<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"
        xmlns:video="http://www.google.com/schemas/sitemap-video/1.1">
  <url>
    <loc>https://www.febspot.com/video/3516913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny vedio 48</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516913/3516913_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T12:06:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Gotta check myself in the mirror before the race. 🏎️💨😂”</video:title>
      <video:description>“McQueen checks himself in the mirror: ‘Damn, I look good.’ One second later: FULL SEND! 🏎️💨😂” #LightningMcQueenCarsDisneyCarsRacingRaceDayCarTokCarsTokFunnyCarsMcQueenSpeedKaChowBeforeTheRaceCarMemesViralFYP</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516912/3516912_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T12:05:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngopi dulu biar pintar 🤣🤣🤭</video:title>
      <video:description>Kopi hitam #Kopihitam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516911/3516911_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T12:04:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>آزاد کشمیر کی آواز</video:title>
      <video:description>Muntazir Nazir · Original audio 🏡📷❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516910/3516910_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T12:04:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ajwa bewafa</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516909/3516909_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T12:04:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>i was your robot companion, you&apos;re my fav color😌💕</video:title>
      <video:description>Gethsemane - Sleep token #sleeptoken #Gethsemane #metal #alt #rock #music #song #piano #isolated #onlyvocal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516908/3516908_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T12:04:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hotel di bandung</video:title>
      <video:description>Cihampelas memang rame banget nginepnya di hoyel #perjalanan #hotel #bandung #rame</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516907/3516907_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T12:03:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FREE FIRE BR MODE RANK PUSH</video:title>
      <video:description>Join me for an exciting Free Fire LIVE gameplay session! Watch intense fights, clutch moments, amazing kills, and hopefully some BOOYAH! Like the stream Chat with me during the live Share the stream with your friends! Let&apos;s reach the next milestone together! #Freefire #gameplay #rankpush</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516906/3516906_720p.mp4</video:content_loc>
      <video:duration>3269</video:duration>
      <video:publication_date>2026-10-05T12:03:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Artist Draws Stunning Pictures With a Typewriter! 🤯⌨️</video:title>
      <video:description>What looks like an ordinary typewriter is actually a unique artistic tool! 🤯🎨 Watch as an artist creates incredibly detailed drawings using nothing but a typewriter, transforming individual characters and keystrokes into a remarkable work of art. Set inside a beautiful theater, this fascinating technique shows how creativity can turn an everyday machine into something extraordinary. Would you have the patience to create art like this? 👀🔥 #typewriterart #typewriterdrawing #drawingwithatypewriter #artwithtypewriter #typewriterartist #typewriterartwork #creativeart #uniqueart #amazingart #unusualart #artistictechnique #traditionalart #mechanicalart #livedrawing #liveart #detaileddrawing #creativedrawing #artinnovation #incredibleart #satisfyingart #handmadeart #artisticcreativity #fascinatingart #vintagetypewriter #typewritercreativity #artperformance #theaterart #visualart #drawingtechnique</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516905/3516905_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T12:03:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aku suka banget warna hitam</video:title>
      <video:description>Warna hitam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516904/3516904_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T12:02:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Laboratory Room (Reward: 1 Chaos Drop) 100% Solved (Check Pinned Comments for Steps) | Brawl Stars🤩🔥</video:title>
      <video:description>LABORATORY ROOM — 100% SOLVED! 🧪✅ | Brawl Stars The Laboratory Room has been fully solved! 🔬⚡ Watch the complete Brawl Stars gameplay and discover how the Laboratory Room challenge is completed from start to finish. If you&apos;re exploring Mortis&apos; Mortuary, unlocking rooms, completing challenges, or looking for the best way to solve the Laboratory Room, this video is for you! 🔥 In this video: • Laboratory Room 100% Solved • Mortis&apos; Mortuary gameplay • Brawl Stars challenge walkthrough • Room unlocking &amp; progression • Tips for completing the Laboratory • Full gameplay &amp; solution 🎮 Game: Brawl Stars 🧪 Challenge: Laboratory Room 💯 Completion: 100% Solved 👍 Like the video if this helped you! 💬 Comment which room/challenge I should solve next. 🔔 Subscribe for more Brawl Stars gameplay, challenges, updates &amp; guides! #brawlstars #brawlstarsgameplay #brawlstarslaboratory #laboratoryroombrawlstars #laboratoryroom100solved #brawlstarslaboratoryroom #mortismortuary #mortismortuarybrawlstars #brawlstarsmortismortuary #brawlstarschallenge #brawlstarschallenges #brawlstarsguide #brawlstarswalkthrough #brawlstarstutorial #brawlstarsnewupdate #brawlstarsupdate #brawlstarsevent #brawlstarsroom #laboratorybrawlstars #mortisbrawlstars #brawlstarssolution #brawlstars100solved #brawlstarsgameplay2026 #supercellbrawlstars #brawlstarstips #brawlstarssecrets #brawlstarsnewevent</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516903/3516903_720p.mp4</video:content_loc>
      <video:duration>123</video:duration>
      <video:publication_date>2026-10-05T12:02:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 22</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516902/3516902_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T12:02:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vice Sargodha 15</video:title>
      <video:description>Feroz Khan · Dil 🙏🙏🙏😢😢😢</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516901/3516901_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T12:02:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bantuan Air bersih</video:title>
      <video:description>Kemarau panjang kekeringan, bantuan air bersih #waterkemarau</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516900/3516900_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T12:02:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🦁🦁 Stunning Lion 🦁🦁.mp4.2026</video:title>
      <video:description>🦁🦁 Stunning Lion 🦁🦁.mp4 #🦁🦁StunningLion🦁🦁mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516899/3516899_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T12:01:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arora tiktok 2</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516898/3516898_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T12:01:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How much 3</video:title>
      <video:description>Old #France</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516897/3516897_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T12:01:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beef Bhuna &amp; Smoky Aloo Bhorta | Traditional Bangladeshi Village Cooking ASMR 🍛🔥</video:title>
      <video:description>Step into a peaceful Bangladeshi village kitchen 🌿🏡 as she prepares a delicious traditional Beef Bhuna, Smoky Aloo Bhorta, and Steaming Rice over a rustic matir chula. 🔥🍛 From washing and chopping fresh ingredients to slowly cooking the rich, spicy beef and preparing the smoky bhorta, every moment captures the warmth of traditional village cooking. 🎧✨ Enjoy the relaxing sounds of sizzling mustard oil, chopping, crackling fire, and peaceful rural ambience. #Bangladeshibeefbhuna #beefbhunarecipe #Bangladeshibeefrecipe #traditionalBangladeshicooking #Bangladeshivillagecooking #beefcurryBangladesh #aloobhorta #smokyaloobhorta #Bangladeshifood #Bengalifood #Bengalicooking #ruralBangladesh #villagefood #villagecookingASMR #BangladeshifoodASMR #cookingASMR #traditionalclaystovecooking #matirchulacooking #desifood #spicybeefcurry #beefandpotatocurry #authenticBangladeshifood #cozyvillagecooking #relaxingcookingvideo #Bangladeshivillagelife #traditionalvillagefood #Ghiblistylecooking #GhiblicookingASMR #AIcookinganimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516896/3516896_720p.mp4</video:content_loc>
      <video:duration>112</video:duration>
      <video:publication_date>2026-10-05T12:01:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monkey vs dog 3</video:title>
      <video:description>#Monkey #dog #lucu #videolucu #monyetlucu #anjinglucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516895/3516895_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T12:00:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagal melompat</video:title>
      <video:description>Saya gagal melompat akhirnya saya jatuh dan labgsung makan #Funyvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516894/3516894_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T12:00:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sara cute princes 7</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516893/3516893_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T12:00:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mezametara Saikyou Soubi to Uchuusenmochi Datta node, Ikkodate Mezashite Youhei toshite Jiyuu ni Iki</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516892/3516892_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-10-05T12:00:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Symphony of the Countryside: Wind and Chirping Birds Harmony</video:title>
      <video:description>A scenic view of vast and lush rice fields in a peaceful village, backed by green trees and local houses. The atmosphere comes alive with the gentle sound of rushing wind accompanied by the natural symphony of chirping birds echoing across the landscape #villagescenery #ricefields #rushingwind #chirpingbirds #natureharmony #countrysideambiance #peacefulnature #naturalsoundscape #rurallandscape #freshair</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516891/3516891_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T12:00:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Push comel</video:title>
      <video:description>Comel #capcutcapcutpioneerpioneertemplate</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516890/3516890_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T11:58:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>teacher day status</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516889/3516889_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T11:58:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ok! This About the Olympic Opening Ceremony is 😨🤯</video:title>
      <video:description>Ok! This About the Olympic Opening Ceremony is 😨🤯 #Satanic #Olympic #viral #OpeningceremonyOlimpic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516888/3516888_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T11:57:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ojisan wa Kawaii Mono ga Osuki Episodes 1</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516887/3516887_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-10-05T11:57:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bisa. Gemoy</video:title>
      <video:description>Cara makan sapi supaya cepat gemuk #hewan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516886/3516886_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T11:57:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waseem tariq 6</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516885/3516885_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T11:57:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny jokes 3</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516884/3516884_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T11:56:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rambo sahiba</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516883/3516883_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T11:55:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relaxing Lakeside Campfire at Sunset - Crackling Fire Sounds for Sleep &amp; Peace | 4K</video:title>
      <video:description>Find your peace with this beautiful lakeside campfire at sunset. The sound of crackling fire combined with a golden sunset over the calm lake is perfect for relaxation, stress relief, meditation, and deep sleep. Filmed in 4K at the lake during golden hour. Pure nature sounds, no music. 🔔 Subscribe for more relaxing fireplace and nature videos every day. Where are you watching from? Let me know in the comments! #fyphealingsunsetcampfireapiunggundanausenjagoldenhourrelaxingnatureaestheticcozybonfirecampingoverthinkingtenangmasukberanda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516882/3516882_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:55:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seitokai ni mo Ana wa Aru! Episodes 1</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516881/3516881_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-10-05T11:55:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That&apos;s brother...</video:title>
      <video:description>a man&apos;s greatest blessing? you should agree with this #friends #boys #men #blessing #run #jogging #thought #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516880/3516880_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:55:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Janagana mano</video:title>
      <video:description>#Janaganamano</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516879/3516879_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T11:55:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Insane Rooftop Parkour 🔥 1v4 Clutch You Won&apos;t Believe 💀</video:title>
      <video:description>This is the craziest COD Warzone parkour and close combat clutch I have ever seen! Insane FPS skills, non-stop action and unbelievable ending. Watch till the end - this rooftop fight is pure chaos! Follow for more viral gaming moments USA. #gaming #callofduty #warzone #codgameplay #fps #clutch #parkour #viralgaming #usagaming #insanemoments #gaminghighlights #shooter</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516878/3516878_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-10-05T11:54:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gulwareeenaa 3</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516877/3516877_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-05T11:54:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baba Khabri</video:title>
      <video:description>Aaj Meri Khair Nahi 😩😩😩</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516876/3516876_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:53:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🦒🦁 Lions Feast On A Giraffe 🦁🦒.mp4.2026</video:title>
      <video:description>🦒🦁 Lions Feast On A Giraffe 🦁🦒.mp4 #🦒🦁LionsFeastOnAGiraffe🦁🦒mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516875/3516875_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T11:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ingat kawan</video:title>
      <video:description>Tanpa uang kamu tidak istimewa #Travelparisprancis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516874/3516874_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T11:52:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny videos</video:title>
      <video:description>United states #Fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516873/3516873_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T11:52:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>English 14</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516872/3516872_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T11:52:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ritu Gupta</video:title>
      <video:description>Tu hi Haqeeqat 💕</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516871/3516871_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-10-05T11:52:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yasei no Last Boss ga Arawareta! 2nd Season Episodes 2</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516870/3516870_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-10-05T11:52:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m girls</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516869/3516869_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T11:51:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eit ga kena 🤣</video:title>
      <video:description>#Komedi #lucu #videolucu #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516868/3516868_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T11:51:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Creative By Samia 3</video:title>
      <video:description>زیرو سے 50+ سال تک کی پرفیکٹ کٹنگ! اب گھر بیٹھے ہر سائز کی بالکل درست پیمائش سیکھیں ✂️👗</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516867/3516867_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T11:50:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 21</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516866/3516866_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:50:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>new Malik goat farm</video:title>
      <video:description>اپنی بکریوں کو یہ ٹیکہ لگوائیں ورنہ پچھتاوا ہو گا PPR</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516865/3516865_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T11:49:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>English 13</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516864/3516864_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T11:49:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Croatia vs england</video:title>
      <video:description>Score 0-7 #FootballEnglandCroatia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516863/3516863_720p.mp4</video:content_loc>
      <video:duration>195</video:duration>
      <video:publication_date>2026-10-05T11:49:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Magical Green Fire Campfire - Real Chemical Fire Burning at Night | Satisfying &amp; Relaxing</video:title>
      <video:description>This is a real campfire with green flames burning at night. This rare phenomenon happens when copper or chemicals are burned, creating a magical green fire effect. Watch the mesmerizing green and orange flames dance in the dark. Perfect for relaxing, satisfying, and magical atmosphere. Is this magic or science? Comment what you think below! 🔥 Watch more relaxing fire videos on my channel. Don&apos;t forget to SUBSCRIBE! #fypapiunggungreenfireapihijaucampfiremagicalsatisfyingoddlysatisfyingrarefirebonfireviralmagicalfiremisteriaesthetic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516862/3516862_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T11:49:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hayat Khan</video:title>
      <video:description>✨Premium Modern Wardrobe &amp; Dressing Unit Design ✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516861/3516861_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:48:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Burna boy 👽</video:title>
      <video:description>Concert</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516860/3516860_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T11:48:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dengan kerang ajaib</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516859/3516859_720p.mp4</video:content_loc>
      <video:duration>508</video:duration>
      <video:publication_date>2026-10-05T11:48:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yawar Abbas</video:title>
      <video:description>Shagir mining area …</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516858/3516858_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-05T11:47:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice vedio 71</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516857/3516857_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T11:47:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doraemon: Nobita and the New Castle of the Undersea Devil 2026 Line Dual Audio WEB-DL | Hindi Full M</video:title>
      <video:description>Download Doraemon: Nobita and the New Castle of the Undersea Devil 2026 Line Dual Audio WEB-DL | Hindi Full Movie! Released in (2026), this Movie is available in the following formats: 1080p UHD 60FPS 4K HDR (2160p) 1080p x265 10Bit 4K SDR Movies &amp; TV Series Get fast and secure Google Drive Direct Download Links with BluRay 720p - 480p - 1080p , available in . Perfect for . Vegamovies provides fast and secure G-Drive links for: 4K Dual Audio Movies 1080p Dual Audio Movies Hindi Dubbed HQ Movies Top IMDb Movies Click below to start your download! Watch Doraemon: Nobita and the New Castle of the Undersea Devil 2026 Line Dual Audio WEB-DL | Hindi Full Movie Online #HindiDubbedHQMovies #Doraemon #doraemonmovie #dorimonmovie #cartoonmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516856/3516856_720p.mp4</video:content_loc>
      <video:duration>6112</video:duration>
      <video:publication_date>2026-10-05T11:47:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎶RISE AGAIN</video:title>
      <video:description>RISE AGAIN BY: CRA MUSIC PRODUCTIONS #music #reggae #riseagain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516855/3516855_720p.mp4</video:content_loc>
      <video:duration>313</video:duration>
      <video:publication_date>2026-10-05T11:46:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dek Anggi cantik</video:title>
      <video:description>✨ Sekadar hiburan tentang kecantikan 🌸 Menikmati sisi indah, anggun, dan menarik dari setiap perempuan. 💕 Bukan untuk membandingkan, hanya untuk menikmati keindahan dan berbagi vibes positif. 🌷✨ #hiburananggivideocewecewecantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516854/3516854_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:46:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fox Street Auto</video:title>
      <video:description>1976 Lincoln Continental w/ 88k original miles available at</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516853/3516853_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T11:44:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asian girl hot</video:title>
      <video:description>Asian gi #america</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516852/3516852_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T11:44:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What a German Panzer Advance Looked Like at Kursk in 1943</video:title>
      <video:description>What a German Panzer Advance Looked Like at Kursk in 1943 A WWII-style recreation inspired by German newsreel footage of armored units and infantry advancing during Operation Citadel at Kursk in July 1943. #WhataGermanPanzerAdvanceLookedLikeatKurskin1943AWWII-stylerecreationinWWIIBattleOfKurskOperationCitadelMilitaryHistoryworldwar2</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516851/3516851_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T11:43:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>IAN h2h💖</video:title>
      <video:description>출처 : 이안의 챗GPT와 통화를 시켜드리도록 하겠습니다ᯓ★ Hearts2Hearts 하츠투하츠 2026 TMElive International Music Awards BH2ND/ 귀여워귀여워/ 언니강아 동생강아 #IANh2h</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516850/3516850_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T11:43:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Late afternoon atmosphere at the toll gate</video:title>
      <video:description>Video showing the toll gate and traffic congestion on the toll road. #Travel #truck #truckcomunity</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516849/3516849_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T11:43:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Golden Sunset Over the Lake 🌅 | Peaceful Nature Views &amp; Relaxing Vibes #Shorts</video:title>
      <video:description>Watch this breathtaking golden sunset glowing over the peaceful lake. 🌅✨ The warm orange sky, calm water, and beautiful natural scenery create a relaxing and aesthetic moment that is perfect for unwinding and enjoying the beauty of nature. Take a moment to relax, enjoy the peaceful sunset vibes, and let the scenery brighten your day. 🌊🧡 If you love beautiful sunsets, peaceful nature, relaxing scenery, and aesthetic videos, don&apos;t forget to Like, Comment, Share, and Subscribe for more amazing Shorts! #aestheticvideo #beautifulmoments #trendingvideo #viralshorts #relaxingvibes #aestheticlifestyle #beautifulvisuals #YouTubeShorts #trendingshorts #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516848/3516848_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T11:42:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Urban Legend - Nyi Roro Kidul Sang penguasa laut selatan</video:title>
      <video:description>Konon, di balik luasnya Laut Selatan Jawa, ada sosok misterius yang dipercaya sebagai penguasanya… Nyi Roro Kidul. 🌊👑 Benarkah ia hanya legenda, atau ada kisah mengerikan yang tersembunyi di balik mitos tersebut? Saksikan sampai akhir dan temukan sisi misterius Sang Penguasa Laut Selatan. 👻</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516847/3516847_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T11:42:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teskilat-S7-EP187-720p</video:title>
      <video:description>Teskilat-S7-EP187-720p</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516846/3516846_720p.mp4</video:content_loc>
      <video:duration>8353</video:duration>
      <video:publication_date>2026-10-05T11:41:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Allahuma barik</video:title>
      <video:description>Bismillah viralkan #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516845/3516845_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T11:41:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freefire 35</video:title>
      <video:description>Gameplay #FreeFireFreeFireBrasilGarenaFreeFireSCHICOFreeFireBooyahFreeFireMobileFreeFireGameFreeFireHeadshotFreeFireProFreeFireSquadFreeFireGameplayFreeFireAoVivoGamerBRJogoMobileFreeFireDicasFreeFireHighlights</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516844/3516844_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T11:40:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Curug 3</video:title>
