</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474241/3474241_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T08:50:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474240</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474240/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What is this 30</video:title>
      <video:description>What is this #Travel #viral #trending #reels #explore #discover #ticktok #youtube #insta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474240/3474240_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-21T08:50:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474239</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474239/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Real time 3</video:title>
      <video:description>Real #Travel #viral #trending #reels #explore #discover #ticktok #youtube #insta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474239/3474239_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T08:50:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natural 57</video:title>
      <video:description>Natural #Travel #viral #trending #reels #explore #discover #ticktok #youtube #insta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474238/3474238_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T08:49:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474237</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474237/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mehfil 3</video:title>
      <video:description>Mehfil #Travel #viral #trending #reels #explore #discover #ticktok #youtube #insta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474237/3474237_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T08:48:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Three questions words,what,where,who</video:title>
      <video:description>Its all learning English and tok pisin or pidgin language. #Language #tourism</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474236/3474236_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T08:48:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video E-Voting</video:title>
      <video:description>Video E-Voting Menjelaskan tata cara pemilihan di gunakan uji coba melalui pemilihan OSIS SMP Al Azhar 22 Jakarta #Tatacarapemilu #menjelaskanalurpemilihan #caramemilihsecaradigital</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474235/3474235_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-21T08:47:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hala Madrid 8</video:title>
      <video:description>We together always #Theking👑neverdies</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474234/3474234_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T08:46:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why aren&apos;t you going to the white stone?</video:title>
      <video:description>Why aren&apos;t you going to the white stone?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474233/3474233_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T08:46:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Winter soja</video:title>
      <video:description>Your mom is the only one to disturb you if you be rich #AfricaUgandambale</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474232/3474232_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T08:45:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachoeira 7</video:title>
      <video:description>#Cachoeira</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474231/3474231_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-21T08:44:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RONALDO IS GOALS MOMMENT</video:title>
      <video:description>RONALDO IS GOALS MOMMENT #SPORTS #GOALS #FOOTBALLS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474230/3474230_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T08:43:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kiss Or We Die (2026) Eng Sub</video:title>
      <video:description>Kiss Or We Die (2026) Eng Sub Kiss Or We Die, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #KissOrWeDie #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474229/3474229_720p.mp4</video:content_loc>
      <video:duration>2471</video:duration>
      <video:publication_date>2026-09-21T08:43:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Sunset Embracing the City” 🌇</video:title>
      <video:description>Golden-orange hues spread across the evening sky, casting a beautiful reflection on the calm surface of the water. In the distance, the silhouettes of towering skyscrapers stand majestically, while boats slowly glide along the river, carrying shimmering lights across the water. Along the riverside, warm lights and the footsteps of people bring life to the scene. A breathtaking view that creates a perfect harmony between the tranquility of the water, the sparkle of the city, and the beauty of the sunset.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474228/3474228_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T08:42:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video lucu bangett</video:title>
      <video:description>Video lucu bikin ngakak brutal,meme , ngakak.z #videolucungakakbrutal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474227/3474227_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T08:41:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CYBER BASS 🔥💚 ULTRA DEEP BASS | EXTREME FUTURISTIC CAR MUSIC 2026</video:title>
      <video:description>CYBER BASS — RED &amp; GREEN NEON ENERGY! Enter a futuristic cyberpunk world powered by ultra-deep sub bass, powerful Bass House drops, aggressive reese basslines, futuristic synths, and high-energy EDM production. CyberBass #BassBoosted #CarMusic #DeepBass #BassHouse #NightDrive #EDM #FutureRave #Subwoofer #Cyberpunk #CyberBass #EDM #CarMusic #BassHouse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474226/3474226_720p.mp4</video:content_loc>
      <video:duration>706</video:duration>
      <video:publication_date>2026-09-21T08:40:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Major Seaside Hotel Fire Treated As Suspicious</video:title>
      <video:description>Major Seaside Hotel Fire Treated As Suspicious</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474225/3474225_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-21T08:36:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gunung botak papua bara</video:title>
      <video:description>Menikmati keindahan alam Gunung Botak, Papua Barat 🌿🏔️ Perjalanan kali ini membawa kita melihat panorama alam yang begitu indah, mulai dari perbukitan hijau, hamparan laut yang luas, hingga suasana alam Papua yang masih terasa alami dan mempesona. Gunung Botak menjadi salah satu tempat yang menawarkan pemandangan luar biasa untuk dinikmati, terutama bagi para pecinta alam dan perjalanan. Nikmati keindahan Papua Barat dalam video ini dan jangan lupa dukung channel dengan Like, Comment, dan Subscribe. ❤️ #perjalanan #wisataalam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474224/3474224_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-09-21T08:36:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love U Lots Episode 5</video:title>
      <video:description>Love U Lots Episode 5 #LoveULotsEpisode5 #LOVEULOTS #FILIPINOMOVIES #MUSTWATCH #TRENDING #VIRALTODAY #FYP #PINOYMOVIES #TAGALOGMOVIES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474223/3474223_720p.mp4</video:content_loc>
      <video:duration>3315</video:duration>
      <video:publication_date>2026-09-21T08:36:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Bona Fide Killer (2026) Episode 7 Eng Sub</video:title>
      <video:description>A Bona Fide Killer (2026) - KOREAN DRAMA Yoo Bo Na appears to be an ordinary working mother in her 30s, juggling family life with her husband and daughter. But behind her everyday facade, she is &quot;Kingfisher,&quot; a legendary sniper who hunts down ruthless criminals that have escaped the law. After returning from a three-year childcare leave, Bo Na resumes her dangerous double life, struggling to balance motherhood, marriage, and her deadly mission. As her investigative journalist husband Kwon Tae Seong unknowingly inches closer to discovering Kingfisher&apos;s true identity, and determined detective Lee Dong Jin relentlessly pursues the elusive vigilante, Bo Na finds herself trapped between family, justice, and survival. With the help of her loyal ally Kim Bong Pal, she must navigate a world where one mistake could destroy both her secret life and the family she cherishes. A Bona Fide Killer, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, koreandrama, dramakorean, koreanromance, romancekorean, movie, moviekorean, koreanmovie #ABonaFideKiller #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #koreandrama #dramakorean #koreanromance #romancekorean #movie #moviekorean #koreanmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474222/3474222_720p.mp4</video:content_loc>
      <video:duration>3926</video:duration>
      <video:publication_date>2026-09-21T08:34:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Edge of the Earth: The Katmai Chronicles</video:title>
      <video:description>Edge of the Earth: The Katmai Chronicles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474220/3474220_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T08:33:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the moment 2</video:title>
      <video:description>#mlbb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474219/3474219_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T08:30:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tutor menjadi GILAAAA</video:title>
      <video:description>mas jaz tutorial #tutorial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474218/3474218_720p.mp4</video:content_loc>
      <video:duration>231</video:duration>
      <video:publication_date>2026-09-21T08:28:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bocil core</video:title>
      <video:description>indonesia bocil core hahah #videolucuindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474217/3474217_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T08:28:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474216</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474216/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Siapa salah ku tak tau</video:title>
      <video:description>Semoga terhibur dengan vidio ini #Komedi #lucu #funy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474216/3474216_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T08:27:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YouTube shorts video - YouTube finds</video:title>
      <video:description>#YouTube #YouTubevideo #youtubevideos #YouTubeshorts #YouTubefinds #youtubeearnings</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474215/3474215_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T08:25:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mr queen ep4</video:title>
      <video:description>#Mrqueenep4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474214/3474214_720p.mp4</video:content_loc>
      <video:duration>2530</video:duration>
      <video:publication_date>2026-09-21T08:23:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 666</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ON THE BEACH MIAMI PART 666 #HOST #AMERIKA #BEAUTIFUL #SEXY #BEACH #MIAMI #PART666</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474213/3474213_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-21T08:23:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Na casa do pai</video:title>
      <video:description>Agora ,estamos a cantar i convidar todos vocês pipoooo 🙏 #Viagem #parísFrança #Portugal #Inglaterra #Moçambique</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474212/3474212_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T08:23:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Awakening of the Sword Sovereign 🌕🔥</video:title>