      <video:description>Pemandangan #CikupaTangerangIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516843/3516843_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T11:39:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kelakuan anak muda jaman now</video:title>
      <video:description>Anak muda ugal ugalan naik motor sambil membawa sajam , ditendang oleh pemotor lain 😅 #Instantkarma</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516842/3516842_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T11:38:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Octopus stuck to her belly while snorkeling</video:title>
      <video:description>Emma was just swimming… and an octopus latched onto her belly without her noticing! Her reaction is hilarious Have you ever had something like this happen in the sea? #octopussnorkelingdivingreactionfunnyseavacationsurpriseviraloceanpregnantpregnancypregnantbellybumplifemomtobe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516841/3516841_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T11:38:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Entertainment 239</video:title>
      <video:description>Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516840/3516840_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T11:37:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Entertainment 238</video:title>
      <video:description>Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516839/3516839_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T11:37:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kamran Team 2</video:title>
      <video:description>Dogesh bhai rocked. Chor Shocked 🤯</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516838/3516838_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T11:37:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Entertainment 237</video:title>
      <video:description>Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516837/3516837_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:37:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Entertainment 236</video:title>
      <video:description>Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516836/3516836_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:36:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Entertainment 235</video:title>
      <video:description>Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516835/3516835_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gowes Bareng Sabtu Pagi</video:title>
      <video:description>Gowes pagi bersama komunitas gowes PCC #GowesPrabumulihPCCOK</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516834/3516834_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-05T11:36:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Entertainment 234</video:title>
      <video:description>Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516833/3516833_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T11:34:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosmic Inflation: The Universe’s Rapid Expansion</video:title>
      <video:description>Cosmic inflation describes a brief period when the early universe expanded extraordinarily fast. This rapid expansion may explain why the universe appears remarkably uniform and why tiny quantum fluctuations became the seeds of galaxies and cosmic structures. Scientists continue studying inflation to understand what happened during the universe’s earliest moments. #CosmicInflationEarlyUniverseBigBangSpaceFactsAstronomyCosmologyUniverseSpaceScienceQuantumPhysicsAmazingUniverse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516832/3516832_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:33:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Swati Rana 42</video:title>
      <video:description>Rohail Hyatt;Faisal Rafi;Rahat Fateh Ali Khan · Jiya Dhadak Dhadak Jaye</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516831/3516831_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:32:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>এত অল্প বয়সে চায়ের দোকানদার</video:title>
      <video:description>এত অল্প বয়সে চায়ের দোকানদার</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516830/3516830_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T11:31:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ginjal</video:title>
      <video:description>Penyakit ginjal kronis stadium 1-3 biasanya tanpa gejala, stadium 4-5 biasanya ada keluhan lemes, sesek, bengkak, dan gejala yg mgk jarang kalian duga spt diatas.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516829/3516829_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-10-05T11:31:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Massive Fish Appeared From the Darkness 🌊🐟</video:title>
      <video:description>A peaceful underwater dive turns into an incredible close-up encounter with a giant reef fish—and the discovery gets even more surprising #underwatervideo #oceanwildlife #giantfish #marinelife #scubadiving #underwaterdiscovery #reeffish #wildlifevideo #oceanadventure #naturevideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516828/3516828_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:31:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CARS &amp; Friends</video:title>
      <video:description>CARS dkk is a community created to build friendships, strengthen relationships, and share memorable moments together. It’s not just about gathering, but also about creating meaningful connections, supporting one another, and enjoying good times together. With the spirit of friendship and togetherness, CARS dkk is a place to meet, share experiences, have fun, and create unforgettable memories. CARS dkk — One community, many stories, one family. #GatheringAssociationCommunityFriendship</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516827/3516827_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:31:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beach in a pangandaran indonesia</video:title>
      <video:description>View beach in pangandaran at evening #Beach #pangandaran #indonesia #hollyday</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516826/3516826_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T11:30:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>THE PROCESSING OF THE PARINARI CURATELLIFOLIA(CHAKATA)(MOBOLA) DRINK</video:title>
      <video:description>From Wild Fruit to Traditional Drink | Chakata (Mobola) Processing 🥤🌳 Discover the fascinating traditional process of turning Chakata (Hacha/Mobola) fruit, scientifically known as Parinari curatellifolia, into a refreshing traditional drink in a rural Zimbabwean setting. This video takes you through the journey from harvesting the ripe fruit, preparing and processing it, and producing the traditional drink using knowledge passed down through generations. More than just a drink, Chakata represents a beautiful connection between nature, traditional food practices, rural life, and Zimbabwean cultural heritage. 🌍 Come and experience this traditional process and discover how communities make use of the natural fruits found in their surroundings. Nature provides. Tradition preserves. Culture keeps the story alive. ❤️🌿 #CHAKATA #HACHAFRUIT #MOBOLAPLUM #PARINARICURATELLIFOLIA #TRADITIONALDRINK #ZIMBABWEANFOOD #TRADITIONALFOODS #AFRICANFOOD #RURALZIMBABWE #ZIMBABWEANCULTURE #AFRICANHERITAGE #WILDFRUITS #INDEGENOUSFRUITS #TRADIONALKNOWLEDGE #AFRICANVILLAGE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516825/3516825_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:30:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#thefunnyVideo#3</video:title>
      <video:description>Superrrrngakakk 😅😅🤭🤭😁😁😁 #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516823/3516823_720p.mp4</video:content_loc>
      <video:duration>494</video:duration>
      <video:publication_date>2026-10-05T11:28:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Soldier Became Father to an Alien Child — Now They Must Survive Something Worse</video:title>
      <video:description>A Soldier Became Father to an Alien Child — a full-length survival sci-fi movie from Lumz Cinema (2026, English, 4K). Watch the complete film free. The only survivor of a military crash on a frozen alien planet. A creature hunting him through the storm. And a cave where he finds the last thing he expected — a pregnant alien woman, hiding from the same humans he came with. One cave. One impossible child. And a choice that will turn him against his own army. A full AI movie for fans of alien survival films, sci-fi drama and stories like Avatar, The Martian and Enemy Mine. #AlienMovieFullMovieSciFiMovieSurvivalMovieSciFiAIMovieFullMovieEnglish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516822/3516822_720p.mp4</video:content_loc>
      <video:duration>2170</video:duration>
      <video:publication_date>2026-10-05T11:27:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>anak harimau ditemukan mengapung</video:title>
      <video:description>TEGANG detik-detik anak harimau ditemukan mengapung #animal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516821/3516821_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:27:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hidden place in earth</video:title>
      <video:description>i found it hidden place in earth #travel #adventure #exploring</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516820/3516820_720p.mp4</video:content_loc>
      <video:duration>1203</video:duration>
      <video:publication_date>2026-10-05T11:26:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#thefunnyVideo#2</video:title>
      <video:description>😁😁😁😀😀😀ngakakkkkdech #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516819/3516819_720p.mp4</video:content_loc>
      <video:duration>485</video:duration>
      <video:publication_date>2026-10-05T11:26:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>@fypppppp</video:title>
      <video:description>Strange woman call his name #fypppp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516818/3516818_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T11:25:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#thefunnyVideo#1</video:title>
      <video:description>Ngakakkkk dechh #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516817/3516817_720p.mp4</video:content_loc>
      <video:duration>484</video:duration>
      <video:publication_date>2026-10-05T11:24:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>71 of the Craziest Nature Clips Ever</video:title>
      <video:description>Hello everyone, this is YOUR Daily Dose of Internet. In this video, these are the craziest nature videos of the decade. Waves crash over two story condos, a massive glacier collapses in Iceland, and filmmakers are caught in a terrible avalanche. There&apos;s also a volcanic eruption in Papua New Guinea and a sinkhole swallowing a football field. #disaster #nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516816/3516816_720p.mp4</video:content_loc>
      <video:duration>969</video:duration>
      <video:publication_date>2026-10-05T11:24:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivasi 229</video:title>
      <video:description>Motivasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516815/3516815_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T11:23:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wanted to know.the truth</video:title>
      <video:description>Behind his father death #fypeveveryonefebspotfebspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516814/3516814_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T11:22:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soul Land (Douluo Dalu) Season 2 Episode 16 English Subbed</video:title>
      <video:description>Soul Land (Douluo Dalu) Season 2 Episode 16 English Subbed #Tangsan #XiaoWu #DaiMuBai #Shrek #Douluo #Dalu #SoulLand #Donghua #Chinese #Anime #XiaoYan #Lindong #MuChen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516813/3516813_720p.mp4</video:content_loc>
      <video:duration>1265</video:duration>
      <video:publication_date>2026-10-05T11:22:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Found another son</video:title>
      <video:description>His father other son #fypp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516812/3516812_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T11:20:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motorcycle 20</video:title>
      <video:description>Motorcycle #Motorcycle #priamalam #anakmotor #motor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516811/3516811_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T11:20:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GOYANG PARAH</video:title>
      <video:description>Joss jisa #Hiburan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516810/3516810_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T11:20:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>@fyppppp</video:title>
      <video:description>Encounter with there father</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516809/3516809_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T11:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP10-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love drama #action #romance #story #love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516808/3516808_720p.mp4</video:content_loc>
      <video:duration>2746</video:duration>
      <video:publication_date>2026-10-05T11:18:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Urban Miracle Doctor Eps 202</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516807/3516807_720p.mp4</video:content_loc>
      <video:duration>694</video:duration>
      <video:publication_date>2026-10-05T11:14:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DHA Cambridge Campus</video:title>
      <video:description>DHA Cambridge Campus · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516806/3516806_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T11:13:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tales of Herding Gods Eps 96</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516805/3516805_720p.mp4</video:content_loc>
      <video:duration>1324</video:duration>
      <video:publication_date>2026-10-05T11:13:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>♟️ This Chessboard Moves Its Own Pieces! 🤯 Meet the AI-Powered Square Off</video:title>
      <video:description>What if your chess pieces could move by themselves? 🤯♟️ Meet Square Off, the smart chessboard that brings the game of chess into the future. With hidden AI technology, the board can analyze your moves and automatically move its own pieces—making it feel like you&apos;re playing against a real opponent right in front of you! No strings, no magic… just incredible technology. 🤖🔥 Would you try playing chess on a board like this? #SquareOff #SquareOffchess #smartchessboard #smartchess #AIchess #AIchessboard #artificialintelligence #chesstechnology #futuristicchess #automaticchessboard #selfmovingchesspieces #chesspiecesmovebythemselves #smartchesspieces #roboticchess #AItechnology #innovativetechnology #futuretechnology #smartgadgets #techgadgets #chessgadget #electronicchessboard #automatedchess #modernchess #intelligentchessboard #chessinnovation #technologygadgets #cooltechnology #futuristictechnology #chesslover #chessgame</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516804/3516804_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T11:11:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orange cat 5</video:title>
      <video:description>Beautiful orange cat #Animal #travel #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516803/3516803_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T11:11:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E12 Hindi Dubbed Korean Drama English Subtitles</video:title>
      <video:description>King The Land. #Koreandrama #Hindidubbed #englishsubtitles #kingtheland #koreantvseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516802/3516802_720p.mp4</video:content_loc>
      <video:duration>3955</video:duration>
      <video:publication_date>2026-10-05T11:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Renegade Immortal Eps 155</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516801/3516801_720p.mp4</video:content_loc>
      <video:duration>1322</video:duration>
      <video:publication_date>2026-10-05T11:10:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Areba jan Aunty</video:title>
      <video:description>Whtsapp👉https://tinyurl.com/Call-me-03018</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516800/3516800_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:10:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#capcut #douyin #tiktok #ootd #shorts #reels #affiliate</video:title>
      <video:description>#Capcut #douyin #tiktok #affiliate</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516799/3516799_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:09:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagi bawa motor , tiba tiba di ajak ketawa 🤦🤣🤣🤣🤣</video:title>
      <video:description>#Komedi #lucu #videolucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516798/3516798_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T11:09:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Girl Dancing ✨ | Stunning Dance Moves &amp; Smooth Vibes 💃</video:title>
      <video:description>A beautiful dance performance with smooth moves, great energy, and captivating vibes. 💃✨ Watch until the end and enjoy the rhythm! Like, comment, and subscribe for more trending dance videos. #beautifulgirldance #dancevideo #trendingdance #viraldance #danceperformance #smoothdancemoves #girldancing #beautifuldance #USAtrending #viralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516797/3516797_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T11:09:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>সুবহানাল্লাহ 3</video:title>
      <video:description>সুবহানাল্লাহ</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516796/3516796_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:08:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516795</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516795/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S0E11 Hindi Dubbed Korean Drama English Subtitles</video:title>
      <video:description>King The Land. #Koreandrama #Hindidubbed #Koreantvseries #KingTheland #koreantelevisionseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516795/3516795_720p.mp4</video:content_loc>
      <video:duration>4638</video:duration>
      <video:publication_date>2026-10-05T11:07:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jawad Malik</video:title>
      <video:description>Saraiki 😭</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516794/3516794_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T11:07:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anjali Soam</video:title>
      <video:description>Meet this beautiful Rose Finch 🌸🐦</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516793/3516793_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T11:05:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>পার্কের মজাদার প্লেন রাইড ও আনন্দের মুহূর্ত 🎢✈️</video:title>
      <video:description>বিনোদন পার্কের একটি চমৎকার এবং রোমাঞ্চকর রাইডের সুন্দর কিছু মুহূর্ত উপভোগ করুন এই ভিডিওতে। চমৎকার পরিবেশে রাইড চড়ার এই আনন্দময় দৃশ্যটি আপনার মন ভালো করে দেবে। পুরো ভিডিওটি শেষ পর্যন্ত দেখুন এবং ভালো লাগলে অবশ্যই লাইক এবং শেয়ার করবেন! #পার্কেরভিডিও #বিনোদনপার্ক #প্লেনরাইড #রাইডচড়ারআনন্দ #পার্কেররাইড #ভ্রমণেরভিডিও #মজারভিডিও #শিশুদেররাইড #ফানভিডিও</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516792/3516792_720p.mp4</video:content_loc>
      <video:duration>210</video:duration>
      <video:publication_date>2026-10-05T11:05:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gym,boxing</video:title>
      <video:description>#Boxe #gym #gymtips #boxing #viral #boxingtips #gymmotivation #gymmotivation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516791/3516791_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:05:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amit Roy</video:title>
      <video:description>Ufff🎀…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516790/3516790_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T11:05:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>zx10r or cbr1000rr sp</video:title>
      <video:description>Kawasaki zx10r x Honda cbr1000rr sp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516789/3516789_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T11:04:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>v4r or r1m</video:title>
      <video:description>Ducati v4r x yamaha r1m</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516787/3516787_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T11:03:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>No One Was Supposed To Find This Place Again</video:title>
      <video:description>Using satellite imagery I discovered what appeared to be man made structures hidden in a rainforest at the centre of an isolated mountain range. Curious to find out what could be built all the way out here I decided to head on a 5 hiking adventure through the rainforest to try reach it and explore it in person. What we found is going to blow your mind! #travel #hiddenplace #exploring #adventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516786/3516786_720p.mp4</video:content_loc>
      <video:duration>1308</video:duration>
      <video:publication_date>2026-10-05T11:03:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aaaaaammmminnnkan</video:title>
      <video:description>Tolong amin kan daissss</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516785/3516785_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T11:03:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the Cold Master Lost His Heart</video:title>
      <video:description>A Tiny Girl Called Him “Dad” And the Cold Master Lost His Heart</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516784/3516784_720p.mp4</video:content_loc>
      <video:duration>7289</video:duration>
      <video:publication_date>2026-10-05T11:03:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Al Hadi Studio Urdu</video:title>
      <video:description>🌿 جسم کی خارش ختم کرنے کے 3 آسان طریقے</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516783/3516783_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T11:03:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>رحم دل ❤️ لوگ جنت میں #solangibhai786 #knowledge #shorts #foryou</video:title>
      <video:description>رحم دل ❤️ لوگ جنت میں #solangibhai786 #knowledge #shorts #foryou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516782/3516782_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T11:02:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516781</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516781/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona janda muda</video:title>
      <video:description>#Pesonacantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516781/3516781_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T11:02:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516780</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516780/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Marapthon3</video:title>
      <video:description>Gorengan Bravy dan aloy #Marapthon3 #arap #Bravy #kingaloy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516780/3516780_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T11:02:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 377</video:title>
      <video:description>#Unitedstates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516779/3516779_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T11:02:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Pineapple Family’s Secret 🍍💔</video:title>
      <video:description>family, a hidden secret, and a moment that changes everything. 🍍💔 Watch until the end to discover the truth. #pineapplefamily #fruitdrama #AIstory #emotionalstory #familydrama #AIanimation #3Danimation #pineapplestory #dramaticstory #viralstory #animatedstory #shortfilm</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516778/3516778_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-10-05T11:02:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E10 Hindi Dubbed Korean Drama English Subtitles</video:title>
      <video:description>King The Land. #Koreandrama #Hindidubbed #Koreantvseries #KingTheland #koreantelevisionseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516777/3516777_720p.mp4</video:content_loc>
      <video:duration>3967</video:duration>
      <video:publication_date>2026-10-05T11:02:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>my dream car 2</video:title>
      <video:description>audi r8 x hyundai suv palisade</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516776/3516776_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T11:02:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>marapthon3</video:title>
      <video:description>Kedekatan arap dan azka #Marapthon3 #arap #Azka #DedyCorbuzier</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516775/3516775_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T11:01:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caroline Traveline</video:title>
      <video:description>🇨🇭 SWITZERLAND SUMMER BUCKET LIST</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516774/3516774_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T11:01:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempat Sampah Jepang vs Indonesia</video:title>
      <video:description>Tempat Sampah Jepang vs Indonesia #TempatSampahJepangvsIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516773/3516773_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T11:00:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Apakah ini yang namanya berang-berang? 😅😅</video:title>
      <video:description>Hanya untuk hiburan waktu luang #Hewan #hewanpeliharaan #pets</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516772/3516772_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T11:00:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516771</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516771/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perbedaan Sekolah Jepang vs Indonesia</video:title>
      <video:description>Perbedaan Sekolah Jepang vs Indonesia #PerbedaanSekolahJepangvsIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516771/3516771_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T11:00:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best shoe cover for rain</video:title>