      <video:description>&quot;Under the light of the full moon, a legendary warrior awakens his ancient power. With a spiritual sword shining like lightning and mysterious symbols swirling around him, he stands ready to face every challenge. #SwordSovereignCultivationAICharacterFantasyWarriorEpicBattleAIVideoMartialArtsLegendaryWarrior</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474211/3474211_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T08:23:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Youtube video camera | youtube</video:title>
      <video:description>This video camera for perfect for youtube videos, YouTube shorts, YouTube earnings, #YouTube #YouTubevideo #YouTubevideos #YouTubeshort #youtubeshorts #shorts #videos #googlevideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474210/3474210_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T08:22:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 665</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE GARDEN PART665 #HOST #AMERIKA #BEAUTIFUL #SXYGARDEN #PART665</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474209/3474209_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-21T08:21:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Airborne Pirate - Uncharted #airbornepirate #uncharted</video:title>
      <video:description>The Airborne Pirate - Uncharted #airbornepirate #uncharted</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474208/3474208_720p.mp4</video:content_loc>
      <video:duration>329</video:duration>
      <video:publication_date>2026-09-21T08:20:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Youtube video finds | YouTube</video:title>
      <video:description>#YouTube #youtubevideo #YouTubevideos #YouTubeshorts #YouTubeearnings</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474207/3474207_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T08:20:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pls Love (2026) Episode 2 Eng Sub</video:title>
      <video:description>Pls Love (2026) Cold and seemingly-perfect business heiress Phakinee reunites with Parnupsorn, a woman she once shared a fleeting seaside romance with—now working as a hostess at a luxury club in Bangkok. Determined to keep her close, Phakinee hires her as a personal assistant, forcing them to confront unresolved feelings, pride, and painful misunderstandings. As secrets and class differences threaten to pull them apart, both women must decide if they are brave enough to trust and love each other without judgement. Pls Love, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #PlsLove #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474206/3474206_720p.mp4</video:content_loc>
      <video:duration>2840</video:duration>
      <video:publication_date>2026-09-21T08:19:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KIPAS ANGIN MINTA CUTI! | Benda yang Capek Sama Manusia #KipasAnginCuti #bendabicara #videoviral</video:title>
      <video:description>Kipas angin minta cuti karena 3 tahun muter terus tanpa istirahat! Benda yang capek sama manusia ini akhirnya hidup, ngomong, bicara, ngamuk, ngelawan dan membongkar Kehidupan Absurd Anak Kos Sial karena udah benar-benar muak. Video yang viral masuk konten FYP Indonesia, dengan Cerita Animasi AI Lucu Absurd ini, dibuat dengan versi CHAOS FUNNY EXTREME, meme absurd, dan komedi kehidupan Anak Kos Sial yang relate banget. Subscribe dan Like untuk lebih banyak cerita benda yang mulai sadar, benda yang capek sama manusia, dan chaos kehidupan sehari-hari dari Inspirational Kids 168. #kipasangin #KipasMintaCuti, #BendaHidup, #BendaNgamuk, #BendaMuak, #BendaNgomong, #BendaNgelawan, #anakkos #AnakKosSial, #Ceritalucu, #CeritaAI, #animasi #animasiai #animasilucu #viral #masukfyp #kontenfyp #videolucu #ChaosFunny, #fyp #kehidupananakkos, #kehidupanabsurdanakkossial, #memeabsurd #komediAnakKosSial, #bendayangmulaisadar, #bendayangcapeksamamanusia, #chaoskehidupanseharihari, #InspirationalKids168 ----- #KipasAngin #KipasMintaCuti #BendaHidup #BendaNgamuk #BendaMuak #BendaNgomong #BendaNgelawan #AnakKos #AnakKosSial #CeritaLucu #CeritaAI #Animasi #AnimasiAI #AnimasiLucu #Viral #MasukFYP #KontenFYP #VideoLucu #ChaosFunny #FYP #kehidupananakkos #kehidupanabsurdanakkossial #memeabsurd #komediAnakKosSial #bendayangmulaisadar #bendayangcapeksamamanusia #chaoskehidupanseharihari #InspirationalKids168 #FYPIndonesia #Trending #ViralIndonesia #RelateBanget #Shorts #VideoShorts #VideoViral #Youtubeshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474205/3474205_720p.mp4</video:content_loc>
      <video:duration>136</video:duration>
      <video:publication_date>2026-09-21T08:19:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 664</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE PROMOTION UNDERWEAR PART 664 #HOST #AMERIKA #BEAUTIFUL #SEXY #PROMOTION #UNDERWEAR #PART664</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474204/3474204_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-21T08:19:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Entre Copos e Beijos</video:title>
      <video:description>Entre Copos e Beijos #Alegria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474203/3474203_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-21T08:18:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>malikzadasunny</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474202/3474202_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T08:16:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Satisfying Teal Soap Scooping ASMR | Mint Curls 2</video:title>
      <video:description>Watch an ice cream scoop effortlessly carve a smooth, cylindrical curl from a solid teal soap block. Enjoy this oddly satisfying ASMR video designed for ultimate relaxation and stress relief. #tealsoapscooping #mintsoapcurls #oddlysatisfyingvideo #metalscoopcutting #relaxingvisualsounds</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474201/3474201_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T08:15:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Girl 267</video:title>
      <video:description>So Hot Look</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474200/3474200_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T08:15:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Beautiful Photoshot</video:title>
      <video:description>Awesome Look</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474199/3474199_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T08:14:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hamza fowler</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474197/3474197_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T08:14:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buatkan rumah 2</video:title>
      <video:description>#Buatkanrumahdaribatu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474196/3474196_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-21T08:14:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Girl 266</video:title>
      <video:description>Hot Look</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474195/3474195_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T08:14:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot Girl 226</video:title>
      <video:description>Tiktoker Girl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474194/3474194_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T08:13:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazon finds 2</video:title>
      <video:description>#Amazon #amazonfinds #amazonsale #flipkart #flipkartfinds</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474193/3474193_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T08:13:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kashees Bridal Makeup 2</video:title>
      <video:description>Best Trendy Bridal Makeover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474192/3474192_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T08:13:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>うまくいくよ。</video:title>
      <video:description>うまくいくか、うまくいかないかのどちらかだ。</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474191/3474191_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-09-21T08:13:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny video 759</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474190/3474190_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T08:12:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hand-Carving a Wooden Block | Satisfying Woodworking ASMR</video:title>
      <video:description>What happens when a sharp gouge chisel cuts deep, precise grooves into a solid piece of wood? Watch the deeply satisfying process of detailed hand-carving, accompanied by the crisp, soothing ASMR sounds of fresh wood shavings curling away from the grain. #woodcarvingasmr #gougechisel #satisfyingwoodworking #woodshavingasmr #handcarving #tactileasmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474189/3474189_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T08:12:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Tiktoker 28</video:title>
      <video:description>Warda malik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474188/3474188_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T08:12:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patroli karhutla</video:title>
      <video:description>Sosialisasi dilarang bakar hutan dan lahan #Karhutla</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474187/3474187_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T08:11:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474186</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474186/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mehakchohdry</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474186/3474186_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-21T08:10:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love U Lots Episode 4</video:title>
      <video:description>Love U Lots Episode 4 #LoveULotsEpisode4 #LOVEULOTS #FILIPINOMOVIES #MUSTWATCH #TRENDING #VIRALTODAY #FYP #PINOYMOVIES #TAGALOGMOVIES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474185/3474185_720p.mp4</video:content_loc>
      <video:duration>3111</video:duration>
      <video:publication_date>2026-09-21T08:10:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474184</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474184/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Dangdut Performance Hits Different! 🔥</video:title>
      <video:description>This Dangdut Performance Hits Different! 🔥 #dangdut #Indonesiandangdut #dangdutsinger #dangdutmusic #Indonesiansinger #dangdutperformance #livedangdut #femaledangdutsinger</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474184/3474184_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T08:10:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mr queen ep 3</video:title>
      <video:description>#Mrqueenep3</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474183/3474183_720p.mp4</video:content_loc>
      <video:duration>2335</video:duration>
      <video:publication_date>2026-09-21T08:10:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sinergitas TNI POLRI</video:title>
      <video:description>Patroli TNI POLRI #Patroliharkamtibmas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474182/3474182_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T08:10:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474181</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474181/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>過去</video:title>
      <video:description>前世では多くの飢えを経験した</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474181/3474181_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-21T08:10:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dilarang bakar hutan dan lahan</video:title>
      <video:description>Sosialisasi dilarang membakar hutan dan lahan #Karhuta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474180/3474180_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T08:09:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love U Lots Episode 3</video:title>
      <video:description>Love U Lots Episode 3 #LOVEULOTS #FILIPINOMOVIES #MUSTWATCH #TRENDING #VIRALTODAY #FYP #PINOYMOVIES #TAGALOGMOVIES #LoveULotsEpisode3</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474179/3474179_720p.mp4</video:content_loc>
      <video:duration>3465</video:duration>
      <video:publication_date>2026-09-21T08:08:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Legend Of Exorcism Season 1 Last Episode 13 In Hindi</video:title>
      <video:description>Enjoy #Anime #HindiAnime #ExorcismAnime #LegendOfExorcism #MonstersAnime #DemonsAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474178/3474178_720p.mp4</video:content_loc>
      <video:duration>1008</video:duration>
      <video:publication_date>2026-09-21T08:08:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474177</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474177/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Buatkan rumah</video:title>
      <video:description>#Buatkanrumah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474177/3474177_720p.mp4</video:content_loc>
      <video:duration>114</video:duration>
      <video:publication_date>2026-09-21T08:07:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474176</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474176/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shynowuyi</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474176/3474176_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-09-21T08:07:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harkamtibmas</video:title>
      <video:description>Patroli #Harkamtibmas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474175/3474175_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T08:07:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Celebration at The Summit of Mount Patah</video:title>
      <video:description>Celebration at the summit of Mount Patah. Upon reaching the peak, we celebrated to our hearts&apos; content—an expression of our gratitude and pride. #summitcelebrationhikersclimbersmountainclimbers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474174/3474174_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-21T08:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Urban Miracle Doctor Eps 199</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474173/3474173_720p.mp4</video:content_loc>
      <video:duration>678</video:duration>
      <video:publication_date>2026-09-21T08:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474172</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474172/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reels 26</video:title>
      <video:description>This is my own video I&apos;m reels making Instagram and Facebook. #Imsoexcitedthisplatform</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474172/3474172_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T08:04:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474171</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474171/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BEDA DOLO-DOLO - Juan Reza, Silet Open Up, Jackson Zeran feat Monchoustik</video:title>
      <video:description>Thank you for watching and listening to songs from Eastern Indonesia. Don&apos;t forget to keep supporting us and subscribing to our music. Greetings from us, the people of the East. We love you all. #musichip-hop #music-rap #music-slow #music-jazz #music-reggae #music-indonesia #music-rnb #music-pop</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474171/3474171_720p.mp4</video:content_loc>
      <video:duration>258</video:duration>
      <video:publication_date>2026-09-21T08:04:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patroli 3</video:title>
      <video:description>Harkamtibmas #Harkamtibmas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474170/3474170_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T08:04:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ylmy video 2926</video:title>
      <video:description>Wwe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474169/3474169_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T08:03:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tales of Herding Gods Eps 94</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474168/3474168_720p.mp4</video:content_loc>
      <video:duration>1255</video:duration>
      <video:publication_date>2026-09-21T08:03:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video hafe fun free fire trend</video:title>
      <video:description>Video hafe fun free fire trend fashion #Gamessfreefirejj</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474167/3474167_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-21T08:03:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474166</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474166/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keindahan alam Negeri Dongeng China Di Qarhan Salt Take</video:title>
      <video:description>Keindahan alam Negeri Dongeng China Di Qarhan Salt Take Qinghai dijuluki Sebagai Danau Garam Terbesar Dichina #TravelChina #Donghua #Kultivator #negeriDongengChina #wisataChina</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474166/3474166_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T08:03:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patroli harkamtibmas 2</video:title>
      <video:description>Harkamtibmas #Harkamtibmas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474165/3474165_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-21T08:02:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi 15 20th September 2026 Full Episode 17.</video:title>
      <video:description>Khatron Ke Khiladi 15 20th September 2026 Full Episode 17.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474164/3474164_720p.mp4</video:content_loc>
      <video:duration>4380</video:duration>
      <video:publication_date>2026-09-21T08:02:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Renegade Immortal Eps 153</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474163/3474163_720p.mp4</video:content_loc>
      <video:duration>1422</video:duration>
      <video:publication_date>2026-09-21T08:01:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love U Lots Episode 2</video:title>
      <video:description>Love U Lots Episode 2 #LOVEULOTS #FILIPINOMOVIES #MUSTWATCH #TRENDING #VIRALTODAY #FYP #PINOYMOVIES #TAGALOGMOVIES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474162/3474162_720p.mp4</video:content_loc>
      <video:duration>2986</video:duration>
      <video:publication_date>2026-09-21T08:00:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474161</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474161/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quando a Lua Aparecer</video:title>
      <video:description>Quando a Lua Aparecer #Alegria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474161/3474161_720p.mp4</video:content_loc>
      <video:duration>184</video:duration>
      <video:publication_date>2026-09-21T08:00:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animasi 26</video:title>
      <video:description>#London #Jerman #dubai #prancis #american</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474160/3474160_720p.mp4</video:content_loc>
      <video:duration>300</video:duration>
      <video:publication_date>2026-09-21T07:59:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#bikin laper bule 6</video:title>
      <video:description>masakan khas Indonesia #hiburan #kuliner #wisata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474159/3474159_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T07:58:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love U Lots Episode 1</video:title>
      <video:description>Love U Lots Episode 1 #LoveULotsEpisode1 #LOVEULOTS #FILIPINOMOVIES #MUSTWATCH #TRENDING #VIRALTODAY #FYP #PINOYMOVIES #TAGALOGMOVIES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474158/3474158_720p.mp4</video:content_loc>
      <video:duration>2753</video:duration>
      <video:publication_date>2026-09-21T07:57:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Extreme Middle Split to Backbend Flow! 😱🔥</video:title>
      <video:description>Starting off in a wide wide-legged stance, sliding straight into a deep middle split, and finishing off with an intense backbend fold! Flexibility takes consistency, patience, and lots of core control. #FlexibilityContortionMiddleSplitSplitsBackbendStretchingFlexibilityGoalsFitnessGymnastContortionist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474157/3474157_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T07:56:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474156</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474156/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love U Lots Episode 8</video:title>
      <video:description>Love U Lots Episode 8 #LOVEULOTS #FILIPINOMOVIES #MUSTWATCH #TRENDING #VIRALTODAY #FYP #PINOYMOVIES #TAGALOGMOVIES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474156/3474156_720p.mp4</video:content_loc>
      <video:duration>3931</video:duration>
      <video:publication_date>2026-09-21T07:56:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474155</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474155/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video lucu 2 2</video:title>
      <video:description>tingkah laku warga indonesia #indonesialucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474155/3474155_720p.mp4</video:content_loc>
      <video:duration>103</video:duration>
      <video:publication_date>2026-09-21T07:56:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patroli 2</video:title>
      <video:description>Harkamtibmas #Harkamtibmas #bhabinkamtibmas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474154/3474154_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T07:56:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cheerful Girl Running Through Golden Autumn Forest</video:title>
      <video:description>Young woman having fun in a stunning autumn forest filled with colorful fallen leaves. She runs through the woodland holding handfuls of yellow foliage while bright sunlight shines through the trees. The cheerful atmosphere and vibrant fall colors create beautiful lifestyle footage celebrating nature, happiness, freedom, and outdoor recreation. #autumnforest #fallfoliage #youngwoman #beautifulgirl #yellowleaves #autumnleaves #runningwoman #colorfulforest #goldenleaves</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474153/3474153_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-21T07:55:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story kata kata 3</video:title>
      <video:description>Bantu suport🙏 #Storykatakata #Fyp #bantusuport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474152/3474152_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T07:55:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Contortion Backbend Challenge with My Dog! 🐶🧘‍♀️</video:title>
      <video:description>When your workout partner has four legs and zero boundaries! Watch as I bend into a full backbend while holding my pup on my patio. Balancing, stretching, and staying flexible with a little extra weight and a lot of fun! #FlexibilityContortionBackbendDogMomStretchingFlexibilityGoalsFitnessGymnastContortionistWorkoutBuddy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474151/3474151_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-21T07:54:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patroli mbg</video:title>
      <video:description>Mbg #Mbg</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474150/3474150_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T07:54:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video lucu 27</video:title>