      <video:description>Best shoe cover for rain #shoecover #useful #subscribe #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516770/3516770_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T10:59:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nazia choudhary 2</video:title>
      <video:description>Intiaz mall Sahiwal ma khrab ghosht pkra gya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516769/3516769_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T10:59:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😑😮‍💨</video:title>
      <video:description>#badmood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516768/3516768_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T10:58:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Whale Watch</video:title>
      <video:description>🐋 The humpback whale — 40 tons launching its entire body out of the ocean. Pure power at golden hour.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516767/3516767_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:58:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E09 Hindi Dubbed Korean Drama English Subtitles</video:title>
      <video:description>King The Land #Koreandrama #Hindidubbed #englishsubtitles #kingTheland #koreantvseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516765/3516765_720p.mp4</video:content_loc>
      <video:duration>4168</video:duration>
      <video:publication_date>2026-10-05T10:58:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>animated film about a monkey and a rabbit who need help</video:title>
      <video:description>animated film about a monkey and a rabbit who need help #fyp #animation #cartoon #film #USA #AMERIKASERIKAT #VIRAL</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516764/3516764_720p.mp4</video:content_loc>
      <video:duration>466</video:duration>
      <video:publication_date>2026-10-05T10:57:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nos três sem #dinheiro #piadascurtas #comedia #humor #memes #funil</video:title>
      <video:description>#Semdinheirobolsofuurado</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516763/3516763_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T10:57:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Langka di Zaman Jahiliyah! Inilah Sosok Wanita Melek Aksara Pelopor Ilmu.</video:title>
      <video:description>#shifabintiabdullah #kisahsahabiyah #tokohwanitaislam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516761/3516761_720p.mp4</video:content_loc>
      <video:duration>109</video:duration>
      <video:publication_date>2026-10-05T10:56:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🫪😔</video:title>
      <video:description>#all</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516760/3516760_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T10:56:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drive Sydney &amp; Beyond</video:title>
      <video:description>Rain in the city 🚗🍃</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516759/3516759_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T10:56:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chitral Valley</video:title>
      <video:description>Spring festival kalash valley</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516758/3516758_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T10:55:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Queen Xanda</video:title>
      <video:description>🌍 10 WEBSITES TO Get JOBS WITH VISA SPONSORSHIP</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516757/3516757_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T10:54:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Every Champions League Winner in History! 🏆🔥</video:title>
      <video:description>Who has dominated the Champions League? 🏆⚽ Watch the complete visual history of UEFA Champions League winners and see how the biggest clubs in Europe compare by trophies. From Real Madrid and AC Milan to Barcelona, Bayern Munich, Liverpool and more! Who is your favorite Champions League champion? 👑 #ChampionsLeague #ChampionsLeaguewinners #UEFAChampionsLeague #UCLwinners #footballhistory #soccerhistory #ChampionsLeaguehistory #mostChampionsLeaguetrophies #RealMadrid #ACMilan #Barcelona #BayernMunich #Liverpool #footballfacts #soccerfacts #UCLhistory #Europeanfootball️⃣HashtagsChampionsLeagueUCLFootballSoccerFootballHistoryUCLHistoryRealMadridACMilanBarcelonaBayernMunichLiverpoolFootballFacts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516756/3516756_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-10-05T10:54:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coffee 25</video:title>
      <video:description>&quot;When people ask why you drink coffee every day... ☕😂 I&apos;d rather be travelling, but coffee fits the budget! #CoffeeTime #NightVibes #Humor&quot; #coffeetravellingcoffeetimenightvibeshumor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516755/3516755_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T10:53:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GACHIAKUTA SPECIAL</video:title>
      <video:description>LOOK AT THIS #VIRALANIMESERIES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516754/3516754_720p.mp4</video:content_loc>
      <video:duration>110</video:duration>
      <video:publication_date>2026-10-05T10:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>perbosa_footboll</video:title>
      <video:description>rahull</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516753/3516753_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T10:53:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP09-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love drama #action #romancelove #story</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516752/3516752_720p.mp4</video:content_loc>
      <video:duration>2719</video:duration>
      <video:publication_date>2026-10-05T10:52:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“How Hacha (Chakata) Fruit Is Processed into Nutritious Traditional Porridge in Rural Zimbabwe”</video:title>
      <video:description>From Forest Fruit to Nutritious Traditional Porridge | Hacha (Chakata) 🌳 Discover how the traditional hacha (chakata) fruit, scientifically known as Parinari curatellifolia, is processed in the rural landscape to make a nutritious traditional porridge. From harvesting the wild fruits to preparing, processing, and turning them into wholesome porridge, this video showcases a beautiful part of Zimbabwean traditional food knowledge and rural culture. 🌿 This is more than just food—it is a connection between nature, traditional knowledge, community, and generations of Zimbabwean heritage. Watch the complete process and discover how a wild fruit from the forest can be transformed into a traditional meal enjoyed in rural communities. 🌍 Nature provides. Tradition preserves. Communities continue the story. #HACHA #CHAKATA #PARINARICURATELLIFOLIA #HACHAPORRIDGE #TRADITIONALPORRIDGE #ZIMBABWE #ZIMBABWEANFOOD #AFRICANFOOD #WILDFRUITS #TRADITIONALFOODS #RURALZIMBABWE #AFRICANHERITAGE #TRADITIONALKNOWLEDGE #NUTRITIOUSFOOD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516751/3516751_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T10:52:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sagnik Bera</video:title>
      <video:description>In first frame: Blue throated barbet 2nd frame: Indian Paradise Flycatcher 3rd frame: Orange headed thrush 4 th trame: Lineated Barbet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516750/3516750_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T10:52:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alien 3</video:title>
      <video:description>Alien VS #Movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516749/3516749_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-10-05T10:51:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Efootball 7</video:title>
      <video:description>#Sport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516748/3516748_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T10:51:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nzforever</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516747/3516747_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T10:50:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP08-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love drama #action #romance #drama #love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516746/3516746_720p.mp4</video:content_loc>
      <video:duration>2742</video:duration>
      <video:publication_date>2026-10-05T10:50:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mirza ghalib</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516745/3516745_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:50:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>First Dragon Season 1 Episode 5 In Hindi</video:title>
      <video:description>Enjoy #FirstDragon #Anime #HindiAnime #SpiritsAnime #AnotherWorldAnime #TeleportAnime #MagicAnime #SoldierAnime #TeleportSoldierAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516744/3516744_720p.mp4</video:content_loc>
      <video:duration>991</video:duration>
      <video:publication_date>2026-10-05T10:49:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Normal skill VS Kings of trampoline 4</video:title>
      <video:description>Watch these crazy skateboard &amp; roller skating tricks! 🔥 Watch till the end for a beautiful surprise ✨ If you enjoyed this video, don&apos;t forget to Like, Share, and Subscribe/Follow for more amazing short clips! #SkateboardingRollerSkatingViralsshortsTrendingKaabaArtEntertainmentShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516743/3516743_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T10:49:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kabut asap di kalimantan, Indonesia</video:title>
      <video:description>video kiriman teman dari Palangkaraya tentang kabut asap di Kalimanta Indonesia #smoke #asap #Palangkaraya #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516742/3516742_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T10:49:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Balapan 2</video:title>
      <video:description>Pembalapan #Mobil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516741/3516741_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T10:49:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 20</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516740/3516740_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T10:49:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>anak monyet dan kelinci terjatuh</video:title>
      <video:description>film animasi #animasi #viral #fyp #kids #anakanak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516739/3516739_720p.mp4</video:content_loc>
      <video:duration>106</video:duration>
      <video:publication_date>2026-10-05T10:49:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Heavy Bike Stunts | Powerful Motorcycle Stunt Show 🏍️ | Crazy Bike Skills</video:title>
      <video:description>Watch an exciting heavy bike stunt showcase featuring powerful motorcycles, impressive riding skills, and action-packed moments. 🏍️🔥 Professional stunt performance in a controlled environment. Do not attempt dangerous stunts yourself. Always wear proper safety gear and follow local laws. #heavybikestunts #heavybikestunt #bikestunts #motorcyclestunts #heavymotorcycle #bikestuntvideo #motorcyclestuntvideo #crazybikeskills #bikeridingskills #professionalbikestunts #stuntbikevideo #heavybikeriding #motorcycleskills #bikestuntshow #bikeactionvideo #bikeshorts #motorcycleshorts #bikevideo #stuntrider #heavymotorcyclestunts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516738/3516738_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-10-05T10:48:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shahid tapsite</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516737/3516737_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T10:48:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP07-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love drama #action #love #romancestory</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516736/3516736_720p.mp4</video:content_loc>
      <video:duration>2633</video:duration>
      <video:publication_date>2026-10-05T10:48:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caricature News</video:title>
      <video:description>Douglas Macgregor, a former U.S. Army Colonel and advisor to the U.S. Secretary of Defense, has reiterated his views on the dynamics of the geopolitical conflict. #DouglasMacgregor #GeopoliticsWorldPoliticsUnitedStatesIran #GlobalConflict #LatestNews #Military #cççInternationalAffairsPoliticalLandscapeOc</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516735/3516735_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T10:48:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video lucu 31</video:title>
      <video:description>pyp video #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516734/3516734_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T10:47:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sebuah pekerjaan</video:title>
      <video:description>Sebuah pekerjaan yang penting halal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516733/3516733_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:47:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cara Dapat uang dari Febspot</video:title>
      <video:description>Cara Dapat uang dari Febspot #Febspot #freelance #tutorial #caradapatuang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516732/3516732_720p.mp4</video:content_loc>
      <video:duration>414</video:duration>
      <video:publication_date>2026-10-05T10:47:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ular naik di tiang listrik</video:title>
      <video:description>Lampu sering mati mungkin karna ini</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516731/3516731_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T10:47:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nostr fatykhan</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516730/3516730_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T10:46:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP06-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love drama #action #love #romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516729/3516729_720p.mp4</video:content_loc>
      <video:duration>2774</video:duration>
      <video:publication_date>2026-10-05T10:45:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Korean Horror Movie - The Ghost Station - भूतिया स्टेशन _ Hindi Dubbed 2025 _ Thriller _ Full Movie.</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516728/3516728_720p.mp4</video:content_loc>
      <video:duration>4836</video:duration>
      <video:publication_date>2026-10-05T10:44:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic vedio 31</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516727/3516727_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T10:44:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perfect lipsing</video:title>
      <video:description>Imitating the way of singing and really getting into the song #Song #india #Kuchkuchhotai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516726/3516726_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T10:43:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Glamour Salon Wah Cantt</video:title>
      <video:description>Pedicure 🦶 03112344441</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516725/3516725_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T10:42:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KNY.YH S2 Eps 6</video:title>
      <video:description>battle with the moon demon army</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516724/3516724_720p.mp4</video:content_loc>
      <video:duration>308</video:duration>
      <video:publication_date>2026-10-05T10:42:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516723</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516723/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hikmat ki Baat</video:title>
      <video:description>نماز کے بعد پڑھنے والی 5 دعائیں | ہر مسلمان کے لیے مفید اذکار 🤲</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516723/3516723_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T10:42:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NIGHT TRIP (4k UHD) Full Thriller Horror Movie - Allison Mackie - Hollywood Hindi Horror Movie.mp4</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516722/3516722_720p.mp4</video:content_loc>
      <video:duration>7863</video:duration>
      <video:publication_date>2026-10-05T10:41:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mission Raniganj - 65 Mazdooron Ki Zindagi Bachane Ka Mission - Akshay Kumar - 15 august Special -.m</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516721/3516721_720p.mp4</video:content_loc>
      <video:duration>7386</video:duration>
      <video:publication_date>2026-10-05T10:41:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saba Urdu Writing</video:title>
      <video:description>رازداری میں بڑی عافیت ہے...</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516720/3516720_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T10:41:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP05-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love drama #romance #action #love #story</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516719/3516719_720p.mp4</video:content_loc>
      <video:duration>2623</video:duration>
      <video:publication_date>2026-10-05T10:41:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PARTNER (2026) New Released South Superhit Comedy Movie In Hindi - Aadhi Pinisetty &amp; Hansika Motwani</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516718/3516718_720p.mp4</video:content_loc>
      <video:duration>6617</video:duration>
      <video:publication_date>2026-10-05T10:41:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Churuli - Full Movie - Vinay Forrt, Chemban Vinod Jose, Joju George, Soubin Shahir.mp4</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516717/3516717_720p.mp4</video:content_loc>
      <video:duration>6844</video:duration>
      <video:publication_date>2026-10-05T10:41:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RAAVAN [Hindi] Full Movie - JEET - LAHOMA - TANUSREE - SHATAF - 4K.mp4</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516716/3516716_720p.mp4</video:content_loc>
      <video:duration>7969</video:duration>
      <video:publication_date>2026-10-05T10:41:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belah kelapa muda dulu biar gacor tar malam</video:title>
      <video:description>rungsing ngajak Samsudin mah sok beda kahayang #Pesonacantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516715/3516715_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T10:39:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hercai | Herjai Urdu - Episode 1 | Eng Sub / Urdu Dubbed | Full Episode</video:title>
      <video:description>Khwahishon aur badle ki ek anokhi kahani! Dekhiye Hercai (Herjai) Urdu - Episode . Is nayi drama serial mein mohabbat, nafrat aur raazon ka ek naya safar shuru hota hai. Kya Miran aur Reyyan ki kismat unhe ek karegi ya ye nafrat ki aag sab kuch jala degi? Janiye is pehle episode mein! ⭐ Episode Highlights: Kirdar: Miran Aslanbey aur Reyyan Şadoğlu Theme: Romance, Revenge, Drama Language: Urdu Dubbed / Subtitles Important Links &amp; Tags (Aapke Channel ke liye) 🔗 Subscribe to our Channel: [Apne Channel ka Link yahan lagayein] 🔗 Watch Next Episode: [Agli Episode ka Link agar ho] Hashtags:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516714/3516714_720p.mp4</video:content_loc>
      <video:duration>2687</video:duration>
      <video:publication_date>2026-10-05T10:39:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio kopi 2</video:title>
      <video:description>Kopi nikmat,bikin hari lebih semangat #Kopi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516713/3516713_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T10:38:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Philosophy of live : 4 phase of suffering in live . Confusion said</video:title>
      <video:description>Philosophy of live phase of suffering in live Confusion said</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516712/3516712_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T10:37:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP04-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love drama #romance #love #drama #money #story</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516711/3516711_720p.mp4</video:content_loc>
      <video:duration>2748</video:duration>
      <video:publication_date>2026-10-05T10:35:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Al quran Surah An Nas.</video:title>
      <video:description>Al quran Surah An Nas. Surah An-Nas adalah surah ke-114 atau surah terakhir dalam Al-Qur&apos;an yang terdiri dari 6 ayat dan tergolong surah Makkiyah. #Alquran #Surah #SurahAnNas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516710/3516710_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T10:35:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516709</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516709/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Old men working hard</video:title>
      <video:description>Witnessing timeless craftsmanship in a traditional roadside workshop—where skill, patience, and dedication turn everyday materials into something special. 🛠️✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516709/3516709_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:35:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Funny video #Funny #comedy #funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516708/3516708_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T10:34:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KNY S2 Last Battle</video:title>
      <video:description>the final battle of the demon-slaying squad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516707/3516707_720p.mp4</video:content_loc>
      <video:duration>286</video:duration>
      <video:publication_date>2026-10-05T10:34:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516706</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516706/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brrr! Scraping Real Glacier Ice Feels SO Good 🥶✨</video:title>
      <video:description>Okay, how stunning is this ice wall? 😍🧊 Deep blue, super textured, and every scrape sends fluffy snow flying everywhere ❄️💨 It&apos;s cold, it&apos;s crunchy, and it&apos;s honestly hypnotizing 🎧 Headphones on, volume up, and let the arctic calm take over 🏔️😌 Would you try this in real life? 🥶 Tell me below 👇💬 Like ❤️, follow 🔔, and share with your fellow ice lovers 🫶 #glacierASMR #icewall #icescraping #blueice #satisfyingice #snowASMR #glacierice #frozenwall #crunchyASMR #winterASMR #oddlysatisfying #relaxingvideo #natureASMR #icetexture #satisfyingshort</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516706/3516706_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T10:34:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jiya rajpoot officialpage68 2</video:title>
      <video:description>Roop Kumar Rathod · Aashiq Mujhe Aashiq (Jhankar)</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516705/3516705_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T10:34:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KNY_S2</video:title>
      <video:description>the fight of the demon-slaying troops</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516704/3516704_720p.mp4</video:content_loc>
      <video:duration>270</video:duration>
      <video:publication_date>2026-10-05T10:33:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona terasering baru gantung di lereng gunung cikuray dan view kota Garut nya🌱😍</video:title>
      <video:description>Pesona terasering baru gantung di lereng gunung cikuray dan view kota Garut nya🌱😍 #Viewgunung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516703/3516703_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T10:33:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 😘 40</video:title>
      <video:description>Haider ali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516702/3516702_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:33:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>trade on the spot</video:title>
      <video:description>fomo of market @fomc news #tradingxauusd</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516701/3516701_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T10:33:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 😘 39</video:title>
      <video:description>Haider ali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516700/3516700_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T10:33:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Ice Scraping Sound Is Pure Bliss 🧊😮‍💨🎧</video:title>
      <video:description>Get ready for the chilliest ASMR of your day 🧊🎧 Watch a sharp blade glide across a crystal-clear ice block and turn it into soft, fluffy snow ❄️✨ Super crisp, super smooth, super relaxing 😌 Put on your headphones, take a deep breath, and just let that crunch wash over you 🌬️ Did you get the tingles? Let me know below 👇💬 Like ❤️, follow 🔔, and share it with someone who loves satisfying stuff 🫶 #iceASMR #icescraping #iceshaving #satisfyingice #snowASMR #crunchyASMR #ASMRsounds #oddlysatisfying #relaxingvideo #knifeonice #iceblock #frozenASMR #stressrelief #tingles #satisfyingshort</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516699/3516699_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T10:33:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KNY.YH S2</video:title>
      <video:description>demon-slaying troops</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516698/3516698_720p.mp4</video:content_loc>
      <video:duration>333</video:duration>
      <video:publication_date>2026-10-05T10:32:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yusra Azmat Visaa</video:title>
      <video:description>Yusra Azmat Visaal · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516697/3516697_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T10:32:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Labubu beraksi</video:title>
      <video:description>Hiburan anak labubu di ibarbo yogyakarta #labubu #perjalanan #anak #mainan #ibarbo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516696/3516696_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T10:31:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan indah 14</video:title>
      <video:description>Musim semi yang sungguh luar biasa perpaduan antara cuaca dan musim yg indah #Lanscape</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516695/3516695_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T10:31:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aadhichanduzz</video:title>