      <video:description>ada ada saya warga +62 #indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474149/3474149_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-21T07:54:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Bona Fide Killer (2026) Episode 6 Eng Sub</video:title>
      <video:description>A Bona Fide Killer (2026) - KOREAN DRAMA Yoo Bo Na appears to be an ordinary working mother in her 30s, juggling family life with her husband and daughter. But behind her everyday facade, she is &quot;Kingfisher,&quot; a legendary sniper who hunts down ruthless criminals that have escaped the law. After returning from a three-year childcare leave, Bo Na resumes her dangerous double life, struggling to balance motherhood, marriage, and her deadly mission. As her investigative journalist husband Kwon Tae Seong unknowingly inches closer to discovering Kingfisher&apos;s true identity, and determined detective Lee Dong Jin relentlessly pursues the elusive vigilante, Bo Na finds herself trapped between family, justice, and survival. With the help of her loyal ally Kim Bong Pal, she must navigate a world where one mistake could destroy both her secret life and the family she cherishes. A Bona Fide Killer, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, koreandrama, dramakorean, koreanromance, romancekorean, movie, moviekorean, koreanmovie #ABonaFideKiller #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #koreandrama #dramakorean #koreanromance #romancekorean #movie #moviekorean #koreanmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474148/3474148_720p.mp4</video:content_loc>
      <video:duration>3645</video:duration>
      <video:publication_date>2026-09-21T07:54:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474147</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474147/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zindagi Ki Haqeeqat | Islamic Reminder #Shorts</video:title>
      <video:description>Heart Touching Islamic Reminder | Hazrat Ali (RA) Ka Farman | Islamic Learning 786 Is video mein ek khoobsoorat aur sabaq amoz Islamic farman share kiya gaya hai jo dil ko sukoon de aur zindagi mein hidayat ka zariya bane. Agar video pasand aaye to LIKE, SHARE aur SUBSCRIBE zaroor karein: 👉 @IslamicLearning786 #hazratalikafarman #hazrataliquotes #islamicquotesurdu #islamicstatus #islamicshorts #islamicreminder #hearttouchingislamicstatus #hazratalisayings #urduquotes #islamiclearning786 #shorts #motivationalislamicquotes #goldenwordsinurdu #deenkibaatein #farmanehazratali #sabaqamozbaatein #urdustatus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474147/3474147_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T07:54:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Insane Floor Contortion Flow! 😱🔥</video:title>
      <video:description>Pushing flexibility and strength to the next level with this quick floor contortion combo! It takes consistency, practice, and core control to stick these transitions #FlexibilityContortionFloorworkStretchingFlexibilityGoalsFitnessGymnastContortionist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474146/3474146_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-21T07:53:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patroli harkamtibmas</video:title>
      <video:description>Patroli harkamtibmas di desa binaan #Harkamtibmas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474145/3474145_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T07:53:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kuntilanak 2</video:title>
      <video:description>Mensos kuntilanak bikin ngakak. Hiburan Kunti bikin seru ya bestie. #kuntilanakshortvideopendekkomedikomedihoror</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474144/3474144_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-21T07:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love U Lots Episode 7</video:title>
      <video:description>Love U Lots Episode 7 #LOVEULOTS #FILIPINOMOVIES #MUSTWATCH #TRENDING #VIRALTODAY #FYP #PINOYMOVIES #TAGALOGMOVIES #LoveULotsEpisode7</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474143/3474143_720p.mp4</video:content_loc>
      <video:duration>3198</video:duration>
      <video:publication_date>2026-09-21T07:52:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carilah orang yg bersyukur memilikimu</video:title>
      <video:description>#Orangygbersyukurmemilikimu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474142/3474142_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-21T07:52:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patroli malam 3</video:title>
      <video:description>Patroli kamtibmas #Harkamtibmas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474141/3474141_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T07:52:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Golden Hour Beach Contortion Shoot! 🌅🏖️</video:title>
      <video:description>Nothing beats stretching by the ocean at sunrise! Taking my flexibility practice to the beach for a magical golden hour contortion photoshoot. Pushing balance, strength, and grace with every pose. #FlexibilityContortionSunriseShootBeachContortionBackbendStretchingFlexibilityGoalsFitnessGymnastContortionist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474140/3474140_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T07:51:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BENTO DPRESSY - KETUA POSISI .. feat. SON DHEZTROW - CARLOS HIP-HOP - RIKARDO (Oficial Music Video)</video:title>
      <video:description>Thank you for watching and listening to songs from Eastern Indonesia. Don&apos;t forget to keep supporting us and subscribing to our music. Greetings from us, the people of the East. We love you all. #musichip-hop #music-rap #music-slow #music-jazz #music-reggae #music-indonesia #music-rnb #music-pop</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474139/3474139_720p.mp4</video:content_loc>
      <video:duration>231</video:duration>
      <video:publication_date>2026-09-21T07:51:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>avocado fruit in the dry season</video:title>
      <video:description>avocado fruit in the dry season #Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474138/3474138_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-21T07:50:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>監査人🔴 第1話 (Kansanin 🔴 Dai-10-wa</video:title>
      <video:description>#Film監査人🔴第1話Kansanin🔴Dai-10-wa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474137/3474137_720p.mp4</video:content_loc>
      <video:duration>4043</video:duration>
      <video:publication_date>2026-09-21T07:49:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crazy Outdoor Contortion Press Up Challenge! ☀️🧘‍♀️</video:title>
      <video:description>Taking my flexibility practice outside! Watch as I press up into a full contortion hold outdoors. It takes so much core strength, balance, and patience to pull off these moves! #FlexibilityContortionChestStandOutdoorWorkoutStretchingFlexibilityGoalsFitnessGymnastContortionist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474136/3474136_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-21T07:49:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Curhatan kuntilanak</video:title>
      <video:description>Kuntilanak aja bisa ngeluh juga ya. Video hiburan ya bestie. #kuntilanakkomedihororkuntilanakkomedikocakshort</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474135/3474135_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T07:49:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Against the Current (2026) Ep 22 - Eng Sub</video:title>
      <video:description>Against the Current Episode 22 EngSub -</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474134/3474134_720p.mp4</video:content_loc>
      <video:duration>2770</video:duration>
      <video:publication_date>2026-09-21T07:49:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Get ready for a happy new day with Lili, Riku, Bunny and Teddy! 🌞🎒 2</video:title>
      <video:description>Get ready for a happy new day with Lili, Riku, Bunny and Teddy! 🌞🎒 “Get Dressed for the Day” is a cheerful original nursery rhyme for toddlers and preschool children. Sing along as our friends get ready for the day, put on their shoes, pick up their school bags, and start their morning with happy smiles! 👕👟🎒 This fun kids song encourages children to learn simple daily routines through music, movement, and playful animation. 🎵 Song: Get Dressed for the Day 🌈 Channel: Lili Kids World 👧 Lili • 👦 Riku • 🐰 Bunny • 🧸 Teddy Perfect for: Toddlers and preschoolers Kids morning routines Getting ready for the day Preschool learning Fun sing-along activities Original nursery rhymes and kids songs Subscribe to Lili Kids World for more original nursery rhymes, kids songs, learning adventures, and fun sing-alongs! 🌈🎶 Learn • Sing • Smile Every Day! 💙 #getdressedfortheday #getdressedsong #kidssongs #nurseryrhymes #nurseryrhymesfortoddlers #kidssongsfortoddlers #preschoolsongs #toddlersongs #babysongs #morningroutinesong #gettingdressedsongforkids #kidsmorningsong #schoolpreparationsong #preschoollearningsongs #educationalsongsforkids #funkidssongs #childrensongs #originalnurseryrhymes #originalkidssongs #singalongsongsforkids #learningsongsfortoddlers #LiliKidsWorld #LiliKidsWorldsongs #kidslearning #toddlerlearning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474133/3474133_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-21T07:48:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The sound of truth guitar cover</video:title>
      <video:description>Guitar cover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474132/3474132_720p.mp4</video:content_loc>
      <video:duration>259</video:duration>
      <video:publication_date>2026-09-21T07:48:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan angker</video:title>
      <video:description>Mistis,alasroban,misteri #Misteri #horror #mistis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474131/3474131_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-21T07:48:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Insane Handstand to Contortion Flow! 😱🔥</video:title>
      <video:description>Which move was your favorite? Let me know in the comments below, and don&apos;t forget to like, share, and subscribe for more contortion routines! ✨ #FlexibilityContortionHandstandBackbendStretchingFlexibilityGoalsFitnessGymnastContortionist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474130/3474130_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-21T07:47:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Against the Current (2026) Ep 21 - Eng Sub</video:title>
      <video:description>Against the Current - Episode 21 EngSub</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474129/3474129_720p.mp4</video:content_loc>
      <video:duration>2800</video:duration>
      <video:publication_date>2026-09-21T07:46:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHESYLINO - KALAH DI BELIS FEAT RIZKY TENG - WULANSARI (Official Music Video)</video:title>
      <video:description>Thank you for watching and listening to songs from Eastern Indonesia. Don&apos;t forget to keep supporting us and subscribing to our music. Greetings from us, the people of the East. We love you all. #musichip-hop #music-rap #music-slow #music-jazz #music-reggae #music-indonesia #music-rnb #music-pop</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474128/3474128_720p.mp4</video:content_loc>
      <video:duration>198</video:duration>
      <video:publication_date>2026-09-21T07:45:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Unbelievable Contortion Skills! 😱🔥</video:title>
      <video:description>​Which pose surprised you the most? Drop a comment below, and don&apos;t forget to like, share, and subscribe for more contortion and flexibility content! ✨ #FlexibilityContortionBackbendChestStandStretchingFlexibilityGoalsDanceFitnessGymnastContortionist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474127/3474127_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T07:45:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Song comedy 2</video:title>
      <video:description>Song comedy #comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474126/3474126_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-21T07:45:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dukun vs ustad</video:title>
      <video:description>Lucu humor fun #Lucu #humor #fun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474125/3474125_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-21T07:44:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shayari reels video</video:title>
      <video:description>#Reels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474124/3474124_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T07:44:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Bet You Can’t Do This Flexibility Trick! 😱🔥</video:title>
      <video:description>Doing it anyway! Watch me pull off this crazy contortion leg hold and fold. Pushing my limits every single day—flexibility takes time, practice, and a whole lot of control! #FlexibilityContortionLegScaleStretchingFlexibilityGoalsDanceFitnessGymnastContortionist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474123/3474123_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T07:43:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kanzer pmc - Malas Cari Baru (feat. Amran Domaking) (Official Music Video)</video:title>
      <video:description>Thank you for watching and listening to songs from Eastern Indonesia. Don&apos;t forget to keep supporting us and subscribing to our music. Greetings from us, the people of the East. We love you all. #musichip-hop #music-rap #music-slow #music-jazz #music-reggae #music-indonesia #music-rnb #music-pop</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474122/3474122_720p.mp4</video:content_loc>
      <video:duration>208</video:duration>
      <video:publication_date>2026-09-21T07:43:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#nature climate⛲⛲⛲</video:title>
      <video:description>My place is very good nature in my Maharashtra so many people like Maharashtra India thank you so much subscribe my channel. #challengingMaharashtraNature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474121/3474121_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T07:43:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reels video 11</video:title>
      <video:description>#Reels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474120/3474120_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T07:43:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#viral 28</video:title>
      <video:description>💜 BTS is back with unforgettable music, amazing performances, and powerful moments for ARMY! 🎶✨ Enjoy this BTS video and celebrate the energy, talent, friendship, and incredible journey of RM, Jin, SUGA, j-hope, Jimin, V, and Jung Kook. 💜 If you love BTS, don’t forget to LIKE 👍, SHARE 🔥, and SUBSCRIBE 🔔 for more BTS videos, edits, updates, and entertainment! 💜 BTS FOREVER 💜 ARMY FOREVER #BTS #BTSARMY #BangtanSonyeondan #RM #Jin #SUGA #JHope #Jimin #V #JungKook #KPOP #BTS2026 #BTSComeback #ARIRANG #BTSWorldTour #BTSFans💜 BTS — THE MOMENT THAT BRINGS ARMY TOGETHER! 💜 Get ready for an exciting BTS experience filled with amazing moments, powerful energy, incredible performances, and unforgettable memories! 🎶✨ BTS has inspired millions of fans around the world with their music, passion, friendship, and dedication. This video is made for all ARMY who love BTS and enjoy their amazing journey. 💜 🔥 Watch until the end! 👍 Like the video 💬 Comment your favorite BTS member or moment 🔔 Subscribe for more BTS videos, edits, shorts, and entertainment! 💜 BTS FOREVER 💜 ARMY FOREVER #BTS #BTSARMY #Bangtan #KPOP #RM #Jin #SUGA #JHope #Jimin #V #JungKook #BTSFans #BTSVideo #BTSShorts #KPOPFans #ARMY #BTSEdit #BTSMoments #BTS2026💜 BTS — A JOURNEY OF MUSIC, FRIENDSHIP &amp; UNFORGETTABLE MOMENTS! 💜 Welcome to another exciting BTS video! 🎶✨ Enjoy amazing BTS moments, powerful performances, incredible visuals, and the energy that ARMY loves. Whether you are a longtime ARMY or discovering BTS for the first time, we hope this video brings a little happiness to your day. 💜 🔥 Watch till the end! 👍 Like &amp; Share 💬 Comment your favorite BTS moment 🔔 Subscribe for more BTS content! BTS × ARMY = FOREVER 💜</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474119/3474119_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T07:43:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Village Vlog 🌾 | Gaon Ki Khoobsurat Sair | Village Life</video:title>
      <video:description>Assalam-o-Alaikum! 🌸 Aaj ke is beautiful village vlog mein mere saath gaon ki khoobsurat galiyon, hare-bhare kheton aur pur-sukoon mahaul ki sair karein. 🌾🌿 Gaon ki simple life, natural beauty aur desi environment ka yeh pyara safar aapko zaroor pasand aayega. Video pasand aaye to Like, Share aur Follow zaroor karein. ❤️ #villagevlog #villagelife #beautifulvillage #Pakistanvillage #Pakistanivillage #gaonkisair #gaonkizindagi #villagegirlvlog #desilife #rurallife #naturevlog #countrysidevlog #villagelifestyle #Pakistanvlog #beautifulnature #dailyvlog #desivillage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474118/3474118_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-21T07:42:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎵 Song: Get Dressed for the Day 🌈 Channel: Lili Kids World 👧 Lili • 👦 Riku • 🐰 Bunny • 🧸 Teddy</video:title>
      <video:description>Get ready for a happy new day with Lili, Riku, Bunny and Teddy! 🌞🎒 “Get Dressed for the Day” is a cheerful original nursery rhyme for toddlers and preschool children. Sing along as our friends get ready for the day, put on their shoes, pick up their school bags, and start their morning with happy smiles! 👕👟🎒 This fun kids song encourages children to learn simple daily routines through music, movement, and playful animation. 🎵 Song: Get Dressed for the Day 🌈 Channel: Lili Kids World 👧 Lili • 👦 Riku • 🐰 Bunny • 🧸 Teddy Perfect for: Toddlers and preschoolers Kids morning routines Getting ready for the day Preschool learning Fun sing-along activities Original nursery rhymes and kids songs Subscribe to Lili Kids World for more original nursery rhymes, kids songs, learning adventures, and fun sing-alongs! 🌈🎶 Learn • Sing • Smile Every Day! 💙 #getdressedfortheday #getdressedsong #kidssongsnurseryrhymes #nurseryrhymesfortoddlers #kidssongsfortoddlers #preschoolsongstoddlersongs #babysongs #morningroutinesong #gettingdressedsongforkids #kidsmorningsong #schoolpreparationsong #preschoollearningsongs #educationalsongsforkids #funkidssongschildren #songsoriginalnurseryrhymes #originalkidssongssingalongsongsfor #kidslearningsongsfortoddlersLiliKidsWorld #LiliKidsWorldsongs #kidslearning #toddlerlearning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474117/3474117_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-21T07:42:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mind-Blowing Backbend Flexibility Workout! 🧘‍♀️✨</video:title>
      <video:description>Watch as I push my flexibility limits with this extreme backbend flow! Flexibility takes consistency, patience, and lots of practice. Let me know what trick or stretch you want to see next! Don&apos;t forget to like, comment, and subscribe for more contortion and flexibility content. #FlexibilityContortionBackbendYogaStretchingFlexibilityGoalsDanceFitnessGymnast</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474116/3474116_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T07:41:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>পার্স</video:title>
      <video:description>পার্স</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474115/3474115_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-21T07:40:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Take The Bloody Shot! For The Skyfall</video:title>
      <video:description>Take The Bloody Shot! For The Skyfall</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474114/3474114_720p.mp4</video:content_loc>
      <video:duration>350</video:duration>
      <video:publication_date>2026-09-21T07:38:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>No caption 17</video:title>
      <video:description>Free fire trend fashion #Gamesfreefiretrendfashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474113/3474113_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-21T07:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>alam Negeri Dongeng China Di Hulund Grasland Keindahan</video:title>
      <video:description>alam Negeri Dongeng China Di Hulund Grasland Keindahan Yang Sangat Menarik dan menakjubkan ketika Musim Panas Tiba #TravelChina #Donghua #Kultivator #negeriDongengChina</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474112/3474112_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-21T07:37:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cool motorbike 2</video:title>
      <video:description>Motorcycle with cool and amazing style #Flexible #cool #worldwide #travel #France #ItalyAmerica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474111/3474111_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T07:37:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alien Covenant (2017) Hindi Dubbed</video:title>
      <video:description>Alien Covenant (2017) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474110/3474110_720p.mp4</video:content_loc>
      <video:duration>7323</video:duration>
      <video:publication_date>2026-09-21T07:37:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clawed- The Legend Of Sasquatch (2005) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Clawed- The Legend Of Sasquatch (2005) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474109/3474109_720p.mp4</video:content_loc>
      <video:duration>5118</video:duration>
      <video:publication_date>2026-09-21T07:36:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon Hunter (2009) Hindi Dubbed.</video:title>
      <video:description>Dragon Hunter (2009) Hindi Dubbed.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474108/3474108_720p.mp4</video:content_loc>
      <video:duration>5668</video:duration>
      <video:publication_date>2026-09-21T07:36:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#ganeshpooja</video:title>
      <video:description>Support plz</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474107/3474107_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T07:36:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ekkadiki Pothavu Chinnavada (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Ekkadiki Pothavu Chinnavada (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474106/3474106_720p.mp4</video:content_loc>
      <video:duration>7469</video:duration>
      <video:publication_date>2026-09-21T07:36:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frog Kingdom (2013) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Frog Kingdom (2013) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474105/3474105_720p.mp4</video:content_loc>
      <video:duration>5230</video:duration>
      <video:publication_date>2026-09-21T07:36:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Guardians of the Galaxy Vol. 2 (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Guardians of the Galaxy Vol. 2 (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474104/3474104_720p.mp4</video:content_loc>
      <video:duration>8146</video:duration>
      <video:publication_date>2026-09-21T07:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ai ditolak</video:title>
      <video:description>AI #Ai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474103/3474103_720p.mp4</video:content_loc>
      <video:duration>178</video:duration>
      <video:publication_date>2026-09-21T07:36:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>IDI- Inspector Dawood Ibrahim (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>IDI- Inspector Dawood Ibrahim (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474102/3474102_720p.mp4</video:content_loc>