      <video:description>This Kind Of Men’s🥹🤌❤️‍🩹Feels Like I Won In Life🫶❤️‍🩹</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516694/3516694_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T10:31:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5-Minute Crafts Men 2</video:title>
      <video:description>3 Smart Hacks for Electrical Cables! 💡</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516693/3516693_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T10:30:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One piece 43</video:title>
      <video:description>Momen Sanji membangkitkan kekuatan tersembunyi germa66 #onepiece</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516692/3516692_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-10-05T10:29:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>They Use a JET ENGINE to Clear Snow From This Bridge! 😱❄️</video:title>
      <video:description>How do you clear heavy snow from a massive bridge? You bring out a machine with jet-engine-level power! 🔥💨❄️ This incredible snow-clearing truck blasts powerful air across the road, quickly pushing snow away and exposing the pavement underneath. The sheer force of the airflow is absolutely amazing to watch! This unusual winter maintenance technique shows just how powerful specialized engineering equipment can be when extreme weather hits. 🌨️🚛 Would you trust this machine to clear the road in front of you? 👀 #jetenginesnowremoval #snowclearingmachine #snowremovaltruck #jetpoweredsnowblower #jetenginesnowblower #snowremovaltechnology #bridgesnowremoval #QingdaoJiaozhouBayBridge #Qingdaobridge #Chinabridge #Chinasnowremoval #powerfulsnowblower #winterroadmaintenance #snowclearingtruck #heavyequipment #roadmaintenance #snowremovalmachine #innovativetechnology #engineeringtechnology #amazingmachines #extremeweathertechnology #winterengineering #snowclearingequipment #powerfulairblast #jetenginetechnology #bridgemaintenance #highwaysnowremoval #roadsnowclearing #heavymachinery #unusualmachines #futuristictechnology #amazingengineering #viraltechnology #wintertechnology #satisfyingsnowremoval #snowplowing #snowremovalshorts #engineeringshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516691/3516691_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T10:29:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of duty 28</video:title>
      <video:description>Call of Duty: WWII gameplay on PS5 in 4K at 60FPS. This 1942 Midway air strike mission features intense World War II aerial combat, tactical military operations, and immersive battlefield action set during the major conflict in the Pacific. Experience realistic Call of Duty: WWII gameplay featuring strategic bombing runs, cinematic dogfights, and non-stop military action as Allied forces launch a massive air strike against a heavily fortified enemy port. The mission highlights large-scale aerial warfare, precision strikes, and immersive battlefield moments. If you enjoy Call of Duty gameplay, World War II missions, and ultra-realistic 4K combat experiences, this video delivers action-packed, immersive battlefield moments. 🎮 About the Game Call of Duty: WWII is a 2017 first-person shooter developed by Sledgehammer Games and published by Activision. The game focuses on World War II combat, featuring cinematic campaign missions and immersive battlefield environments across Europe. Call of Duty: WWII Gameplay Call of Duty: WWII PS5 Gameplay (4K 60FPS) Call of Duty: WWII Midway Air Strike Gameplay Call of Duty: WWII Pacific Mission Gameplay #callofduty #thecallofduty #callofdutypc #callofdutymw4 #newcallofduty #callofduty2026 #worstcallofduty #callofdutynext #callofdutyfacts #callofdutygames #callofdutywarzone #callofdutymobile #cpredscallofduty #callofdutydetails #callofdutysecrets #callofdutyshorts #callofdutyvanguard #callofdutyremastered #callofdutyminecraft #minecraftcallofduty #callofdutywaratwar #callofdutytrolling #callofdutycontroller #callofdutycampaign #callofdutygameplay #gaming #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516690/3516690_720p.mp4</video:content_loc>
      <video:duration>934</video:duration>
      <video:publication_date>2026-10-05T10:29:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AK Education System</video:title>
      <video:description>Science Symbols &amp; Chemical Formulas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516689/3516689_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T10:28:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Project Manager Interview Questions and Answers</video:title>
      <video:description>Preparing for a Project Manager Interview? 🚀 Here are the Top 50 Project Manager Interview Questions &amp; Answers you should know! This video covers important Project Management topics such as: ✅ Project Planning &amp; Execution ✅ Scope, Schedule &amp; Cost Management ✅ Risk Management ✅ Stakeholder Management ✅ Team Leadership ✅ Communication &amp; Conflict Resolution ✅ Project Budget &amp; Resources ✅ Critical Path &amp; Project Scheduling ✅ Change Management ✅ Project Quality Management ✅ Agile &amp; Scrum ✅ Handling Delays, Risks &amp; Difficult Stakeholders 🎯 Perfect for Project Managers, Assistant Project Managers, Project Coordinators, Team Leaders, Planning Engineers, PMP Candidates, and professionals preparing for project management interviews. 👉 Want to learn all Top 50 Project Manager Interview Questions &amp; Answers in detail? Watch the full video linked below or in the pinned comment! 📌 Subscribe to Ali Aziz Quality Education for more Project Management, Leadership, Career Skills, and Interview Questions &amp; Answers. https://www.youtube.com/@AliAzizQualityEducation?sub_confirmation=1 https://yt.nimlinks.com/@AliAzizQualityEducation Facebook Page : https://www.facebook.com/groups/965626118171156/ #projectmanagerinterviewquestionsandanswers #projectmanagementinterviewquestions #projectmanagerinterview #projectmanagerjobs #projectplanninginterviewquestions #projectmanagerskills #projectmanagementjobs #projectplanning #projectexecution #projectriskmanagement #projectmanagementcareer #projectmanager #projectmanagementskills #projectjob #aliazizqualityeducation #project #projectcoordinator #projectmanagement #interviewquestionsandanswers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516688/3516688_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T10:26:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aiza Ashraf</video:title>
      <video:description>Tere liye Gulaab Ve</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516687/3516687_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:26:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516686</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516686/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Wife Spent $8,900 at a Luxury Hotel! 😱 | Part 1</video:title>
      <video:description>Pineapple thought everything was perfect… until he discovered a shocking $8,900 luxury hotel charge on their credit card. 😱🍍 Who was Peach really meeting at the hotel? And what secret is she hiding? Watch until the end for the shocking twist! This is a dramatic AI-generated fruit story filled with betrayal, secrets, and unexpected surprises. Follow for more viral AI fruit drama stories! #AIfruitdrama #fruitstory #pineapplestory #peachstory #AIanimation #animatedstory #betrayalstory #relationshipdrama #marriagedrama #luxuryhotel #8900hotelbill #shockingdiscovery #secretwife #cheatingmystery #dramaticstory #viralAIstory #3Danimation #fruitcharacters #emotionalstory</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516686/3516686_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-10-05T10:26:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Scraping This Crystal Block Is Weirdly Satisfying 😮‍💨✨</video:title>
      <video:description>Okay, this one&apos;s pure ASMR heaven 😍🎧 Watch a glossy crystal block get scraped down, layer by layer, into soft, fluffy white powder ❄️✨ That crisp scraping sound? Chef&apos;s kiss 👌 Turn your volume up, relax, and let your brain melt for a few seconds 🧠💆‍♂️ Which part hit the spot for you? Drop a comment 👇💬 and don&apos;t forget to like ❤️, follow 🔔, and share with that friend who needs a little calm 😌 #satisfyingvideo #ASMR #crystalscraping #satisfyingscrape #ASMRsounds #relaxingvideo #oddlysatisfying #scrapingASMR #crystalASMR #powderASMR #stressrelief #tingles #sleepsounds #visualASMR #shortsatisfying</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516685/3516685_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T10:26:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dr Muneer Ahmad</video:title>
      <video:description>یہ دیسی ٹوٹکے آپ کو حیران کر دیں گیں 😱 اگر ویڈیو پسند آئے تو شیئر ضرور کریں</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516684/3516684_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:25:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>​Off-Roading with the Squad 🌿 ATV Jungle Tour in Roblox</video:title>
      <video:description>Cruising through rivers, crossing suspension bridges, and climbing mountains on ATVs with the best squad. Watch till the end for the summit view! 🏔️✨ ​👍 Hit the like button and subscribe if you enjoyed this video! #​RobloxEditRobloxATVRobloxAdventureRobloxSquadGamingShortsAestheticRoblox</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516683/3516683_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T10:25:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wallpaper 8</video:title>
      <video:description>😵‍💫#music #wallpaper #colorfull#opticalart #Music #wallpaper</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516682/3516682_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T10:25:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mountain Racer Cycle 🚴‍♂️🔥 | Epic Ride &amp; Adventure | Cycling VideoLook in this line gets wild....😳 T</video:title>
      <video:description>🏔️🚴‍♂️ Experience an exciting mountain cycling adventure with beautiful views, challenging terrain, and impressive riding moments! 🔥🌄 ⚠️ Ride responsibly, wear proper safety gear, and follow local cycling rules. This video is for entertainment and adventure purposes. #MountainRacingMountainBikeCyclingBikeRideCyclingAdventureMTBAdventureShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516681/3516681_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T10:24:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aisha Khan</video:title>
      <video:description>Wafa World😘🥀</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516680/3516680_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T10:24:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khushi Panwar</video:title>
      <video:description>Sach Rana / Vneeeet · Baaki</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516679/3516679_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:23:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love Than Other Your k-drama in hindi ep 3</video:title>
      <video:description>In hindi kdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516678/3516678_720p.mp4</video:content_loc>
      <video:duration>3846</video:duration>
      <video:publication_date>2026-10-05T10:23:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Unofficial: TMC</video:title>
      <video:description>Lata Mangeshkar · Hamne Sanam Ko Khat Likha - Jhankar Beats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516677/3516677_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T10:23:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ranking the Funniest Football Moments Ever! ⚽😂</video:title>
      <video:description>From epic fails to hilarious kid moments, here is the ultimate ranking of the funniest football clips! Which moment made you laugh the hardest? Let us know in the comments! 👇 #funnyfootballmoments #footballfails #funnysoccerclips #rankingfootballmoments #footballbloopers #soccerfailscompilation #ronaldosuiifunny #messifunnyclip #footballhumor #streetfootballfails #penaltyfail #funnysportsmoments #viralfootballshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516676/3516676_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T10:22:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Music 522</video:title>
      <video:description>Empezamos algo nuevo: 3 días, 3 sonidos, un protocolo simple. Nada de música de fondo cada audio está construido con un mecanismo acústico específico, y te vamos a decir exactamente cuál es y qué dice (y qué no dice) la evidencia detrás. #Music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516675/3516675_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:21:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fishing iwak nila gedi gedi bwoooos</video:title>
      <video:description>Fhising this is good. Cacing cacing nogo nogo Mancing yo mancing , nek luwe yo mangan bwoooss Salam haup haup #Fhising</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516674/3516674_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:20:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dikejar ombak</video:title>
      <video:description>Main ombak dipantai semakin asik #pantai #ombak #perjalanan #paris #brazil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516672/3516672_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T10:19:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mountain village life</video:title>
      <video:description>Mountain village life · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516671/3516671_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T10:15:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beaconhouse School System Khyber Campus Parents</video:title>
      <video:description>Prize distribution ceremony was done after each and every performance by these little stars 🌟</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516670/3516670_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T10:15:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Insane Bike Stunts 😱 | Ultimate Bike Skills | Crazy Stunt Video 🏍️</video:title>
      <video:description>🔥 Amazing bike stunt moments! 🏍️ Watch till the end for some crazy riding skills and exciting stunt moments. 😱🔥 ⚠️ Stunts are performed in a controlled environment by trained riders. Do not try these stunts yourself.#BikeStunts #BikeSkills #StuntVideo #BikeRider #Motorcycle #Shorts #Viral #BikeStuntsBikeSkillsStuntVideoBikeRiderMotorcycleShortsViral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516669/3516669_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T10:14:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I don&apos;t chase people anymore</video:title>
      <video:description>I don&apos;t chase people who appeared and disappear in my life when it&apos;s convenient for them. #travel #Dubai #Canada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516668/3516668_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T10:14:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516667</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516667/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Areeba.official</video:title>
      <video:description>Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516667/3516667_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T10:14:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>THE ORANGE HERO WAS HUNTED 😱🍊</video:title>
      <video:description>He was never supposed to become a hero… 🍊🔥 After being hunted and betrayed, one powerful orange must fight to uncover the truth and survive. A cinematic AI action story full of suspense, danger, and unexpected twists. Watch until the end — the truth changes everything. 👀 #AIstory #AIanimation #actionstory #fruitdrama #orangehero #orangecharacter #cinematicanimation #AImovie #animatedstory #actionanimation #suspensestory #emotionalstory #3Danimation #viralAIvideo #shortfilm</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516666/3516666_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-05T10:14:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Panties Girl Twerking Girl Twerk Show</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #citygirlstwerk #twerkcitygirls #countrygirltwerk #prettygirltwerk #twerk #twerkteamprettygirltwerk #twerkit #prettygirltwerkfeatlandon #howtotwerk #twerkteam #twerksong #twerkvideo #twerksongs #twerkdance #hottotwerk #twerkthatass #twerkchallenge #twerkcompilation #thetwerkanthem #twerkteamdoit #twerktwerktwerksong #besttwerkmusic #besttwerkvideo #handsuptwerk #mizztwerksum #twerkdatass #newtwerkteam #twerkmusicvideo #twerksongs2017 #twerkteamdiss #twerkteamheavy #thenexttwerkteam #girlbikini #girlbikinibottom #girlsinbikinis #bikini #fullbikini #snsbikini #bikiniline #surfbikini #bikinitops #tinybikini #bikinikill #roxybikini #70sbikini #minibikini #cubabikini #basebikini #solidbikini #microbikini #bikinibeach #bikinibottom #fullbikinibottom #volcombikini #simplybikini #girl #bikinibottoms #classicbikini #bikinidancemv #womensbikini #swimwearbikini #searcherbikini #girlbottom #billabongbikini #girls #surfbikinibottom #sbikinibottom #roxybi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516665/3516665_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T10:13:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inheritance Detective (2025) Episode 5 Eng Sub</video:title>
      <video:description>Inheritance Detective - JAPAN DRAMA Haie Nao is a private detective who specializes in inheritance cases. He runs his own office, Haie Inheritance Investigation Office. He once worked as an elite lawyer, but due to a certain reason, he was kicked out of the lawyers&apos; association. He is also a coffee otaku. When he thinks, he likes to munch on plain coffee beans. He also hates the phrase, &quot;Dead men tell no tales.&quot; Haie Nao takes on challenging inheritance cases and uses his high intelligence and the help of people with colorful personalities. While respecting the will of the deceased, Haie Nao tries to solve the family conflicts and the hidden truths within the inheritance. Inheritance Detective, romancedrama, daramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #InheritanceDetective #romancedrama #daramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516664/3516664_720p.mp4</video:content_loc>
      <video:duration>2696</video:duration>
      <video:publication_date>2026-10-05T10:13:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>新人上线希望大家多多关照</video:title>
      <video:description>今天找到这里，本人啥也不懂希望大家多多关照 #中国</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516663/3516663_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T10:13:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exploring Magical Worlds in Roblox 🌸 | Aesthetic Cinematic Showcase</video:title>
      <video:description>Journey through breathtaking landscapes, ancient ruins, and mystical realms. From quiet lily pad ponds to giant stone guardians and majestic dragons, experience the beauty and wonder of this aesthetic world. ​🎵 Music: All Too Well (10 Minute Version) - Taylor Swift 🎮 Game/Platform: Roblox ​Don&apos;t forget to like, comment, and subscribe for more aesthetic gaming showcases! ✨ #​RobloxAestheticRobloxAestheticGamingFantasyWorldCinematicRobloxGamingVibesAestheticEdits</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516662/3516662_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T10:11:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ketauan check in</video:title>
      <video:description>Ketauan check in #Lucu #komedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516661/3516661_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:11:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pantai teluk penyu</video:title>
      <video:description>Pantai ini sangat indah dan sejuk #perjalanan #paris #prancis #brazil #singapura</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516660/3516660_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T10:10:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>-Realistic- Drawing. This Girl Can Really Draw! MUST WATCH</video:title>
      <video:description>-Realistic- Drawing. This Girl Can Really Draw! MUST WATCH #drawing #realisticdrawing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516659/3516659_720p.mp4</video:content_loc>
      <video:duration>132</video:duration>
      <video:publication_date>2026-10-05T10:10:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That was unexpected</video:title>
      <video:description>That was unexpected #video #music #vlogmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516658/3516658_720p.mp4</video:content_loc>
      <video:duration>327</video:duration>
      <video:publication_date>2026-10-05T10:08:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PERTARUHAN PART 1</video:title>
      <video:description>FILM PERTARUHAN PART 1 #FILM #PERTARUHAN #VIRAL</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516657/3516657_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T10:06:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tenang 6</video:title>
      <video:description>#Chinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516656/3516656_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T10:05:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jumpsuit Pendek Import Wanita / Overall Import /,  Overall Pendek Fashion Wanita | Jp Fashion,</video:title>
      <video:description>BELI DI SINI https://vt.tokopedia.com/t/ZS9D5Aj9j71rK-4K622/ #JumpsuitPendekImportWanitaOverallImport #OverallPendekFashionWanitaJpFashion #WanitaJumpsuitKoreanStyleWanita #PakaianWanitaImport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516655/3516655_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T10:05:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A beautiful bird</video:title>
      <video:description>birds are eating together #birds</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516654/3516654_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:05:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>کراچی میں حبیب چورنگی سائٹ ٹاؤن پر گارمنٹس فیکٹری میں آتشزدگی</video:title>
      <video:description>سائٹ ایریا میں حبیب بینک چورنگی پر واقع گارمنٹس فیکٹری آگ کی لپیٹ میں آ گئی۔ #Fire #Karachi #HabibBankChowrangi #SiteArea #GarmentsFactory</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516653/3516653_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T10:03:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ke pasar malam</video:title>
      <video:description>Ada aja gebrakannya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516652/3516652_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T10:03:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ngopi 31</video:title>
      <video:description>Perkopian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516651/3516651_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T10:03:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Notif jarang jarang</video:title>
      <video:description>Marksman modal pede #MLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516650/3516650_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T10:02:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Laju ombak</video:title>
      <video:description>Pemecah ombak yang ada di pesisir pamtai selatan #paris #prancis #jalanan #perjalaman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516649/3516649_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T10:02:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>song edukasi</video:title>
      <video:description>edukasi #song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516648/3516648_720p.mp4</video:content_loc>
      <video:duration>420</video:duration>
      <video:publication_date>2026-10-05T10:02:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>She Was Lost at Sea… But Her Mother Never Gave Up 💔</video:title>
      <video:description>She disappeared during a terrible storm… Everyone thought she was gone forever. But her mother never stopped searching. 🌊💔 Will they finally find each other? #AIstory #emotionalstory #lostdaughter #motheranddaughter #dramaticstory #animatedstory #3Danimation #oceanstorm #familyreunion #sadstory #mysterystory #viralstory #cinematicanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516647/3516647_720p.mp4</video:content_loc>
      <video:duration>160</video:duration>
      <video:publication_date>2026-10-05T10:02:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Kacer Suddenly Flies Over Watermelon Harvesters! 🍉🐦 You Won’t Believe What Happens Next!</video:title>
      <video:description>A beautiful Kacer suddenly takes flight above farmers harvesting fresh watermelons in the field. 🍉🐦 A rare and fascinating moment where the beauty of wild birds meets everyday life in the countryside. 🌿✨ #KacerBirdsOfTheWildWildBirdBirdWatchingNatureWatermelonHarvestBirdLoversWildlifeNatureLoversFacebookReelsViralReelsAmazingBirds</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516646/3516646_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T10:02:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP03-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love k-drama #action #romance #money #past</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516645/3516645_720p.mp4</video:content_loc>
      <video:duration>2703</video:duration>
      <video:publication_date>2026-10-05T10:01:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful bird 28</video:title>
      <video:description>Sangat indah suaranya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516644/3516644_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T10:01:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>USA to Darwin, Australia is INSANE! 19,400 KM by Boat Via Panama Canal?!</video:title>
      <video:description>How far is Darwin, Australia from the USA? 🤯 This sailboat travels 19,400 kilometers starting from the USA! The epic route: Sailing through the Caribbean, transiting the famous Panama Canal into the Pacific Ocean, crossing the ENTIRE Pacific Ocean past Fiji and Vanuatu, and finally arriving in Darwin, Northern Territory, Australia! Can you imagine spending months at sea for this journey? How long do you think it takes? Route: USA (Florida) → Caribbean Sea → Panama Canal → Pacific Ocean → Fiji → Vanuatu → Darwin, Australia #USAToAustralia #DarwinAustralia #PanamaCanal #SailingRoute #Geography #MapFacts #USAToDarwin #SailingAdventure #PacificOcean #CaribbeanSea #Distance #Australia #NorthernTerritory #Fiji #Vanuatu #WorldMap #TravelFacts #Sailboat #PanamaCanalTransit #19400KM</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516643/3516643_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T10:00:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan di buat pusing</video:title>
      <video:description>Asikin ajah #videoseru</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516642/3516642_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T09:58:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inheritance Detective (2025) Episode 4 Eng Sub</video:title>