      <video:duration>7070</video:duration>
      <video:publication_date>2026-09-21T07:36:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kong- Skull Island (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Kong- Skull Island (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474101/3474101_720p.mp4</video:content_loc>
      <video:duration>7103</video:duration>
      <video:publication_date>2026-09-21T07:36:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Man on a Ledge (2012) Hindi Dubbed</video:title>
      <video:description>Man on a Ledge (2012) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474100/3474100_720p.mp4</video:content_loc>
      <video:duration>6143</video:duration>
      <video:publication_date>2026-09-21T07:36:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moana (2016) Hindi Dubbed</video:title>
      <video:description>Moana (2016) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474099/3474099_720p.mp4</video:content_loc>
      <video:duration>6433</video:duration>
      <video:publication_date>2026-09-21T07:36:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monster Trucks (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Monster Trucks (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474098/3474098_720p.mp4</video:content_loc>
      <video:duration>6284</video:duration>
      <video:publication_date>2026-09-21T07:36:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Norm of the North (2016) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Norm of the North (2016) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474097/3474097_720p.mp4</video:content_loc>
      <video:duration>5431</video:duration>
      <video:publication_date>2026-09-21T07:36:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Get Dressed for the Day 👕🎒 | Fun Kids Song | Nursery Rhymes for Toddlers | Lili Kids World 2</video:title>
      <video:description>Get ready for a happy new day with Lili, Riku, Bunny and Teddy! 🌞🎒 “Get Dressed for the Day” is a cheerful original nursery rhyme for toddlers and preschool children. Sing along as our friends get ready for the day, put on their shoes, pick up their school bags, and start their morning with happy smiles! 👕👟🎒 This fun kids song encourages children to learn simple daily routines through music, movement, and playful animation. 🎵 Song: Get Dressed for the Day 🌈 Channel: Lili Kids World 👧 Lili • 👦 Riku • 🐰 Bunny • 🧸 Teddy Perfect for: Toddlers and preschoolers Kids morning routines Getting ready for the day Preschool learning Fun sing-along activities Original nursery rhymes and kids songs Subscribe to Lili Kids World for more original nursery rhymes, kids songs, learning adventures, and fun sing-alongs! 🌈🎶 Learn • Sing • Smile Every Day! 💙 #getdressedfortheday #getdressedsong #kidssongsnurseryrhymes #nurseryrhymesfortoddlers #kidssongsfortoddlers #preschoolsongs #toddlersongs #babysongs #morningroutinesong #gettingdressedsongforkids #kidsmorningsong #schoolpreparationsong #preschoollearningsongs #educationalsongsforkids #funkidssongs #childrensongs #originalnurseryrhymes #originalkidssongs #singalongsongsforkidslearning #songsfortoddlers #LiliKidsWorld #LiliKidsWorldsongs #kidslearning #toddlerlearning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474096/3474096_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-21T07:35:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Mirror Has a Secret Dimension 🪞✨ | Mind-Blowing AI Magic</video:title>
      <video:description>What if your reflection lived in a completely different world? 🪞✨ A normal person approaches a mirror, but inside the reflection, everything is colorful, magical, and completely different. When the reflection picks a flower, it mysteriously passes through the mirror into the real world! 🌸😱 A cinematic 15-second journey filled with magical realism, stunning VFX, surreal transitions, and a mind-blowing final wink. ✨ #mirrordimension #magicmirror #mirrorreflection #alternatedimension #magicalmirror #AIvideo #AIgeneratedvideo #mindblowingvideo #magicalrealism #surrealvideo #fantasyVFX #mirrormagic #reflectioncomesalive #magicaltransformation #cinematicVFX #supernaturalmirror #fantasyworld #viralAIvideo #trendingAIvideo #creativeAIvideo #916verticalvideo #YouTubeShorts #viralshorts #magicaltransition #visualeffects #surrealtransformation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474095/3474095_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T07:35:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny football 5</video:title>
      <video:description>#football #funny #laugh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474094/3474094_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T07:31:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Discover Pangandaran, West Java 🇮🇩</video:title>
      <video:description>Discover Pangandaran, West Java 🇮🇩 Beyond its famous beaches, Pangandaran hides emerald rivers, tropical forests, dramatic coastal rocks, and quiet beaches waiting to be explored. From Green Canyon and Citumang to Madasari and Karapyak Beach, this is a glimpse of the lesser-known side of Indonesia. Would you add Pangandaran to your Indonesia travel list? Follow Beauty Of Indonesia Tours for more hidden destinations across Indonesia. #Indonesia #VisitIndonesia #ExploreIndonesia #Pangandaran #WestJava #WestJavaIndonesia #IndonesiaTravel #TravelIndonesia #HiddenIndonesia #HiddenGemsIndonesia #ExploreWestJava #IndonesiaTourism #TravelInspiration #BeautifulIndonesia #BeautyOfIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474093/3474093_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-21T07:30:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just Look at That Sauce—It’s Making Me Hungry! Who Would Try This? 😋</video:title>
      <video:description>Tender, flavorful fish swimming in a delicious golden-yellow sauce, topped with green chilies for an extra kick! 🤤🔥 If this dish were right in front of you, how many bowls of rice could you finish? 😆🍚 Are you Team Spicy 🌶️ or Team Mild 😋? Tell me in the comments! 👇 #yellowcurryfish #spicyfish #fishrecipe #Indonesianfood #deliciousfish #seafoodrecipe #spicyseafood #homemadefood #tastyfood #foodlovers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474092/3474092_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T07:29:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#गणेश विसर्जन🐘🐘🐘</video:title>
      <video:description>महाराष्ट्राचे शान आहे गणेश विसर्जन महाराष्ट्रात हा साजरा खूप चांगल्या पद्धतीने करतात तुम्हाला जर हा व्हिडिओ आवडला असेल तर सबस्क्राईब करा. #गणेशचतुर्थी</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474091/3474091_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T07:28:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fire 🔥 2</video:title>
      <video:description>He can #Spain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474090/3474090_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T07:27:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LINDI MINI DRESS ONE SHOULDER SEXY BODYCON PARTY DRESS</video:title>
      <video:description>BELI DI SINI https://vt.tokopedia.com/t/ZS9ABWP9SGn64-i6RCJ/ #LINDIMINIDRESSONESHOULDERSEXYBODYCONPARTYDRESS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474089/3474089_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-21T07:26:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>腾龙公司官方网站</video:title>
      <video:description>关于腾龙公司的开户与注册处理步骤操作指南 预备阶段尊敬的读者，本文将详细介绍如安在腾龙公司开户。 在开端处理总公司开户之前，需求做好以下预备工作：钉钉as84523 1. 供认公司类型：首要需求供认要开立的公司类型，包含有限责任公司、股份有限公司等。不同类型公司的开户要求可能会有所不同，因而需求先供认公司类型。 2. 了解开户银行要求：在挑选开户银行时，需求了解该银行对总公司开户的要求和标准。不同银行的要求可能会存在差异，因而需求提前咨询并了解相关要求。 3. 预备材料：根据银行要求，预备开户所需的各种材料，包含公司营业执照、组织机构代码证、税务挂号证、法人身份证明等。 在预备好以上材料之后，能够开端处理总公司开户：tl12060.com 居处是能够用作注册公司的，只要是能供给合法的运用证明，那就能够央求注册挂号。可是，关于一些影响居民安全，环境卫生的，都不能将居处地址作为公司的注册地址。 运用居处地址作为注册地址，需求供给证明，证明房子的运用者是自己，比如说，需求有房产证，央求挂号的时分需求供给复印件，上面有产权单位盖章或是有产权人签字才能够。 运用租借房子的，想要注册公司，需求有房子供给者证明，或许有租借合同，红本签字，能够不需求有房产证，可是需求证明实际情况，等供认正确之后，工商才会予以挂号注册。 #旅行</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474088/3474088_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T07:23:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O deus que amou os humanos mais do que os deuses 🔥</video:title>
      <video:description>E foi esse amor que destruiu tudo. História completa no canal 👆 #Prometeu #Mitologia #MitologiaGrega #DimensãoB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474087/3474087_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T07:22:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tilawat e Quran Majeed 142</video:title>
      <video:description>Looking for a Professional Website? Hello everyone! I’m a professional Web Developer specializing in modern, fast, and fully responsive websites tailored for businesses and individuals. 💻 Services: ✔️ Business Websites ✔️ E-commerce Stores ✔️ Trading / Crypto Platforms ✔️ Custom Web Solutions I focus on clean design, high performance, and a smooth user experience to help your business grow online. 👉 Check out my Fiverr Gigs: https://www.fiverr.com/s/jjm8wxw https://www.fiverr.com/s/WEWrwYl https://www.fiverr.com/s/yvD6XoG If you need high-quality work at a reasonable price, feel free to message me anytime! #Tilawat #Tilawatquran</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474086/3474086_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T07:20:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Highway 3</video:title>
      <video:description>Highway #Highway</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474085/3474085_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T07:20:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moon (2009) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Moon (2009) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474084/3474084_720p.mp4</video:content_loc>
      <video:duration>5822</video:duration>
      <video:publication_date>2026-09-21T07:19:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gifted (2017) Hindi Dubbed</video:title>
      <video:description>Gifted (2017) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474083/3474083_720p.mp4</video:content_loc>
      <video:duration>6070</video:duration>
      <video:publication_date>2026-09-21T07:19:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474082</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474082/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Garuda (2004) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Garuda (2004) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474082/3474082_720p.mp4</video:content_loc>
      <video:duration>6798</video:duration>
      <video:publication_date>2026-09-21T07:19:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fantastic Beasts and Where to Find Them (2016) Hindi Dubbed</video:title>
      <video:description>Fantastic Beasts and Where to Find Them (2016) Hindi Dubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474081/3474081_720p.mp4</video:content_loc>
      <video:duration>7972</video:duration>
      <video:publication_date>2026-09-21T07:19:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Despicable Me 3 (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>Despicable Me 3 (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474080/3474080_720p.mp4</video:content_loc>
      <video:duration>5381</video:duration>
      <video:publication_date>2026-09-21T07:18:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Death Warrior (2009) Hindi Dubbed Full Movie Watch Onlin HD</video:title>
      <video:description>Death Warrior (2009) Hindi Dubbed Full Movie Watch Onlin HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474079/3474079_720p.mp4</video:content_loc>
      <video:duration>5422</video:duration>
      <video:publication_date>2026-09-21T07:18:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beauty and the Beast (2017) Hindi Dubbed Full Movie Watch Online in HD</video:title>
      <video:description>Beauty and the Beast (2017) Hindi Dubbed Full Movie Watch Online in HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474078/3474078_720p.mp4</video:content_loc>