      <video:description>Inheritance Detective - JAPAN DRAMA Haie Nao is a private detective who specializes in inheritance cases. He runs his own office, Haie Inheritance Investigation Office. He once worked as an elite lawyer, but due to a certain reason, he was kicked out of the lawyers&apos; association. He is also a coffee otaku. When he thinks, he likes to munch on plain coffee beans. He also hates the phrase, &quot;Dead men tell no tales.&quot; Haie Nao takes on challenging inheritance cases and uses his high intelligence and the help of people with colorful personalities. While respecting the will of the deceased, Haie Nao tries to solve the family conflicts and the hidden truths within the inheritance. Inheritance Detective, romancedrama, daramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #InheritanceDetective #romancedrama #daramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516641/3516641_720p.mp4</video:content_loc>
      <video:duration>2696</video:duration>
      <video:publication_date>2026-10-05T09:58:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dust of Anak Krakatau - Debu Dari Anak Krakatau</video:title>
      <video:description>Dust from the dust of anak krakatau eruption on my car in Jakarta. From Sunda Strait to Jakarta. #krakatoa #krakatau #anakkrakatau #dust #eruption #sunda #sundastrait #Jakarta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516640/3516640_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T09:56:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Modern fishing slingshot</video:title>
      <video:description>Modern fishing slingshot #Fiahing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516639/3516639_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T09:56:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yeh Rishta Kya Kehlata Hai Full Episode Update</video:title>
      <video:description>Yeh Rishta Kya Kehlata Hai Full Episode Update #YehRishtaKyaKehlataHai #episodeupdate #update #trending #viral #gossips #entertainment #yrkkh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516638/3516638_720p.mp4</video:content_loc>
      <video:duration>295</video:duration>
      <video:publication_date>2026-10-05T09:55:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP02-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love k-drama #love #romance #money #action</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516637/3516637_720p.mp4</video:content_loc>
      <video:duration>2531</video:duration>
      <video:publication_date>2026-10-05T09:54:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boxing 21</video:title>
      <video:description>Boxing tutorial #Boximh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516636/3516636_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T09:52:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fireworks of My Heart-S1-EP01-{Hindi.Chinese DUB-EngSUB}-720p HD-KDHindiDubbed.mp4 (HS)</video:title>
      <video:description>love drama #action #love #romance #money</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516635/3516635_720p.mp4</video:content_loc>
      <video:duration>2584</video:duration>
      <video:publication_date>2026-10-05T09:51:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lorong malam</video:title>
      <video:description>Lorong malam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516634/3516634_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T09:51:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Irakli Orbeladze</video:title>
      <video:description>5th ave, NY 🗽🇺🇸</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516633/3516633_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T09:50:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cowok iseng</video:title>
      <video:description>Cowok iseng</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516632/3516632_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T09:50:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Huma Doll</video:title>
      <video:description>Madam Ayesha G Beauty Parlour Mei</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516631/3516631_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T09:50:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516630</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516630/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sandhu Saab</video:title>
      <video:description>nishu_03_noor_23 · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516630/3516630_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T09:49:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to Get Your First Job in Shipping 🚢 | Shipping Career Guide</video:title>
      <video:description>Want to start your career in the Shipping or Maritime Industry? 🚢 Getting your first job can be challenging, but the right preparation can make a big difference. In this video, learn the key steps to getting your first job in shipping, including: ✅ Choose the Right Maritime Career Path ✅ Complete Required Education &amp; Training ✅ Obtain Relevant Certifications ✅ Prepare a Professional CV ✅ Apply to Shipping Companies &amp; Manning Agencies ✅ Prepare for Maritime Job Interviews ✅ Understand Entry-Level Positions ✅ Build Relevant Skills &amp; Experience ✅ Avoid Common Mistakes When Applying ✅ Stay Consistent With Your Job Search 🎯 Perfect for Fresh Graduates, Deck Cadets, Marine Engineers, Merchant Navy Candidates, Maritime Students, and Beginners looking to start a career in shipping. 👉 Want a complete step-by-step guide? Watch the full video linked below or in the pinned comment! 📌 Subscribe to Ali Aziz Quality Education for more Marine Jobs, Shipping Careers, Interview Questions, Career Skills, and Professional Development videos. https://www.youtube.com/@AliAzizQualityEducation?sub_confirmation=1 https://yt.nimlinks.com/@AliAzizQualityEducation Facebook Page : https://www.facebook.com/groups/965626118171156/ #howtogetfirstjobinshipping #firstjobinshipping #shippingjobs #merchantnavyjobs #merchantnavycareer #howtojoinmerchantnavy #maritimejobs #maritimecareer #shippingcareer #marinejobs #marinecareer #shippingindustryjobs #marineinterview #merchantnavyinterview #shippingcompanyjobs #maritimeindustry #aliazizqualityeducation #merchantnavykaisejoinkare #howtojoinmerchantnavyafter12 #lifeatsea #merchantnavy #merchant #ship #shippingcompany</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516629/3516629_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T09:48:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viagem 11</video:title>
      <video:description>#Violão</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516628/3516628_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-05T09:47:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dr Sajjad Nawaz khan</video:title>
      <video:description>Govt jobs 2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516627/3516627_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T09:47:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asikin aja 6</video:title>
      <video:description>Kewer kewer asikk #Homedance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516626/3516626_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T09:47:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Small Big &amp; Some Moon Monster Cars vs lava - BeamNG.Drive #gaming #gamer #game #reels #gta</video:title>
      <video:description>Small Big &amp; Some Moon Monster Cars vs lava - BeamNG.Drive #gaming #gamer #game #reels #gta #SmallBigSomeMoonMonsterCarsvslava-BeamNGDrivegaminggamergamereelsgta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516625/3516625_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T09:47:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beras</video:title>
      <video:description>Baru banget beli beras, tapi banyak kutunya . Alhamdulillah bisa dituker #Makanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516623/3516623_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T09:46:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bhai Jan Rice store</video:title>
      <video:description>سب سے اعلی کوالٹی کا سستا سٹیم کائنات چاول انتہائی کم ریٹ پر گھر بیٹھے منگوائیں معیار اور مقدار کی ضمانت کے ساتھ</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516622/3516622_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T09:46:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KILAT BALEBAT</video:title>
      <video:description>Pertarungan antar 2 jawara yang di tampilkan dalam suatu acara di banten yang menjadi salah satu ciri khas di daerah kami, semoga dapat menghibur....SELAMAT MENYAKSIKAN #travel #senibudaya #culture #indonesian #banten #martialart #pencaksilat #entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516621/3516621_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-10-05T09:46:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My baby girl 4</video:title>
      <video:description>Like Cumi #Hiburan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516620/3516620_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T09:46:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>First Dragon Season 1 Episode 4 In Hindi</video:title>
      <video:description>Enjoy #FirstDragon #Anime #HindiAnime #SpiritsAnime #AnotherWorldAnime #TeleportAnime #MagicAnime #SoldierAnime #TeleportSoldierAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516619/3516619_720p.mp4</video:content_loc>
      <video:duration>966</video:duration>
      <video:publication_date>2026-10-05T09:45:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prize Bond Draw in October-2026  #prizebond #aliazizqualityeducation</video:title>
      <video:description>In This Video you get the Information of 750 Prize Bond Draw Schedule and Wining Amount 15-October-2026. 👉 Watch full video : https://www.youtube.com/watch?v=1zEt7qjEjw0&amp;list=PLTpsDsRRRYdRekqjSXKICPQfCtLQyjXn8&amp;index=2 Prize Bond National Savings Prize Bond 750 city Rawalpindi 15.10.2026 Rawalpindi Prize Bond Guess Paper Prize Bond Link Routine Formula prize bond guess paper Prize Bond Draw in October 2026 750 Prize Bond Schedule and Complete list https://www.youtube.com/@AliAzizQualityEducation?sub_confirmation=1 https://yt.nimlinks.com/@AliAzizQualityEducation Facebook Page : https://www.facebook.com/groups/965626118171156/ #750prizebonddraw2026 #750prizebonddraw #prizebonddraw2026 #750prizebonddrawlisttoday #750prizebondlist2026 #750prizebonddrawresulttoday #prizebonddrawschedule2026 #prizebonddraw750result #750prizebondschedule2026 #prizebondresulttoday #prizebonddraw #750prizebondresulttoday #prizebond #aliazizqualityeducation #prizebondqurandazischedule #750prizebondlist #prizebondtips #prizebondlist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516617/3516617_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T09:44:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deepak Mathur</video:title>
      <video:description>🏡 BRAND NEW CONSTRUCTION HOUSE FOR SALE | FARIDABAD</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516616/3516616_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T09:44:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amanda manopo 3</video:title>
      <video:description>#Amandamanopo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516615/3516615_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T09:43:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>exhausting day</video:title>
      <video:description>tired😵‍💫😵‍💫 #hot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516614/3516614_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T09:43:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aril noah</video:title>
      <video:description>#Arilnoah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516613/3516613_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-10-05T09:43:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bike World 2</video:title>
      <video:description>Honda Bike World laya Shehar Karachi k Second Hand Motorcycle rakhnay walo k liye khushkhabri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516612/3516612_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T09:43:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mr bert</video:title>
      <video:description>#Mrbert</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516611/3516611_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-10-05T09:42:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Full top bra</video:title>
      <video:description>very nice tank top #thebraisnice</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516610/3516610_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T09:42:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ali Baba aur 40 Bhoot season 01 episode 13.Cheekh. 720p</video:title>
      <video:description>Ali Baba aur 40 Bhoot season 01 episode 13.Cheekh. 720p. Best of the best series.Best Horror series.Jao jake dekho maja aa jayega. Please follow me more than videos request. #Jiohotstar #Febspot.com Subscribe to my channel ❤️❤️🥹 #India</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516609/3516609_720p.mp4</video:content_loc>
      <video:duration>1656</video:duration>
      <video:publication_date>2026-10-05T09:41:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prize Bond Draw in October 2026 | 750 Prize Bond Schedule and Complete list</video:title>
      <video:description>In This Video you get the Information of 750 Prize Bond Draw Schedule and Wining Amount 15-October-2026. Prize Bond National Savings Prize Bond 750 city Rawalpindi 15.10.2026 Rawalpindi Prize Bond Guess Paper Prize Bond Link Routine Formula prize bond guess paper Prize Bond Draw in October 2026 750 Prize Bond Schedule and Complete list If you like the video, please don&apos;t forget to subscribe and Click the like button to support. https://www.youtube.com/@AliAzizQualityEducation?sub_confirmation=1 https://yt.nimlinks.com/@AliAzizQualityEducation Facebook Page : https://www.facebook.com/groups/965626118171156/ #750prizebonddraw2026 #750prizebonddraw #prizebonddraw2026 #750prizebonddrawlisttoday #750prizebondlist2026 #750prizebonddrawresulttoday #prizebonddrawschedule2026 #prizebonddraw750result #750prizebondschedule2026 #prizebondresulttoday #prizebonddraw #750prizebondresulttoday #prizebond #aliazizqualityeducation #prizebondqurandazischedule #750prizebondlist #prizebondtips #prizebondlist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516608/3516608_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T09:40:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kadang sampe hilang akal tapi, harus segera sadar</video:title>
      <video:description>&quot;Kadang sampai hilang akal... Tapi, harus segera sadar. Dia sudah menghindar, harusnya kamu sadar, bukan malah mengejar.&quot; 🌿 Versi Lengkap &amp; Diperindah &quot;Kadang kita sampai hilang akal demi seseorang, memberi semua, berharap dia akan tinggal. Tapi kita harus segera sadar: jika dia ingin pergi, biarkanlah pergi. Mengejar orang yang menghindar hanya akan menjadikanmu semakin terlihat tidak berharga.&quot; 🕯️ Kata-Kata Mutiara Serupa yang Menenangkan 1. &quot;Mencintai boleh, tapi jangan sampai lupa mencintai diri sendiri. Menunggu boleh, tapi tahu kapan harus berhenti.&quot; 2. &quot;Tidak semua hal harus diperjuangkan. Kadang melepaskan adalah cara terbaik untuk menyelamatkan diri.&quot; 3. &quot;Allah biarkan kamu disakiti, bukan untuk menghancurkanmu, tapi untuk membukakan mata hatimu, agar kamu sadar siapa yang pantas tinggal dan siapa yang harus dilepaskan.&quot; 4. &quot;Sakit itu wajar, itu tandanya kamu pernah tulus. Tapi jangan biarkan rasa sakit itu membuatmu lupa: kamu berharga, dan kamu pantas dicintai tanpa harus memohon.&quot; 5. &quot;Berhenti mengejar bayangan. Saat kamu berbalik, matahari akan kembali menyinari wajahmu.&quot; 🫂 Pesan Intinya - Hilang akal karena cinta itu manusiawi — tanda hatimu tulus 💛 - Tetaplah berharga — jangan memohon pada orang yang memilih menjauh - Sadar bukan berarti berhenti mencintai, tapi berhenti menyakiti diri sendiri 🕊️ #Katakatamutiara</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516607/3516607_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T09:40:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mohammad Hamza</video:title>
      <video:description>🇵🇰💫🇮🇳 𝐑𝐄𝐒𝐏𝐄𝐂𝐓 &amp; 𝐏𝐑𝐎𝐅𝐄𝐒𝐒𝐈𝐎𝐍𝐀𝐋𝐈𝐒𝐌 𝐀𝐋𝐖𝐀𝐘𝐒 𝐒𝐓𝐀𝐍𝐃 𝐀𝐁𝐎𝐕𝐄 𝐀𝐋𝐋.🤝✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516606/3516606_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-05T09:39:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>a fun day</video:title>
      <video:description>today i look so sexy #sexyhot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516605/3516605_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T09:39:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Al quran Surah Al Mulk. Tabarok.</video:title>
      <video:description>Al quran Surah almulk. Atau lebih dikenal surah tabarok. #Alquran #surah #surahalmulk #tabarok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516604/3516604_720p.mp4</video:content_loc>
      <video:duration>402</video:duration>
      <video:publication_date>2026-10-05T09:38:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosmic Strings: Invisible Threads of the Universe</video:title>
      <video:description>Cosmic strings are hypothetical ultra-thin structures that may have formed during the universe’s earliest moments. They could stretch across enormous cosmic distances while containing extraordinary energy. Although scientists have not confirmed their existence, these mysterious structures might leave detectable effects on light, gravity, and the large-scale structure of space. #CosmicStringsSpaceFactsUniverseCosmologyAstronomySpaceScienceDeepSpaceCosmicMysteryPhysicsAmazingUniverse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516603/3516603_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T09:37:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinta apakah itu cinta</video:title>
      <video:description>Koplo cinta apakah itu cinta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516602/3516602_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T09:36:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coming Soon 3</video:title>
      <video:description>&quot;Menyatukan mimpi dengan alam melalui detail bambu. ✨ Keindahan yang berkelanjutan dari jantung Bali. AKAN SEGERA DIBUKA. BAMBU BAR surga alam. #bambubar #disainbambu #arsitektur #kontruksi #eco #vibes #bali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516601/3516601_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T09:36:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goyangnya sanngekk banget goyang terus sampai keluar di dalam becek</video:title>
      <video:description>Sex MUKENA PUTIH VIRAL TIKTOK LINK VIDEY Most Viewed Mukena Putih Coolmax XXX stelah azka coolmax lanjut mukena Putih coolmaxxx Stream the full Mukena Putih Coolmax Viral Video : Bokep Mukena Putih Coolmax XXX Video video online here on CurioWhisper. This post is categorized under Bokep Indo, Bokep Indo Jilbab, Bokep Indo Terbaru, Bokep Indo Viral, Bokep Indonesia, Bokep Mukena Putih Coolmax, Mukena Putih Coolmax Porn, Mukena Putih Coolmax XXX Resmi Rilis Mukena Putih Yang Lagi Viral, Full Vidio ( Link Di K0m3nt4r ) #viralmukenaputih #mukenaputih #kakakadik #rokhijauviral #rokhijau #tukangcilokviral #gurubahasainggris #masukberanda #fypage #ffxml #anaksma #fyp #freefire #bugurubahasainggris Yang lagi viral dan banyak dicari, dulu mukena pink, sekarang mukena putih.. ytta 🤫 #mukenaputih #viral stelah azka coolmax lanjut mukena putih coolmax {Link ada di komentar} #azkafadhillah04 #garenafreefire #ff_lover #foryoupage #bugurubahasainggris #fyp #rokijo #ffxml #video #viral #blunder #masukberanda Yang lagi viral dan banyak dicari, dulu mukena pink, sekarang mukena putih.. ytta 🤫 #mukenaputih #viral Habis mukena pink ada lagi mukena putih yang lagi viral Link Video Mukena Putih Coolmax Viral! Disebut Lebih Hot dari Mukena Pink, Benarkah Ada Aslinya Link Video Mukena PutGek Diah Viral Lagi! Detail Dua Tato di Lengan dan Kutek Hitam Cowok Remes-Remes Bikin Penasaranih Coolmax Viral! Disebut Lebih Hot dari Mukena Pink, Benarkah Ada Aslinya Link Video Azka Fadillah Coolmax Full Durasi Tanpa Sensor Jadi Buruan Warganet, Benarkah Asli? Link Video Cut Salwa Dicari Lagi, Ada Part 2 dan 3 Disebut Lebih Hot Adegannya! Link Download Mukena Pink Viral Video Diburu Netizen, Ada yang Mantul-Mantul Mantap Viral Link Video Mukena Putih Coolmax jadi Buruan Warganet X dan TikTokouh ini ukhti </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516600/3516600_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T09:35:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gacha club edit</video:title>
      <video:description>Gacha player</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516599/3516599_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T09:34:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Serendipity (2026) Episode 25 Eng Sub</video:title>
      <video:description>Serendipity (2026) - CHINESE DRAMA Su Wan, an animal psychology major, has loved animals since childhood and can&apos;t bear to see them harmed. One day, she learns that a group of dogs has been kidnapped and trafficked. Disregarding her own safety, she follows the clues alone to the kidnappers&apos; hideout, determined to rescue the dogs. Finding herself in mortal danger after being discovered, she is suddenly saved by a stranger. Unbeknownst to Su Wan, this mysterious boy is none other than Bai Tian Yu, her childhood sweetheart from sixteen years ago. The two were inseparable as children, but various unforeseen events led to their separation. This thrilling encounter brings them back together, leading to a healing and sweet love story. Serendipity, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #Serendipity #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516598/3516598_720p.mp4</video:content_loc>
      <video:duration>2825</video:duration>
      <video:publication_date>2026-10-05T09:34:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hand press chopper</video:title>
      <video:description>Hand press chopper #chopper #useful #subscribe #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516597/3516597_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T09:33:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Collaboration video</video:title>
      <video:description>Enjoy the vide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516596/3516596_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T09:33:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Paradekersttractor 3</video:title>
      <video:description>Kerstmis #Belgische</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516595/3516595_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T09:31:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Infinite Upgrade System &amp;amp</video:title>
      <video:description>He Unlocked an Infinite Upgrade System &amp;amp; Built an Undead Army That Conquered the World | Anime Re...</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516594/3516594_720p.mp4</video:content_loc>
      <video:duration>7652</video:duration>
      <video:publication_date>2026-10-05T09:30:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Song 301</video:title>
      <video:description>Indian Song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516593/3516593_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T09:30:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berikan kesempatan untuk dapat kembali bersama</video:title>
      <video:description>🎶 &quot;Ku Siap Hidup Denganmu&quot; — Tri Suaka ft. Nabila Maharani Bagian lirik yang kamu maksud: &quot;Berikan ku kesempatan yang kedua kali Perbaiki semua ini Kini ku telah berbeda, tak seperti dulu Ku siap hidup denganmu&quot; #Berikankesempatan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516592/3516592_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T09:30:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Manatuto beach - Timor Leste</video:title>
      <video:description>Manatuto beach Timor Leste #Beach #trip #manatuto #Timorleste</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516591/3516591_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T09:29:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menyakitkan tapi nanti akan terbiasa</video:title>
      <video:description>Menyakitkan #Paris #france #kindomunited #canada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516590/3516590_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T09:29:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smart Spaces</video:title>
      <video:description>A seamless custom home for a zero-clearance refrigerator 🧊✨ Perfect integration in modern kitchen design 🏠💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516589/3516589_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T09:29:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Baby girl 10</video:title>
      <video:description>Masahalla</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516588/3516588_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T09:28:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kavita Kavita</video:title>
      <video:description>Kavita Kavita · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516587/3516587_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T09:27:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>President Republic of Indonesia Escort</video:title>
      <video:description>#Escort #Indonesia #Viral #Video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516586/3516586_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T09:27:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tenangku</video:title>
      <video:description>Tenangku #Paris #france #kindomunited</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516585/3516585_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T09:27:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Allah whit me</video:title>
      <video:description>mampir #fyppp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516584/3516584_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T09:27:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Barat Bridal Lengha 4</video:title>
      <video:description>Latest Design</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516583/3516583_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T09:27:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>جالندھر رائس ٹریڈرز فیصل آباد</video:title>
      <video:description>1509 ریجکشن سٹیم 🌾</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516582/3516582_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T09:26:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sholawat 161</video:title>
      <video:description>#Sholawat #muslim #lyrics #islam #hijab #style</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516581/3516581_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T09:24:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kota tua 2</video:title>
      <video:description>Kota tua #Kotatua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516580/3516580_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T09:23:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eudora jadi mak lampir</video:title>
      <video:description>Mobile legends hero eudora #Mobilelegendsindonesia #eudora</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516579/3516579_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-10-05T09:23:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mangga muda</video:title>
      <video:description>Mangga muda #Fruits</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516578/3516578_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T09:23:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sholawat 160</video:title>
      <video:description>#Sholawat #muslim #lyrics #islam #hijab #style</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516577/3516577_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T09:22:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pertualangan di pohon coklat</video:title>
      <video:description>Berkebun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516574/3516574_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T09:21:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Be Careful When Swimming in Rivers! 🐊😱</video:title>
      <video:description>A peaceful swim in a jungle river suddenly turns into a terrifying crocodile encounter. Always be careful when swimming in natural rivers and never underestimate wildlife. #crocodile #river #crocodileattack #wildlife #jungleriver #dangerousanimals #riverswimming #wildlifeencounter #nature #Indonesia #scarymoment #crocodileencounter #survival #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516573/3516573_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T09:21:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Health Almanac</video:title>
      <video:description>Your feet deserve attention, so see a doctor if a problem sticks around.…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516572/3516572_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T09:21:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Savage By obsidia 🔥</video:title>
      <video:description>you marksman but you ready to open war #MLBBMOBAGAME</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516571/3516571_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T09:20:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naaz Vlogs</video:title>
      <video:description>Friends Entry</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516570/3516570_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-05T09:19:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>morning atmosphere in the Papuan mountains</video:title>
      <video:description>morning atmosphere in the Papuan mountains #Mytrip #mountain #natural #westpapua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516569/3516569_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T09:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nazia choudhary</video:title>
      <video:description>Sahiwal Nashta Point</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516568/3516568_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T09:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>عائشہ ناز</video:title>
      <video:description>Wafa World😘🥀</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516567/3516567_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T09:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayesha Malik sargodha</video:title>
      <video:description>Ayesha Malik sargodha · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516566/3516566_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T09:17:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FOCUS MEDIA</video:title>
      <video:description>Did you see Annarajan getting ready to cut the cake? Annarajan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516565/3516565_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T09:16:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Serendipity (2026) Episode 24 Eng Sub</video:title>
      <video:description>Serendipity (2026) - CHINESE DRAMA Su Wan, an animal psychology major, has loved animals since childhood and can&apos;t bear to see them harmed. One day, she learns that a group of dogs has been kidnapped and trafficked. Disregarding her own safety, she follows the clues alone to the kidnappers&apos; hideout, determined to rescue the dogs. Finding herself in mortal danger after being discovered, she is suddenly saved by a stranger. Unbeknownst to Su Wan, this mysterious boy is none other than Bai Tian Yu, her childhood sweetheart from sixteen years ago. The two were inseparable as children, but various unforeseen events led to their separation. This thrilling encounter brings them back together, leading to a healing and sweet love story. Serendipity, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #Serendipity #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516564/3516564_720p.mp4</video:content_loc>
      <video:duration>2762</video:duration>
      <video:publication_date>2026-10-05T09:16:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daily health Brief 2</video:title>
      <video:description>دانت میں شدید درد؟ گال پر سوجن؟ 🦷</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516563/3516563_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T09:16:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Wags, Jennifer Hubner Wifey of Justin Hubner Football Player of Indonesia National Footbal</video:title>
      <video:description>#Sport #Football #Soccer #FIFA #ASEAN #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516562/3516562_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T09:15:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sadia khan</video:title>
      <video:description>AI content · ﻿Udit Narayan, Alka Yagnik · Yaar Badal Na Jaana</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516561/3516561_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T09:14:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ritika Gaurav Tales</video:title>
      <video:description>Only Wives can Relate 🤣😂</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516560/3516560_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T09:14:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stratton Douthat</video:title>
      <video:description>Get cha some!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516559/3516559_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T09:13:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drama mobile legends  skin naruto</video:title>
      <video:description>Drama mobile legends skin naruto #Mobilelegends #skinnaruto</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516558/3516558_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T09:13:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cat stuff</video:title>
      <video:description>#cat #animal #ai #model #dance #crazy #elon #gpt #astra #candy #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516557/3516557_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T09:12:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When an Ustadz Awakens the Six Paths Sage Mode! (Naruto Parody)</video:title>
      <video:description>A hilarious edited video showing an Indonesian man channeling the power of Hagoromo Otsutsuki, the Sage of Six Paths from Naruto. Watch this funny anime meme that perfectly blends local vibes with epic anime powers! #naruto #animeparody #sageofsixpaths #hagoromo #funnyedit #animememe #indonesianmeme #sixpathssagemode #ustadz</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516556/3516556_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T09:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Train Funny Video</video:title>
      <video:description>#Travel #train #funny #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516555/3516555_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T09:11:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>action movies2025</video:title>
      <video:description>sniper 2025</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516554/3516554_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-10-05T09:11:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Global Academy : NEET/ENGLISH/Notes / By F Malik</video:title>
      <video:description>Important Applications</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516553/3516553_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T09:11:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wowwww 7</video:title>
      <video:description>Gì zậy? #Ủaủa🤣</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516552/3516552_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T09:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOK game</video:title>
      <video:description>HOK GAME #Game #HOK</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516551/3516551_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T09:10:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Emranur Hoque Shawon</video:title>
      <video:description>Castle Combe Village, Cotswolds, England.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516550/3516550_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T09:10:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tanya Chaudhary</video:title>
      <video:description>shyamkalyana_official · Jo to utte ale Ne sadda Mada ni socheya I don care</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516549/3516549_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T09:09:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🫣🫣🫣🫣🫣 2</video:title>
      <video:description>🫣🫣🫣🫣🫣 #🫣🫣🫣🫣🫣</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516548/3516548_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T09:09:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yea duniya ak dulhan...</video:title>
      <video:description>50 views plz #Yeaduniyaakdulhandulhan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516547/3516547_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T09:08:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vilmey mantan Wili salim</video:title>
      <video:description>Hubungan yang kandas antara vilmei dan Wilisalim #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516546/3516546_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T09:08:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OMG ki obosta</video:title>
      <video:description>100 views plz #Omgkiobosta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516545/3516545_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T09:07:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masakan simple</video:title>
      <video:description>Yang mau resep nya komen ya simple mudah dan praktis #fyp #yummy #Makanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516544/3516544_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T09:06:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The natural beauty of the Raja Ampat Islands, West Papua</video:title>
      <video:description>The natural beauty of the Raja Ampat Islands, West Papua #Mytrip #beach #natural #westpapua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516543/3516543_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-05T09:06:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wow ki sundor sari</video:title>
      <video:description>2000 views #Wowkisundorsari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516542/3516542_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T09:06:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>lexi lore brazzers</video:title>
      <video:description>#brazzers #lexilore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516541/3516541_720p.mp4</video:content_loc>
      <video:duration>159</video:duration>
      <video:publication_date>2026-10-05T09:04:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>প্রাক্তন যখন বেস্ট ফ্রেন্ডের বউ! 💔😭 | Jovan | Keya Payel | New Natok 2026 | Bangla Natok</video:title>
      <video:description>প্রাক্তন যখন বেস্ট ফ্রেন্ডের বউ! 💔😭 | Jovan | Keya Payel | New Natok 2026 | Bangla Natok #BanglaNatok2026​‎NewBanglaNatok​‎NewBanglaNatok2025​‎NewBanglaNatok2026​‎BanglaNewNatok​‎BanglaNewNatok2025​‎BanglaDrama​‎BengaliDrama2025​‎BangladeshiDrama​‎BangladeshiDrama2025​‎BangladeshiNatok​‎FarhanAhmedJovan​​JovanNatok​​JovanNewNatok2026​​KeyaPayel​​KeyaPayelNatok​​KeyaPayel2026​​TumiAmar​​TumiAmarFullNatok​​তুমিআমার​​তুমিআমারনাটক​​NewNatok2025​BanglaNatok2025​pakistanidramanatok​shorts​romantic​romanticstatus​whatsappstatus​‎banglanatok​newhindisong​newhindirelaxcingsong​mindrelaxcing​HDRvideo​nirjonnatok​pakistannewdramanatok​‎​‎‎Natok​‎NewNatok2025​‎NewNatok2026​‎BanglaNatok2025​‎BanglaNatok2026​‎NewBanglaNatok​‎NewBanglaNatok2025​‎NewBanglaNatok2026​‎BanglaNewNatok​‎BanglaNewNatok2025​‎BanglaDrama​‎BengaliDrama2025​‎BangladeshiDrama​</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516540/3516540_720p.mp4</video:content_loc>
      <video:duration>757</video:duration>
      <video:publication_date>2026-10-05T09:04:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Young Woman Enjoying Sunny Day</video:title>
      <video:description>Sunny beach lifestyle footage shows a young woman enjoying a peaceful vacation beside the sea. She wears sunglasses and a bikini while lying on the sandy shore and relaxing under the summer sun. Ocean waves gently move toward her along the coastline, creating a natural and calming atmosphere. Perfect for stock video projects about travel, tourism, beach holidays, summer vacations, relaxation, ocean destinations, and outdoor leisure. #youngwoman #beachvacation #bikini #sunglasses #sunbathing #summerbeach #oceanwaves #seaside #sandybeach #summerholiday #beachlifestyle #tropicalvacation #femaletraveler #oceanshore #sunnybeach #relaxingwoman #travellifestyle #summertravel #beachrelaxation #coastalvacation #seawaves #vacationgetaway #tropicalbeach #holidaytravel #seasidelifestyle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516539/3516539_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T09:02:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aku bukan jodohnya</video:title>
      <video:description>Pasti yang kamu cari adalah lagu &quot;Aku Bukan Jodohnya&quot; 🎵 Ini lagu yang sangat populer, dinyanyikan oleh Tri Suaka 🎤 📌 Info Lagu - Penyanyi: Tri Suaka - Judul: Aku Bukan Jodohnya - Lirik inti: &quot;Sudah takdirnya aku bukan jodohnya... Tuhan pertemukan bukan untuk bersamanya...&quot; 🎬 Cara Menonton Video Musik Kamu bisa langsung cari &amp; tonton di: - YouTube → ketik: Tri Suaka - Aku Bukan Jodohnya - TikTok / Instagram → banyak klip video musik &amp; liriknya - Spotify / Joox → untuk mendengarkan audionya Video resminya sudah ditonton puluhan juta kali lho! 😢💔 #Videomusikakubukanjodohnya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516538/3516538_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T09:02:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why Nigerian Parents Hate School Fees!</video:title>
      <video:description>Nigerian parents reacting to school fees is a whole mood that never gets old. Most dads act like they can just call the principal to negotiate the bill when it hits 180k. This hilarious struggle is exactly what every student fears when they bring home the termly payment slip. 🤣 Rate your dad&apos;s reaction to school fees from 1-10! 👇 #Familydrama #schoolfees #Africanparents #school #daddydearest</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516537/3516537_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T09:02:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nmax_cinematic</video:title>
      <video:description>nmaxold</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516536/3516536_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T09:01:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When you finally find your happy place! 🌳✨</video:title>
      <video:description>When you finally find your happy place! 🌳✨ Welcome to the jungle treehouse where every day is magic! Who would you bring here? 👇</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516535/3516535_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T09:00:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>She Jumped From An Elephant Trampoline And Landed On A Running Horse! INSANE! 😱🐴</video:title>
      <video:description>This circus acrobat did the IMPOSSIBLE! Jumped off an elephant trampoline, did multiple flips 20 feet high, and landed perfectly standing on a running horse! 🤸‍♀️🐴🐘 This is real talent! No wires! No tricks! Would you try this? Comment below! 👇 Follow for more insane circus moments! #shortscircusacrobat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516534/3516534_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T08:59:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AMAZING violin cover of I Knew You Were Trouble</video:title>
      <video:description>AMAZING violin cover of I Knew You Were Trouble #music #violincover #musiccover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516533/3516533_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-10-05T08:59:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dibana hai yea man....</video:title>
      <video:description>#Dibanahaiyeaman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516532/3516532_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T08:58:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inheritance Detective (2025) Episode 3 Eng Sub</video:title>
      <video:description>Inheritance Detective - JAPAN DRAMA Haie Nao is a private detective who specializes in inheritance cases. He runs his own office, Haie Inheritance Investigation Office. He once worked as an elite lawyer, but due to a certain reason, he was kicked out of the lawyers&apos; association. He is also a coffee otaku. When he thinks, he likes to munch on plain coffee beans. He also hates the phrase, &quot;Dead men tell no tales.&quot; Haie Nao takes on challenging inheritance cases and uses his high intelligence and the help of people with colorful personalities. While respecting the will of the deceased, Haie Nao tries to solve the family conflicts and the hidden truths within the inheritance. Inheritance Detective, romancedrama, daramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #InheritanceDetective #romancedrama #daramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516531/3516531_720p.mp4</video:content_loc>
      <video:duration>2696</video:duration>
      <video:publication_date>2026-10-05T08:57:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nolan</video:title>
      <video:description>Mpl philipin #Mpl #mlbb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516530/3516530_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T08:56:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Suasana pagi di kampung 2</video:title>
      <video:description>Suasana pagi di kampung halaman #Sukorejo #kendal #jawatengah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516529/3516529_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T08:56:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing music performance with only one guitar string</video:title>
      <video:description>Amazing music performance with only one guitar string #music #musicperformance #guitarmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516528/3516528_720p.mp4</video:content_loc>
      <video:duration>194</video:duration>
      <video:publication_date>2026-10-05T08:55:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tutorial cara top up folgers</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516527/3516527_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-10-05T08:55:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night Time Atmosphere in a Tent by The Lake</video:title>
      <video:description>Night time atmosphere in a tent by the lake. Finally, after pitching the tent by the shores of Lake Tumutan on Mount Patah, it is now approaching bedtime. #atmospheretentlakehikers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516526/3516526_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T08:54:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bound Under Her Skirt (2026) Eng Sub</video:title>
      <video:description>Bound Under Her Skirt (2026) Eng Sub Bound Under Her Skirt, I Fell For The Girl She Feared, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #BoundUnderHerSkirt #IFellForTheGirlSheFeared #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516525/3516525_720p.mp4</video:content_loc>
      <video:duration>1278</video:duration>
      <video:publication_date>2026-10-05T08:53:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gabung modal 90,000 ribu di folgers gajian setiap hari</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516524/3516524_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-10-05T08:53:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Serendipity (2026) Episode 23 Eng Sub</video:title>
      <video:description>Serendipity (2026) - CHINESE DRAMA Su Wan, an animal psychology major, has loved animals since childhood and can&apos;t bear to see them harmed. One day, she learns that a group of dogs has been kidnapped and trafficked. Disregarding her own safety, she follows the clues alone to the kidnappers&apos; hideout, determined to rescue the dogs. Finding herself in mortal danger after being discovered, she is suddenly saved by a stranger. Unbeknownst to Su Wan, this mysterious boy is none other than Bai Tian Yu, her childhood sweetheart from sixteen years ago. The two were inseparable as children, but various unforeseen events led to their separation. This thrilling encounter brings them back together, leading to a healing and sweet love story. Serendipity, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #Serendipity #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516523/3516523_720p.mp4</video:content_loc>
      <video:duration>2715</video:duration>
      <video:publication_date>2026-10-05T08:52:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fairway Of Love (2026) Episode 5 Eng Sub</video:title>
      <video:description>Fairway Of Love (2026) Nana, the daughter of a golf course tycoon, is suddenly called back from studying fashion in Europe to save the business from crisis. There, she meets Pro Vee, a former skilled golf pro who is now the resident golf pro. Pro Vee is strict, demanding, and displeased that Nana knows nothing about golf, the sport she loves and is so dedicated to. The two must cooperate to save Nana&apos;s father&apos;s golf course, leading to a deep and romantic relationship. However, things aren&apos;t as simple as they should be. A major obstacle hindering Nana and Pro Vee&apos;s goals is Pro Jin, another highly skilled golf pro from a rival golf course. This often leads to verbal clashes with Belle, Nana&apos;s father&apos;s secretary, who is sent to assist and be Nana&apos;s right-hand woman. Fairway Of Love, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #FairwayOfLove #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516522/3516522_720p.mp4</video:content_loc>
      <video:duration>3713</video:duration>
      <video:publication_date>2026-10-05T08:52:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nevy 👍👍👍</video:title>
      <video:description>Nevy🙈🙉 #hot46111</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516521/3516521_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T08:52:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>building a house from a shipwreck</video:title>
      <video:description>building a house from a carcass</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516520/3516520_720p.mp4</video:content_loc>
      <video:duration>178</video:duration>
      <video:publication_date>2026-10-05T08:51:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shou transforms into Ultraman Victory</video:title>
      <video:description>ultraman Ginga s episode 1 #ultramanGinga #ultramanvictory #ultramangingaS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516519/3516519_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-05T08:51:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cara klaim penghasilan setiap hari folgers</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516518/3516518_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T08:51:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing music perpformmance</video:title>
      <video:description>Amazing music perpformmance #misic #vlogmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516517/3516517_720p.mp4</video:content_loc>
      <video:duration>367</video:duration>
      <video:publication_date>2026-10-05T08:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terik matahari</video:title>
      <video:description>Suasanan siang ini terik mataharinya menyengat sekali #Cuacatidakbersahabat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516516/3516516_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T08:51:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cara klaim penghasilan di aplikasi folgers</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516515/3516515_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-10-05T08:50:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The simple process of making dentures</video:title>
      <video:description>Process making dentures before and after #Dentisdentures #tooth #smiles #process #before #after #making #dentis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516514/3516514_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-05T08:49:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Part 3 rumah mertua</video:title>
      <video:description>Aku hanya ingin di terima</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516513/3516513_720p.mp4</video:content_loc>
      <video:duration>140</video:duration>
      <video:publication_date>2026-10-05T08:48:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AMVアニメ 『AMVMAD』 エルバフ編 最新情報を</video:title>
      <video:description>#anime #AMV #mad #amvmad #video #viral #trending #bilibili #tv</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516512/3516512_720p.mp4</video:content_loc>
      <video:duration>145</video:duration>
      <video:publication_date>2026-10-05T08:48:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cara klaim absen harian cuan folgers</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516511/3516511_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-10-05T08:48:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tekken 6 hand to hand combat pro 2</video:title>