      <video:duration>7439</video:duration>
      <video:publication_date>2026-09-21T07:18:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Last Conjuring (2017) Hindi Dubbed Full Movie Watch Online HD</video:title>
      <video:description>A Last Conjuring (2017) Hindi Dubbed Full Movie Watch Online HD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474077/3474077_720p.mp4</video:content_loc>
      <video:duration>5789</video:duration>
      <video:publication_date>2026-09-21T07:18:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinematic sepeda motor</video:title>
      <video:description>Sepeda motor dengan gaya keren #Fleksibel #keren #seluruhdunia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474076/3474076_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-21T07:17:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Suasana banjir</video:title>
      <video:description>Suasana banjir di aceh #Banjir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474075/3474075_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-21T07:17:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Get ready for a happy new day with Lili, Riku, Bunny and Teddy! 🌞🎒</video:title>
      <video:description>Get ready for a happy new day with Lili, Riku, Bunny and Teddy! 🌞🎒 “Get Dressed for the Day” is a cheerful original nursery rhyme for toddlers and preschool children. Sing along as our friends get ready for the day, put on their shoes, pick up their school bags, and start their morning with happy smiles! 👕👟🎒 This fun kids song encourages children to learn simple daily routines through music, movement, and playful animation. 🎵 Song: Get Dressed for the Day 🌈 Channel: Lili Kids World 👧 Lili • 👦 Riku • 🐰 Bunny • 🧸 Teddy Perfect for: Toddlers and preschoolers Kids morning routines Getting ready for the day Preschool learning Fun sing-along activities Original nursery rhymes and kids songs Subscribe to Lili Kids World for more original nursery rhymes, kids songs, learning adventures, and fun sing-alongs! 🌈🎶 Learn • Sing • Smile Every Day! 💙 #getdressedfortheday #getdressedsong #kidssongs #nurseryrhymes #nurseryrhymesfortoddlers #kidssongsfortoddlers #preschoolsongs #toddlersongsbabysongs #morningroutinesong #gettingdressedsongforkids #kidsmorningsong #schoolpreparationsong #preschoollearningsongs #educationalsongsforkids #funkidssongs #childrensongs #originalnurseryrhymes #originalkidssongs #singalongsongsforkids #learningsongsfortoddlers #LiliKidsWorld #LiliKidsWorldsongs #kidslearningtoddlerlearning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474074/3474074_720p.mp4</video:content_loc>
      <video:duration>122</video:duration>
      <video:publication_date>2026-09-21T07:15:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mini Toy Car Race Transforms Into a Real Supercar Battle! 🏎️🔥 | Epic AI Racing</video:title>
      <video:description>What starts as an exciting miniature toy car race suddenly transforms into an insane real-life supercar battle! 🏁🔥 Watch Ferrari and Lamborghini-inspired supercars race through a neon cyberpunk city with high-speed drifting, cinematic drone shots, slow motion, speed blur, and intense racing action. The race builds to an epic finish as one car crosses the finish line and claims the WINNER title! 🏆⚡ #minitoycarrace #toycarracing #supercarrace #realsupercarracing #Ferrarirace #Lamborghinirace #cartransformation #toycartorealcar #AIcarvideo #AIracingvideo #cinematiccarrace #cyberpunkracing #neoncityrace #supercardrift #highspeedracing #racingtransformation #epiccarrace #futuristiccarrace #viralAIvideo #viralcarvideo #satisfyingtransformation #droneracingshot #slowmotioncar #speedblur #luxurysupercars #AIgeneratedvideo #YouTubeShorts #viralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474073/3474073_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T07:13:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hazrat Ali (RA) Ka Farman | Islamic Quotes #Shorts 2</video:title>
      <video:description>Hazrat Ali (RA) Ka Farman | Heart Touching Islamic Reminder | Islamic Learning 786 Is video mein Hazrat Ali (RA) ka khoobsoorat farman aur zindagi ka ek ahem sabaq share kiya gaya hai. Allah par kamil bharosa aur sabr hi har pareshani ka hal hai. Agar video pasand aaye to LIKE, SHARE aur SUBSCRIBE zaroor karein: 👉 @IslamicLearning786 #hazratalikafarman #hazrataliquotes #islamicquotesurdu #islamicstatus #islamicshorts #islamicreminder #hearttouchingislamicstatus #hazratalisayings #urduquotes #islamiclearning786 #shorts #motivationalislamicquotes #goldenwordsinurdu #deenkibaatein #farmanehazratali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474072/3474072_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T07:13:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#गणपती🪅🪅🪅</video:title>
      <video:description>गणपती विसर्जनाला महाराष्ट्रात सगळेजण जातात हा सण मोठ्या साजराने करतात कसा वाटला तुम्हाला हा व्हिडिओ सबस्क्राईब करून नोटीस करा. #रॉयलचॅलेंजगणेश</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474071/3474071_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T07:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny shots 5</video:title>
      <video:description>Monkey video #Monkeymistri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474070/3474070_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T07:11:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enjoy the beautiful evening view from the corner of the city</video:title>
      <video:description>Beautiful scenery #View #Afternoon #City</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474069/3474069_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-21T07:11:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Messi is Extremely talented</video:title>
      <video:description>Messi is extremely talented! 🇦🇷⚽🔥 Lionel Messi’s incredible football skills, close control, vision, and ability to create magical moments on the pitch continue to amaze football fans around the world. This video captures another impressive Messi moment that shows why his technique and creativity are so entertaining to watch. If you love Messi, football, soccer skills, football highlights, European football, La Liga, Champions League moments, and legendary players, this one is for you! Watch until the end and enjoy the magic! 👑⚽ #Messi #LionelMessi #MessiSkills #MessiMagic #MessiGoals #MessiHighlights #Football #Soccer #FootballSkills #SoccerSkills #FootballHighlights #SoccerHighlights #FootballFans #SoccerFans #LaLiga #ChampionsLeague #EuropeanFootball #Argentina #FootballLegend #FootballShorts #SoccerShorts #YouTubeShorts #Europe #ViralFootball</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474068/3474068_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T07:10:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amanda  dan andre nikah</video:title>
      <video:description>Artis nikah #Andre #amanda #andrenikah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474067/3474067_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-21T07:08:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tree Frogs Breeding #wildlife #Treefrog #animals #breeding</video:title>
      <video:description>Tree Frogs Breeding #wildlife #Treefrog #animals #breeding</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474066/3474066_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-09-21T07:07:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Andre wedding</video:title>
      <video:description>Andre kawin #Andredanamandanikah #amandarigby</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474065/3474065_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T07:07:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>looping mobile</video:title>
      <video:description>#mlbb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474064/3474064_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T07:05:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Penegahan karhutla</video:title>
      <video:description>Sosialisasi pencegahan membakar hutan dan lahan sembarangan #Karhutla</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474063/3474063_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T07:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Big Boss Hindi S20 Ep 15</video:title>
      <video:description>#BigBossHindiS20Ep15 #BigBossHindi #BigBoss</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474062/3474062_720p.mp4</video:content_loc>
      <video:duration>4308</video:duration>
      <video:publication_date>2026-09-21T07:04:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Concierto mañanero</video:title>
      <video:description>Marcos Antonio solis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474061/3474061_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-21T07:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ALCHEMY OF SOULS EPISODE 7 (ENG SUB) FULL HD</video:title>
      <video:description>This is an actual recording (part 2) of the show where every character is mesmerizing the audience with their astonishing acting skills and lethal face cards like HWANG HYUN MIN. The cast is crazy good at their respective jobs. AOS is so goated specifically season 1. #Alchemyofsouls #netflix #series #kdrama #Southkorean #trending #historical #funny #action #actors #acting #horror #thrill #movies #music #knowledge #friends</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474060/3474060_720p.mp4</video:content_loc>
      <video:duration>776</video:duration>
      <video:publication_date>2026-09-21T07:02:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Ganesh visarjan🪅🪅🪅</video:title>
      <video:description>गणपती विसर्जन हा आमच्या महाराष्ट्राचा सर्वात मोठा तैवार आहे. या दिवशी हा सणाला सगळेजण साजरा करतात मोठ मोठ्याने त्याची प्रार्थना करतात हा व्हिडिओ नक्की पहा तुम्हाला चांगलं वाटेल आणि सबस्क्राईब पण करा माझ्या चॅनलला. #गणेशचॅलेंज</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474059/3474059_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-21T07:01:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King Tanjakan berhadiah</video:title>
      <video:description>Perebutan sang juara tanjakan berhadiah #Perjalanan #Paris #Prancis #trailadventure #rajatanjakan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474058/3474058_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-21T07:01:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🙏🦚 Bhagavad Gita – Chapter 1 | Verse 41 🕉️</video:title>
      <video:description>#Viral #trending #shirts #reels #explore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474057/3474057_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T07:00:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angry Laundry Fails &amp; Epic Kitchen Chaos Try Not To Laugh 😂🧺</video:title>
      <video:description>From pure laundry rage and flying clothes to the funniest kitchen reactions and chaotic background fails — this one is pure chaos! Watch the faces, the throws, and the absolute meltdown energy. Can you hold it in? 🤣 Which part broke you? Drop it in the comments! #funnyfails #trynottolaugh #laundryfails #angrylaundry #kitchenchaos #couplereactions #funnypranks #laughchallenge #epicfailscompilation #funnymoments</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474056/3474056_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T07:00:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Awakening 2026 New Hindi Dubbed Horror Full Movie</video:title>
      <video:description>#TheAwakening #TheAwakening2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474055/3474055_720p.mp4</video:content_loc>
      <video:duration>5554</video:duration>
      <video:publication_date>2026-09-21T06:58:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terlihat biasa tapi JJ nya itu bikin saya kaget banget</video:title>