      <video:description>Tekken 6 hand to hand combat pro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516510/3516510_720p.mp4</video:content_loc>
      <video:duration>196</video:duration>
      <video:publication_date>2026-10-05T08:47:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>harvesting wild forest honey at great heights</video:title>
      <video:description>harvesting wild forest honey at great heights #harvestingwildforesthoneyatgreatheights</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516509/3516509_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T08:47:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Messi estaba loco… 😳🔥 ¡Nadie podía detenerlo!</video:title>
      <video:description>Messi estaba loco… 😳🔥 ¡Nadie podía detenerlo! Descripción: Messi estaba completamente loco en esta jugada. 😳⚽🔥 Su velocidad, control y talento dejaron a todos sin reacción. Una de esas jugadas que demuestran por qué Lionel Messi es una leyenda del fútbol. 🐐🇦🇷 ¿Habías visto esta locura de Messi? 👀🔥 Contenido para fans del fútbol español, LaLiga, Champions League y fútbol europeo. 🇪🇸🏆🌍 #Messi #LionelMessi #MessiMagic #Futbol #Fútbol #FutbolEuropeo #FutbolEspañol #LaLiga #ChampionsLeague #UCL #FutbolFans #FutbolViral #MessiEdit #FutbolShorts #Football #Soccer #GOAT</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516508/3516508_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T08:46:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cara cuan brutal dari folgers</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516507/3516507_720p.mp4</video:content_loc>
      <video:duration>547</video:duration>
      <video:publication_date>2026-10-05T08:46:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mark ZUCKERBERG  family tree 🥰</video:title>
      <video:description>Mark Zuckerberg Family Tree From his parents Edward &amp; Karen, to his wife Priscilla Chan #markzuckerberg #familytree #zuckerberg #tech #legacy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516506/3516506_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T08:45:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tekken 6 hand to hand combat pro</video:title>
      <video:description>Tekken 6 hand to hand combat pro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516505/3516505_720p.mp4</video:content_loc>
      <video:duration>231</video:duration>
      <video:publication_date>2026-10-05T08:45:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cara bermain folgers bisnis cuan</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516504/3516504_720p.mp4</video:content_loc>
      <video:duration>619</video:duration>
      <video:publication_date>2026-10-05T08:43:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan sunrise 2</video:title>
      <video:description>Sunrise — a fresh beginning every day 🌅✨ Golden light painting the sky, waking the world with hope and warmth. Nature’s most beautiful promise: no matter what, the sun always rises again 💛 #SunriseSunriseLoversMorningViewNatureBeautyGoldenHourDawnPeacefulMomentsNaturePhotography</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516503/3516503_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T08:42:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AL QUR&apos;AN KAREEM</video:title>
      <video:description>AL QUR&apos;AN KAREEM #ALQURANKAREEM</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516502/3516502_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-10-05T08:42:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>STOP SCROLLING… You Won’t Believe This! 😱🔥</video:title>
      <video:description>🚨 STOP SCROLLING! You NEED to see what happens next… 👀🔥 One moment. One vibe. Pure magic. ✨ Watch till the end—and tell me in the comments what you think! 👇🔥 ❤️ Like if this caught your attention 💬 Comment your reaction 📲 Share it with someone who needs to see this ➕ Follow for more! #viralvideo #trendingvideo #viralreels #trendingreels #mustwatch #watchtilltheend #amazing #unbelievable #satisfying #wowmoment #incredible #mindblowing #epicmoment #trendingnow #goingviral #viralcontent #socialmediaviral #explorepage #FYP #ForYou #InstagramReels #FacebookReels #YouTubeShorts #shortvideo #popular #entertainment #amazingmoments #trendingcontent #sharethis #followformore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516501/3516501_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T08:42:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Folgers menuju 2 juta mitra di indonesia</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516500/3516500_720p.mp4</video:content_loc>
      <video:duration>609</video:duration>
      <video:publication_date>2026-10-05T08:42:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 12</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516499/3516499_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T08:41:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Curvy Babe Neyleeen Ashley in Bikini Model Posing</video:title>
      <video:description>Sexy Curvy Babe Neyleeen Ashley in Bikini Model Posing Hot, Desi, Beauty, girl, woman, model, best, top, new, sexy, saree, indian, india, arabic, teen, Desire, video, reel, post, fb, insta, ticktok, live, news, trending, viral, vids, #Amazing, #beauty, #fbreels, #beautiful, #girlfriend, #Women, #beach, #health, #fitness, #design, #artist, #trendingreels, #reelsvideo, #trending, #trend, #business, #gym, #fb, #instagram, #viralvideo, #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids #Amazing #fbreels #beautiful #girlfriend #Women #beach #health #fitness #design #artist #trendingreels #reelsvideo #trend #business #gym #instagram #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516498/3516498_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T08:41:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pagi hari adalah waktu terbaik untuk menolak musibah dengan sedekah.</video:title>
      <video:description>Kata Nabi, musibah tidak akan mendahului sedekah di hari yang sama. Sebelum mulai aktivitas, yuk sisihkan sedikit rezekimu agar Allah jaga dari segala marabahaya.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516497/3516497_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T08:41:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Papa punya peran yang nggak kalah penting dalam tumbuh kembang si kecil, Mommy</video:title>
      <video:description>Peluk, cium, ajak main, atau sekadar meluangkan waktu bersama si kecil ternyata bukan cuma jadi momen bonding, tapi juga bisa menjadi bagian dari stimulasi untuk mendukung perkembangannya. Jadi, jangan tunggu si kecil besar untuk mulai dekat dengan Papa. Kehadiran Papa sejak dini juga punya arti besar untuk si kecil. 🥹 Tetap perhatikan beberapa hal saat berinteraksi dengan bayi, terutama soal mencium bayi dan paparan residu rokok ya, Mommy. Save dulu ya, Mommy, biar nggak lupa sama hal-hal kecil yang ternyata berarti. Share juga ke Paksu, biar Papa tahu kalau perannya juga penting dalam tumbuh kembang si kecil. 🤍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516496/3516496_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-10-05T08:40:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sad story 40</video:title>
      <video:description>#Story</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516495/3516495_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T08:40:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Apa yang terjadi ketika Nabi Isa AS muncul kembali?</video:title>
      <video:description>Apakah benar ketika nabi Isa AS turun kembali ke bumi menjadi tanda tanda akhir jaman? Yuk support content creator kecil dengan : Subs : stickitive Tiktok : @stickitive</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516494/3516494_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-10-05T08:40:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot Indian Bong Beautiful Girl - Prety Roy Sexy Video</video:title>
      <video:description>Hot Indian Bong Beautiful Girl - Prety Roy Sexy Video Hot, Desi, Beauty, girl, woman, model, best, top, new, sexy, saree, indian, india, arabic, teen, Desire, video, reel, post, fb, insta, ticktok, live, news, trending, viral, vids, #Amazing, #beauty, #fbreels, #beautiful, #girlfriend, #Women, #beach, #health, #fitness, #design, #artist, #trendingreels, #reelsvideo, #trending, #trend, #business, #gym, #fb, #instagram, #viralvideo, #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids #Amazing #fbreels #beautiful #girlfriend #Women #beach #health #fitness #design #artist #trendingreels #reelsvideo #trend #business #gym #instagram #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516493/3516493_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T08:39:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shehzadi House Episode 4 [ENG CC] Nawal Saeed - Omer Shahzad - 3rd October</video:title>
      <video:description>Shehzadi House Episode 4 [ENG CC] Nawal Saeed - Omer Shahzad - 3rd October #ShehzadiHouseEpisode4ENGCCNawalSaeed-OmerShahzad-3rdOctober</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516492/3516492_720p.mp4</video:content_loc>
      <video:duration>2236</video:duration>
      <video:publication_date>2026-10-05T08:39:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Part 2 rumah mertua</video:title>
      <video:description>Rumah mertuaa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516491/3516491_720p.mp4</video:content_loc>
      <video:duration>216</video:duration>
      <video:publication_date>2026-10-05T08:39:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dancing 🐈</video:title>
      <video:description>Dance, viral, video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516490/3516490_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T08:39:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Top 3 Funniest Mom vs Kid Study Moments! 🤣</video:title>
      <video:description>eaching kids can test any mom’s patience! Watch these hilarious compilation clips of moms trying to help their kids study, from spelling mix-ups to basic math logic that goes completely wrong. Guaranteed to make you laugh! Don&apos;t forget to like, comment, and subscribe for more funny family content! #Funnymomstudymoments #Momteachingkidcomedy #Top3funnymommoments #Momvskidhomeworkcomedy #Funnyparentingmoments #Mathstudyfailcomedy #Indonesianmomfunnymoments #Kidsfunnyanswersstudy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516489/3516489_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T08:38:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reggie Was Shocked Raud Went This Hard! 😭</video:title>
      <video:description>Reggie Was Shocked Raud Went This Hard! 😭 #creator</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516488/3516488_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T08:38:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Asian Beautiful Girl Waiting For You !!!</video:title>
      <video:description>Hot, Desi, Beauty, girl, woman, model, best, top, new, sexy, saree, indian, india, arabic, teen, Desire, video, reel, post, fb, insta, ticktok, live, news, trending, viral, vids, #Amazing, #beauty, #fbreels, #beautiful, #girlfriend, #Women, #beach, #health, #fitness, #design, #artist, #trendingreels, #reelsvideo, #trending, #trend, #business, #gym, #fb, #instagram, #viralvideo, #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids #Amazing #fbreels #beautiful #girlfriend #Women #beach #health #fitness #design #artist #trendingreels #reelsvideo #trend #business #gym #instagram #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516487/3516487_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T08:38:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>​&quot;Rhythm &amp; Grace.&quot;</video:title>
      <video:description>The best remedy to get your mood back: play your favorite song and start dancing. #dancedancerdancelifedancevideodancecoverdancereelsdancetrend</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516486/3516486_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T08:37:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 11</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516485/3516485_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T08:37:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516484</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516484/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kuningan_kuningan</video:title>
      <video:description>view</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516484/3516484_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T08:36:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Labubu 3</video:title>
      <video:description>Labubu and friends</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516483/3516483_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T08:36:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot Sexy Beautiful Model - #bikini #Show #Reel #Video</video:title>
      <video:description>Hot Sexy Beautiful Model - #bikini #Show #Reel #Video #clevageshow #navelshow #boldreels Hot, Desi, Beauty, girl, woman, model, best, top, new, sexy, saree, indian, india, arabic, teen, Desire, video, reel, post, fb, insta, ticktok, live, news, trending, viral, vids, #Amazing, #beauty, #fbreels, #beautiful, #girlfriend, #Women, #beach, #health, #fitness, #design, #artist, #trendingreels, #reelsvideo, #trending, #trend, #business, #gym, #fb, #instagram, #viralvideo, #clevage #show #navel #see #bold #reels #bikini #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids #Amazing #fbreels #beautiful #girlfriend #Women #beach #health #fitness #design #artist #trendingreels #reelsvideo #trend #business #gym #instagram #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516482/3516482_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T08:36:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Part 1 rumah mertua</video:title>
      <video:description>Rumah mertua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516481/3516481_720p.mp4</video:content_loc>
      <video:duration>140</video:duration>
      <video:publication_date>2026-10-05T08:36:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monyet mencuri pisang</video:title>
      <video:description>1. Monyet Nyuri Pisang, Langsung Kena Karma! 🤣 2. Pencuri Pisang Paling Apes, Nyungsep Ke Got! 🐒🍌 3. Monyet Nyuri Pisang Gagal Kabur, Jatuh Di Got! #monyetmonyetlucupisangnyurikarmaviralngakaklucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516480/3516480_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T08:34:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teaser Trailer The Doll Ghawiah</video:title>
      <video:description>It all began with an accident on Babakan Siliwangi Road. Nala encountered a mysterious girl and her doll in the Babakan Siliwangi forest. The doll was named Ghawiah—a name meaning &quot;lost.&quot; Since the accident, strange occurrences have begun to haunt the local residents. Are you ready to play with Ghawiah? #film #trailer #new #horor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516479/3516479_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-05T08:33:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516478</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516478/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 10</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516478/3516478_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T08:32:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rumah ikan</video:title>
      <video:description>Di desa rumah penuh macam² ikan #ikan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516477/3516477_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T08:32:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Makan bersama 10</video:title>
      <video:description>#makan bersama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516476/3516476_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T08:29:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Image information have Google</video:title>
      <video:description>Image information have Google text. More information available in this video. If you want to know more information watch full video also available here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516475/3516475_720p.mp4</video:content_loc>
      <video:duration>321</video:duration>
      <video:publication_date>2026-10-05T08:29:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516474</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516474/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NEW STUDENTS BECOME NUMBER ONE IN SCHOOL</video:title>
      <video:description>New students are determined to be number one in school.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516474/3516474_720p.mp4</video:content_loc>
      <video:duration>186</video:duration>
      <video:publication_date>2026-10-05T08:28:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pertarungan sengit</video:title>
      <video:description>fierce battle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516473/3516473_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T08:27:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Penjelasan bisnis folgers cuan</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516472/3516472_720p.mp4</video:content_loc>
      <video:duration>463</video:duration>
      <video:publication_date>2026-10-05T08:27:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 9</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516471/3516471_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T08:26:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Edukasi folgers</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516470/3516470_720p.mp4</video:content_loc>
      <video:duration>1244</video:duration>
      <video:publication_date>2026-10-05T08:25:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tutorial upgrade di folgers</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516469/3516469_720p.mp4</video:content_loc>
      <video:duration>339</video:duration>
      <video:publication_date>2026-10-05T08:24:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A day in my life 8</video:title>
      <video:description>A day in my life #travel #dayinmylive</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516468/3516468_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T08:23:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516467</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516467/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bitcoin Analysis &amp; Today&apos;s Crypto Market Outlook | BTC Price Update</video:title>
      <video:description>Welcome back! Today we take a deep dive into the current cryptocurrency market setup, covering key macro drivers, Bitcoin&apos;s price consolidation, and liquidations across major exchanges. 📌 IN THIS VIDEO: 0:00 - Global Market Sentiment &amp; Macro Overview 0:45 - Bitcoin (BTC) Price Action &amp; Support/Resistance Levels 1:30 - Institutional Inflows &amp; On-Chain Holder Analysis 2:10 - Market Outlook &amp; Key Levels to Watch 📊 KEY TAKEAWAYS: • Bitcoin (BTC) continues to defend lower support zones, testing key resistance around the $86K level. • Spot ETF net inflows remain consistent, providing a steady baseline bid. • On-chain data indicates long-term holder supply remains largely illiquid. • Leverage strain in derivatives remains low with balanced funding rates. 💬 What’s your price target for BTC this week? Let us know in the comments below! 🔔 Subscribe for daily, data-driven crypto market overviews! #BitcoinBTCCryptoMarketCryptoNewsBitcoinAnalysisBlockchain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516467/3516467_720p.mp4</video:content_loc>
      <video:duration>420</video:duration>
      <video:publication_date>2026-10-05T08:22:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Folgers bagi2 sedekah kaum dhuafa</video:title>
      <video:description>🏆Folgers Investasi🥇 Modal Rp 90,000 ribu Link join Folgers pendaftaran klik 👇 https://www.cafe-folgers.xin/fc/register/280318 #Folgersinvestasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516466/3516466_720p.mp4</video:content_loc>
      <video:duration>575</video:duration>
      <video:publication_date>2026-10-05T08:22:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Say,...</video:title>
      <video:description>Deus é a tua fortaleza. Ele te dá pés firmes como os da cerva e te leva às alturas. 🏔️ 📖 Habacuque 3:19 Segue para receber uma palavra de Deus por dia 🙏✨ Hashtags: #Fé #Deus #SoluçãoDivina</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516465/3516465_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T08:21:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 8</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516464/3516464_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T08:21:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Biarkan musik yang mengungkapkan apa yang tak mampu diucapkan.” 🎧🖤</video:title>
      <video:description>#Musik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516463/3516463_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-10-05T08:20:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐼 “I’m Alone… Please, I’m Hungry” 🥺 | Cute Panda That Will Melt Your Heart</video:title>
      <video:description>Have you ever seen a panda this adorable? 🐼🥺 This lonely little panda seems to be saying, “Please… I’m hungry.” ❤️ Watch until the end and let this cute panda brighten your day! Don’t forget to like, share, and follow for more adorable animal moments. 🐼✨ #cutepanda #hungrypanda #lonelypanda #pandavideo #cuteanimal #adorablepanda #funnypanda #pandaaskingforfood #cuteanimals #animalvideo #pandalover #adorableanimals #viralpanda #pandashorts #cuteanimalshorts #funnyanimals #wildlife #pandabear #pandalovers #heartwarmingvideoHashtagsPandaCutePandaHungryPandaCuteAnimalsAdorableAnimalsFunnyAnimalsPandaLoversAnimalLoversViralPandaPandaVideoCuteVideoAnimalShortsShortsViralShortsPandaBear</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516462/3516462_720p.mp4</video:content_loc>
      <video:duration>103</video:duration>
      <video:publication_date>2026-10-05T08:20:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan-jalan bersama teman</video:title>
      <video:description>Jalan santai melepas penat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516461/3516461_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T08:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny Parrot 2</video:title>
      <video:description>#Funny #Parrot #justforfun #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516460/3516460_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T08:19:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516459</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516459/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Blood Oath – First Look</video:title>
      <video:description>Offered a new life by Thomas (Dwi Sasono), Mara (Asmara Abigail) instead finds herself in a terrifying situation 👀 First Look: *Sumpah Darah* ‼️ It started as a chance for a fresh start, but things turned out to be far from simple. What exactly is going on between Mara and Thomas? 🤫 #mytrip #filmfilmhoror #trailer #new</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516459/3516459_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T08:19:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516458</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516458/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Borrowed Glances (2026) Eng Sub</video:title>
      <video:description>Borrowed Glances (2026) Eng Sub Borrowed Glances, I Fell For The Girl She Feared, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #BorrowedGlances #IFellForTheGirlSheFeared #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516458/3516458_720p.mp4</video:content_loc>
      <video:duration>3028</video:duration>
      <video:publication_date>2026-10-05T08:18:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516457</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516457/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>build a small house</video:title>
      <video:description>build a small house</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516457/3516457_720p.mp4</video:content_loc>
      <video:duration>111</video:duration>
      <video:publication_date>2026-10-05T08:18:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516456</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516456/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kehidupan 21</video:title>
      <video:description>Kehidupan #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516456/3516456_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-10-05T08:18:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516455</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516455/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inheritance Detective (2025) Episode 2 Eng Sub</video:title>
      <video:description>Inheritance Detective - JAPAN DRAMA Haie Nao is a private detective who specializes in inheritance cases. He runs his own office, Haie Inheritance Investigation Office. He once worked as an elite lawyer, but due to a certain reason, he was kicked out of the lawyers&apos; association. He is also a coffee otaku. When he thinks, he likes to munch on plain coffee beans. He also hates the phrase, &quot;Dead men tell no tales.&quot; Haie Nao takes on challenging inheritance cases and uses his high intelligence and the help of people with colorful personalities. While respecting the will of the deceased, Haie Nao tries to solve the family conflicts and the hidden truths within the inheritance. Inheritance Detective, romancedrama, daramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #InheritanceDetective #romancedrama #daramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516455/3516455_720p.mp4</video:content_loc>
      <video:duration>2696</video:duration>
      <video:publication_date>2026-10-05T08:18:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516454</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516454/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Serendipity (2026) Episode 22 Eng Sub</video:title>
      <video:description>Serendipity (2026) - CHINESE DRAMA Su Wan, an animal psychology major, has loved animals since childhood and can&apos;t bear to see them harmed. One day, she learns that a group of dogs has been kidnapped and trafficked. Disregarding her own safety, she follows the clues alone to the kidnappers&apos; hideout, determined to rescue the dogs. Finding herself in mortal danger after being discovered, she is suddenly saved by a stranger. Unbeknownst to Su Wan, this mysterious boy is none other than Bai Tian Yu, her childhood sweetheart from sixteen years ago. The two were inseparable as children, but various unforeseen events led to their separation. This thrilling encounter brings them back together, leading to a healing and sweet love story. Serendipity, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #Serendipity #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516454/3516454_720p.mp4</video:content_loc>