      <video:description>Terlihat biasa saja, tapi begitu JJ-nya keluar... aku bener-bener kaget banget! 😱🔥 Siapa sangka di balik tampilan yang sederhana ada kejutan yang luar biasa? Tonton sampai habis ya! 🤩</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474054/3474054_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-21T06:58:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You won’t believe how incredible the sky looks!</video:title>
      <video:description>You won’t believe how incredible the sky looks! 😱🌌 At first, it seemed completely normal… but then something unusual appeared. Nature really knows how to surprise us! 😍 What do you think is happening here? Have you ever seen a sky like this before? 👀👇 Drop your guess in the comments! #amazingsky #strangeskyphenomenon #beautifulsky #unbelievablenature #mysterioussky #rareskyphenomenon #stunningnature #viralskyvideo #incrediblemoment #caughtoncamera</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474053/3474053_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T06:58:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>👀 Watch till the end—the final moment changes everything!</video:title>
      <video:description>A mysterious encounter by the water becomes an unforgettable moment when a little girl faces something she never expected. 😳✨ What happens next will keep you watching until the very end! 👀 Watch till the end—the final moment changes everything! ❤️ Like | 💬 Comment | 🔄 Share | 🔔 Follow for more amazing movie moments! #ViralReels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474051/3474051_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-21T06:57:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hafizabad district of Rice and Canal</video:title>
      <video:description>District Hafizabad #Hafizabad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474050/3474050_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T06:56:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bts videos 2</video:title>
      <video:description>Bts videos 🫣🫢 #usacanadafrance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474049/3474049_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T06:55:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keindahan alam Negeri Dongeng China Di Yellow Montain</video:title>
      <video:description>Keindahan alam Negeri Dongeng China Di Yellow Montain di Huangshan Adalah Sebuah Gunung yang Ekonik yang Dikenal Sebagai Gunung Granit Paling Bagus dan Luar Biasa #TravelChina #DonghuaKultivator #negeriDongengChina</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474048/3474048_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-21T06:52:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grandpa and the panda bear</video:title>
      <video:description>a bear acting cute #Grandpaandpandabearcanbefriends</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474047/3474047_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-21T06:52:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>جواهردوزی</video:title>
      <video:description>جواهردوزی روی لباس https://www.instagram.com/reel/DdeoobsqMmg/?stkn=aWE5bTg4MGpmaTNx #جواهردوزی،پنلکارشده</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474046/3474046_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T06:51:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny momment 7</video:title>
      <video:description>#funny #laugh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474045/3474045_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-21T06:50:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Big pig Will fall</video:title>
      <video:description>#piganimalfallbigpig</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474044/3474044_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T06:49:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bang billy</video:title>
      <video:description>Hiburan #Bangbillysaputra #vikakolesnaya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474043/3474043_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-21T06:49:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fase Maskumambang.</video:title>
      <video:description>Fase Maskumambang adalah Fase pertama dalam siklus kehidupan Manusia, yaitu Janin yang dirahim. Maskumambang berasal dari kata Emas &amp; Kemambang, bermakna Emas yang mengambang. Dimana cahayanya terpancar menumbuhkan harapan,agar kelak janin terlahir dengan sehat, dan sebelum dirawat penuh ketulusan,kesabaran.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474042/3474042_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-21T06:48:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amanda vs andre</video:title>
      <video:description>Amanda ruby, andre taulani, podcast #Amandaruby #andretaulani #podcast</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474041/3474041_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-21T06:47:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deus Luta por Ti</video:title>
      <video:description>Entrega a tua batalha a Deus. Ele é o teu defensor. 🙏</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474040/3474040_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-21T06:46:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Faça isso e tudo vai mudar....</video:title>
      <video:description>#brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474039/3474039_720p.mp4</video:content_loc>
      <video:duration>1344</video:duration>
      <video:publication_date>2026-09-21T06:46:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sampo terbaik</video:title>
      <video:description>Sampo anti ketombe, bikin rambut berkilau #Sampo #vitaminrambut #kondisioner</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474038/3474038_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-21T06:45:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Menikmati Tenangnya Alam dari Ketinggian 🌿⛰️”</video:title>
      <video:description>Di antara dinginnya udara dan luasnya pemandangan, ada ketenangan yang sulit dijelaskan dengan kata-kata. Kadang kita hanya perlu berhenti sejenak, menikmati perjalanan, dan bersyukur masih bisa melihat indahnya dunia. 🌿⛰️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474037/3474037_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T06:44:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perapihan pasangan septoteng</video:title>
      <video:description>Pasangan batata.perapihan septiteng #Pekerjaserabutanperapihanpasangan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474036/3474036_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-21T06:44:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeons &amp; Dragons Honor of The Thieves</video:title>
      <video:description>Dungeons &amp; Dragons Honor of The Thieves</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474035/3474035_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-21T06:43:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love Anchored on the Horizon at Sunset</video:title>
      <video:description>A glass heart stands upon the calm ocean, reflecting the beauty of the sunset within it. In the distance, a ship sails beneath a sky adorned with clouds and stars, creating a romantic and meaningful atmosphere filled with beauty and wonder.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474034/3474034_720p.mp4</video:content_loc>
      <video:duration>135</video:duration>
      <video:publication_date>2026-09-21T06:42:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ああ、うまくいくかどうか心配だ！</video:title>
      <video:description>さあ、どうぞ、受け取ってみてください。</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474033/3474033_720p.mp4</video:content_loc>
      <video:duration>143</video:duration>
      <video:publication_date>2026-09-21T06:42:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours Episode 4 Kdrama in Hindi</video:title>
      <video:description>A Love Other Than Yours Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474032/3474032_720p.mp4</video:content_loc>
      <video:duration>3882</video:duration>
      <video:publication_date>2026-09-21T06:42:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bunda maya</video:title>
      <video:description>Podcast maya estianti #Mayaestianti #sipahaju</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474031/3474031_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-09-21T06:42:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice video 801</video:title>
      <video:description>41465.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474030/3474030_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-21T06:41:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cracken</video:title>
      <video:description>Kraken: o monstro misterioso dos mares! 🌊🐙 Uma criatura lendária que atravessa gerações, cercada de histórias, mistérios e relatos sobre um gigantesco ser escondido nas profundezas do oceano. Você teria coragem de encontrar o Kraken? 👀🌊 #CRACKEN</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474029/3474029_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-21T06:40:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesian nature 2</video:title>
      <video:description>Karang Mountain, located in Banten Province, Indonesia, is one of Indonesia&apos;s natural beauties. #nature #mountains #peaks #forests #tourism #climbingKirimmasukan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474028/3474028_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-21T06:40:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#प्रकृती नेचर</video:title>
      <video:description>प्रकृती नेचर ही महाराष्ट्राची शान आहे सर्वजण महाराष्ट्रात राहायला विनंती करतात सबस्क्राईब करा माझ्या चॅनलला आणि व्हिडिओ पहा #चॅलेंजिंगनेचर</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474027/3474027_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-21T06:40:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keindahan alam Negeri Dongeng China Di Mount Sangqing</video:title>
      <video:description>Keindahan alam Negeri Dongeng China Di Mount Sangqing yang Disebut Gunung Mount Sangqing Jiangxi Adalah Sebuah Gunung Yang Menakjubkan Dan Begitu Terkenal Dan Diakui oleh UNESCO Yang terkenal sebagai Gunung Granit Yang Paling Bagus #TravelChina #Donghua #Kultivator #negeriDongengChina</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474026/3474026_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-21T06:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinematic 52</video:title>
      <video:description>Cinematic sepeda motor #italyfrancs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474025/3474025_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-21T06:38:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Port days 2</video:title>
      <video:description>Activities in the port everyday is always busy #sailing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474024/3474024_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-21T06:38:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gaban humilla a Sommers 🔥🔥🔥</video:title>
      <video:description>#Onepiece #Gaban #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474023/3474023_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-21T06:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3474022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3470000/3474022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A sensação fora do corpo que quase ninguém fala.</video:title>
      <video:description>Fora do corpo o projetor astral é tomado de inúmeros sentimentos que podm variar de acordo com a idade eo grau de maturidade,quanto mais projeções mais ele vai dominar as suas emoções,neste vídeo você vai ficar por dentro de cinco sensações para não ser pêgo de surpresa.#viagemastral #desdobramento #projeciologia #projeçãodaconsciência #Viagemastral #projeçãodaconsciência #desdobramento #projeciologia #projeçãoastral #EQM</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3470000/3474022/3474022_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-21T06:36:22+02:00</video:publication_date>
    </video:video>
  </url>
</urlset>