      <video:duration>2800</video:duration>
      <video:publication_date>2026-10-05T08:17:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Friends 53</video:title>
      <video:description>Friends always made fun 😁 #Comedy #fun #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516453/3516453_720p.mp4</video:content_loc>
      <video:duration>126</video:duration>
      <video:publication_date>2026-10-05T08:17:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516452</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516452/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juliet &amp; Juliet (2026) Episode 5 Eng Sub</video:title>
      <video:description>Juliet &amp; Juliet (2026) Blue, the only daughter of the Monchaitrakul household, moves to a provincial convent school where she meets Tokyo, the youngest daughter of Sia Po, a powerful local figure of the Khongpirum family. Love blossoms between them, but it&apos;s a forbidden love, as their long-feuding families are locked in a power struggle. When heirs of two feuding families become one another&apos;s first love, will it end in love or tragedy? Juliet &amp; Juliet, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #JulietJuliet #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516452/3516452_720p.mp4</video:content_loc>
      <video:duration>2716</video:duration>
      <video:publication_date>2026-10-05T08:17:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516451</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516451/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Easy English Verbs for Kids!</video:title>
      <video:description>Learn basic English action verbs with us! Simple, fun, and perfect for kids and beginners. ✨ #englishforkids #learnenglish #englishverbs #actionverbs #basicenglish #englishvocabulary #eslforbeginners #kidslearning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516451/3516451_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T08:16:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516450</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516450/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 74</video:title>
      <video:description>shirui lily flower</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516450/3516450_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T08:15:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#bikinn laper bule</video:title>
      <video:description>masakan khas Indonesia #hiburan #kuliner #wisata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516449/3516449_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T08:15:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terserah lu aja meliii🗿</video:title>
      <video:description>Funny #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516448/3516448_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T08:14:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hanya anggap teman</video:title>
      <video:description>Hnya anggap teman biasa, dan tidak ada hub an lebih #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516447/3516447_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T08:14:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516446</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516446/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The funny dog</video:title>
      <video:description>The funny dog #dog #funny #funnydog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516446/3516446_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T08:13:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Read This Dhikr Daily | La Hawla Wala Quwwata Illa Billah | Rizq &amp; Barakah</video:title>
      <video:description>Description: Recite La Hawla Wala Quwwata Illa Billah with sincerity and remember Allah throughout your day. May Allah grant you halal rizq, ease, protection, and barakah in your work and life. Ameen. 🤲 Tags: #LaHawlaWalaQuwwataIllaBillah #LaHawlaWalaQuwwataIllaBillahDua #LaHawlaWalaQuwwataIllaBillahBenefits #LaHawlaWalaQuwwataIllaBillahDhikr #PowerfulDhikr #PowerfulDua #DuaforRizq #RizqDua #DuaforSuccess #DuaforBusiness #BusinessBarakah #RizqandBarakah #HalalRizq #IncreaseRizq #DuaforMoney #IslamicDua #IslamicDhikr #DailyDhikr #DhikrforRizq #DhikrforSuccess #IslamicReminder #QuranReminder #Allah #Muslim #IslamicMotivation #DailyIslamicReminder #IslamicShorts #YouTubeShorts #DuaforProtection #DuaforEase #BarakahinBusiness #BusinessSuccess #AllahsHelp #TrustinAllah #LaHawla #WalaQuwwataIllaBillah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516445/3516445_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T08:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautiful fish 4</video:title>
      <video:description>fish #fish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516444/3516444_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T08:12:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ella Langley is the new Country Queen!</video:title>
      <video:description>Ella Langley is the new Country Queen! #countrymusic #ellalangleymusic #ellalangley #countrymusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516443/3516443_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T08:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FIFA ASEAN CUP INDONESIA VS BANGLADESH (9-2)</video:title>
      <video:description>Indonesia goes to final FIFA ASEAN CUP 2026 After beating Bangladesh 9-2 #FIFA #FOOTBALL #SOCCER #INDONESIA #VIRAL #VIDEO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516442/3516442_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-10-05T08:12:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Got the money</video:title>
      <video:description>Got the money #money</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516441/3516441_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T08:12:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Making very long food</video:title>
      <video:description>#Food #Streetfood #Cook</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516440/3516440_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-05T08:11:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Don&apos;t forget to pray 2</video:title>
      <video:description>Don&apos;t forget to pray #Video #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516439/3516439_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-05T08:11:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aisar kena penjara, jadi nggak pulang ke Malaysia</video:title>
      <video:description>Penangkapan pan, aisar kaled di Indonesia #fypfypindonesiafypvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516438/3516438_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T08:10:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baru bangun 2</video:title>
      <video:description>Pesona wanita cantik bangun tidur #Pesonacantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516437/3516437_720p.mp4</video:content_loc>
      <video:duration>135</video:duration>
      <video:publication_date>2026-10-05T08:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ella Langley is naturally funny</video:title>
      <video:description>Ella Langley is naturally funny #countrymusic #ellalangleymusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516436/3516436_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T08:09:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TOMB OF FALLEN</video:title>
      <video:description>Chenan mode brutal #chenan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516435/3516435_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T08:09:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YACK🤮YACK🤮YACK🤮</video:title>
      <video:description>#Music #metalcore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516434/3516434_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T08:08:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 73</video:title>
      <video:description>pineapple farms</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516433/3516433_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T08:08:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BMW CINEMATIC!!! |4k 21s</video:title>
      <video:description>Cinematisc cars bmw #Bmw #cars #edit #cinematics #capcut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516432/3516432_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T08:08:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 72</video:title>
      <video:description>orange fruit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516431/3516431_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T08:08:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Job applicants</video:title>
      <video:description>Job applicants with relevant CVs can apply. #parish #france #job #viraljobs #applicants #jobseek #jobassistance #manila #pngjob</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516430/3516430_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T08:07:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tatapan makain dalam</video:title>
      <video:description>Pesona pantai cantik #Pesonacantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516429/3516429_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T08:07:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 71</video:title>
      <video:description>king chilly 😊😊</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516428/3516428_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T08:07:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Save Prabowo</video:title>
      <video:description>#Geopolitic #Prabowo #Mafia #Coruptor #Viral #Video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516427/3516427_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T08:07:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>World Cup Goal</video:title>
      <video:description>#Ronaldo #Messi #WorldCup #Spain #Goal #Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516426/3516426_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T08:04:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Teasing a cat at the airport station.”</video:title>
      <video:description>While waiting and sitting for a bit at the airport, I decided to play with a cat that came up to me. 🐱✈️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516425/3516425_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T08:03:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Simple Bottle Trick Is Pure Physics! 🤯🥤 A Clever DIY Experiment</video:title>
      <video:description>A simple plastic bottle, some string, and a few everyday objects can create a surprisingly clever physics experiment! 🤯 Watch as this homemade setup demonstrates balance, tension, and gravity in a fascinating way. What looks like a simple trick is actually a great example of basic physics hiding in everyday objects. 🔬 Simple materials 🧠 Clever physics 🤯 Unexpected result Would you be able to figure out how this works before watching until the end? #physicsexperiment #simplephysicsexperiment #bottleexperiment #waterbottletrick #physicstrick #scienceexperiment #DIYscience #DIYexperiment #gravityexperiment #tensionexperiment #balanceexperiment #physicsdemonstration #sciencetrick #amazingphysics #simplescience #homemadeexperiment #cleverexperiment #bottletrick #ropeexperiment #stringexperiment #everydayphysics #engineeringexperiment #scienceathome #educationalexperiment #funscience #coolsciencetricks #satisfyingexperiment #interestingphysics #STEMexperiment #scienceshorts #physicsshorts #DIYshorts #amazingexperiment #viralscience</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516424/3516424_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T08:03:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TUMBAL💀</video:title>
      <video:description>#Music #metalcore #indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516423/3516423_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T08:01:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Traditional Saree Dance | Beautiful Expressions &amp; Moves</video:title>
      <video:description>&quot;Watch this beautiful and graceful dance performance in a stunning traditional Indian saree! ✨ The perfect blend of elegant moves and expressions. If you love Indian classical/semi-classical dance and traditional outfits, this video is for you. Don&apos;t forget to Like, Comment, and Follow for more amazing dance videos!&quot; #SareeDance #IndianDance #GracefulDance #TraditionalSaree #DancePerformance #BeautifulExpression #GirlDance #TrendingDance #FebSpotViral #TrendingVideo #ShortDanceVideo #ViralDanceReels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516422/3516422_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T08:01:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tips for High Tomatos Yields</video:title>
      <video:description>Tips for High Tomatos Yields #Farm #agriculture #garden</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516421/3516421_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-05T08:01:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Watch out, don&apos;t fall</video:title>
      <video:description>Hati-hati, jangan sampai jatuh, sayang sekali jika kamu jatuh. Hati-hati jika kamu jatuh, sayang sekali jika kamu jatuh. Hati-hati jika kamu jatuh, sayang sekali jika kamu jatuh.Hati-hati, jangan sampai jatuh, sayang sekali jika kamu jatuh. Hati-hati jika kamu jatuh, sayang sekali jika kamu jatuh. Hati-hati jika kamu jatuh, sayang sekali jika kamu jatuh. #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516420/3516420_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T08:00:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pohon ditengah sawah</video:title>
      <video:description>Pemandangan alam pohon ditengah sawah di desa utama Ciamis Jawa Barat Indonesia #PemandanganalamIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516419/3516419_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T08:00:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Job seekers</video:title>
      <video:description>Applicants with relevant experience can apply #parish #france #job #jobseekers #usa #phillipines #manila</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516418/3516418_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T08:00:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>THE SWORD⚔️</video:title>
      <video:description>#Music #metalcore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516417/3516417_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T08:00:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Little cat 12</video:title>
      <video:description>Little cat #Littlecat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516416/3516416_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:59:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516415</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516415/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asking A Nigerian For A Loan: Why It Never Ends Well. #shorts  #viral</video:title>
      <video:description>Navigating the awkward reality of borrowing money from friends in Nigeria is a universal struggle. That &quot;very soon&quot; repayment promise is basically a myth, especially when your friend starts citing the Super Eagles&apos; next match as their primary source of income. Most people have dealt with these hilarious excuses at least once. 💸 Rate your friend&apos;s most creative excuse for not paying back: 1-10! 👇 #Africancomedyshorts #Nigeriacomedyskit #africancomedy #africanhumor #borrowingmoney #comedy #comedyskit #comedyvideo #funnyskit #loanfraud #loanscam #moneydrama #moneyprank #moneyscam #naijacomedy #nigeriancomedy #relatableskit #scamalert #scammers #Loan #nigerianhumor #personalloan #funnymoney #instantpersonalloan #comedyafrica #naijaskits #loanfor500cibilscore #funnyskits #borrowinggonewrong #3fakeloanapplication #Borrowing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516415/3516415_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:59:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FRAG Pro Shooter - Valentine Gameplay</video:title>
      <video:description>FRAG Pro Shooter - Valentine Gameplay #FragProShooter​ #MobileGame​​​ #Multiplayer​ #fragproshooteredit #fragproshooterofficial #fragproshootergameplay #fragprosootergame #fragprosooter #mobilegameplay #mobilegame #mobilegames #gamesmobile #oldmobilegames #funmobilegames #mobilegaming #bestmobilegames #funnymobilegame #mobilegamesplay #crazymobilegames #funnymobilegames #viralmobilegames #mobile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516414/3516414_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-10-05T07:59:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#bikin laper bule 28</video:title>
      <video:description>masakan khas Indonesia #hiburan #kuliner #wisata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516413/3516413_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:58:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 70</video:title>
      <video:description>beautiful place Dzukou valley</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516412/3516412_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:58:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bikini Girls Let&apos;s Swim As Top Underwater Swimming Moments</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #girlbikini #girlbikinibottom #girlsinbikinis #bikini #fullbikini #snsbikini #bikiniline #surfbikini #bikinitops #tinybikini #bikinikill #roxybikini #70sbikini #minibikini #cubabikini #basebikini #solidbikini #microbikini #bikinibeach #bikinibottom #fullbikinibottom #volcombikini #simplybikini #girl #bikinibottoms #classicbikini #bikinidancemv #womensbikini #swimwearbikini #searcherbikini #girlbottom #billabongbikini #girls #surfbikinibottom #sbikinibottom #roxybikinibottom #nehasharmabikini #cubabikinibottompanties #bestperiodpanties #meeshopantiesforladies #toddlerpantiessoft #transgirl #cottonpantiesfortoddlers #saaltleakproofperiodpanties #meeshopantiesreviewbyjshrdha #meshocottonpantiescomboreview #toddlerwardrobeessentialsgirls #meeehopantiesqualityreviewbyjshrdha #cottonpantiesfrommeeshoreviewbyjshradha #boyshortcottonpantiesmeeshoreviewbyjshrdha #girlssoftunderwear #girlsfashionbasics #5minutecraftsgirly #underwearforlittlegirls #cut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516411/3516411_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-10-05T07:57:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Konichiwa</video:title>
      <video:description>Konichiwa #Konichiwa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516410/3516410_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:57:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUGBANG GURITA SAMPE PANJANG</video:title>
      <video:description>Gurita yang nak di makan daging nya empuk banget loh #Mugbang #makan #korea #kepiting</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516409/3516409_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T07:57:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RollerCoaster at Aquarium</video:title>
      <video:description>#Aquarium #nemo #justforfun #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516408/3516408_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T07:56:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aku si panda</video:title>
      <video:description>Panda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516407/3516407_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:56:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the little girl in me</video:title>
      <video:description>saying the quiet part aloud</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516406/3516406_720p.mp4</video:content_loc>
      <video:duration>141</video:duration>
      <video:publication_date>2026-10-05T07:56:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You Can Actually FLY Without a Plane! 😱 The Power of a Vertical Air Stream</video:title>
      <video:description>Imagine stepping into a powerful stream of air and suddenly being able to float and fly! 🤯💨 This incredible technology uses a powerful vertical airflow to lift a person into the air, creating the sensation of flying without wings or an airplane. It looks like something straight out of a science-fiction movie, but this technology is very real! From the powerful airflow to the amazing flying experience, this is a fascinating look at how engineering can make the impossible feel possible. 🚀 Would you try flying like this? 👀 Tell us in the comments! #indoorskydiving #verticalairstream #flyingwithoutaplane #verticalwindtunnel #indoorflying #bodyflight #humanflight #airtunnel #flyingexperience #skydivingsimulator #windtunnelflying #flywithoutwings #futuristictechnology #amazingtechnology #innovativeengineering #flighttechnology #humanflying #indoorskydivingexperience #gravitydefying #floatinginair #extremetechnology #scienceandtechnology #engineeringmarvel #futureofflight #incredibleinventions #amazinginventions #flyingmachine #aviationtechnology #uniquetechnology #viraltechnology #technologyshorts #scienceshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516405/3516405_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T07:56:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lol wkwk 2</video:title>
      <video:description>Lol #Wkwkwk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516404/3516404_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:56:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516403</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516403/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Selalu bersama 2</video:title>
      <video:description>Suami istri #cinta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516403/3516403_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T07:55:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 69</video:title>
      <video:description>beautiful cats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516402/3516402_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:55:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bigg Boss season 20 episode 29. Day 28.Surprise Ya Shock.Full episode 720p.</video:title>
      <video:description>Bigg Boss season 20 episode 29. Day 28.Surprise Ya Shock.Full episode 720p. Surprise Guest hai. Is channel ko follow kar lo aur videos aane wali hai. #Jiohotstar #Febspot.com Please follow me more than ❤️❤️ #India</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516401/3516401_720p.mp4</video:content_loc>
      <video:duration>4076</video:duration>
      <video:publication_date>2026-10-05T07:52:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pejuang rupiah 7</video:title>
      <video:description>Begini pekerjaan kami seorang pelangsir sawit di lahan banjir #langsirsawit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516400/3516400_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T07:52:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Learn Fruits Vocabulary in English!</video:title>
      <video:description>Learn fruit names in English easily! Comment your favorite fruit below! 🍎🍌✨ #fruitsvocabulary #learnenglishfruits #fruitnamesinenglish #englishforbeginners #englishvocabulary #learnenglish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516399/3516399_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T07:51:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 68</video:title>
      <video:description>any one now this bird name</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516398/3516398_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T07:51:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516397</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516397/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CODM Dusk Shadowstep Goes CRAZY! 80-49 Kill Confirmed Domination on Shoot House | 5125 MVP Gameplay</video:title>
      <video:description>Insane 10v10 Kill Confirmed match on Shoot House! 🔥 Watch Dusk - Shadowstep dominate the lobby with legendary M4 and crazy scorestreaks. From triple kills to Sentry Gun, Predator Missile and Stealth Chopper - this is how you carry your team to 80-49 victory! MVP with 5125 Score - No camp, just pure aggressive rush gameplay. Are you a Dusk main? Let me know your favorite loadout in the comments! #CODMobile #CallofDutyMobile #CODM #CODMobileGameplay #CallofDutyMobileGameplay #CODMGameplay #MobileGaming #FPSMobile #MultiplayerGameplay #CODMobileMultiplayer #4XMultiKill #MultiKill #FuryKill #Bloodthirsty #KillStreak #InsaneKillStreak #CrazyKillStreak #EpicKill #AmazingKill #FastKill #ClutchKill #MobileFPS #AndroidGaming #CompetitiveGaming #ActionGameplay #OnlineMultiplayer #ShooterGame #Gaming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516397/3516397_720p.mp4</video:content_loc>
      <video:duration>299</video:duration>
      <video:publication_date>2026-10-05T07:51:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OK Lets Get Divorce (2026) Episode 12 End Eng Sub</video:title>
      <video:description>OK Lets Get Divorce (2026) - KOREAN DRAMA This series depicts the realistic divorce experience of a wedding dress CEO and a designer couple who decide to divorce to end their exhausting married life. Baek Mi Yeong is the CEO of J&amp;White and finds herself at the center of a turbulent divorce story. Dreaming of becoming a female tailor while watching her father run a suit shop, Mi Yeong became consumed by work after losing her parents in an unexpected accident. She later married Ji Won Ho, a wedding shop designer who had long stood by her side, and together they founded J&amp;White. Although she fought to protect the company through times of crisis, after seven years of marriage, she declared her intention to divorce Won Ho. Ji Won Ho is Mi Yeong&apos;s husband, co-CEO of J&amp;White, and a designer. He fell in love with Mi Yeong at first sight when they met at his first job, drawn to the protective instincts she stirred in him, and proposed after just six months of dating. Having enjoyed a largely stable marriage with Mi Yeong, Won Ho finds himself facing a crisis after an incident that occurred during their fourth year of marriage. OK Lets Get Divorce, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, koreandrama, dramakorean, koreanromance, romancekorean, movie, moviekorean, koreanmovie #OKLetsGetDivorce #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #koreandrama #dramakorean #koreanromance #romancekorean #movie #moviekorean #koreanmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516396/3516396_720p.mp4</video:content_loc>
      <video:duration>3632</video:duration>
      <video:publication_date>2026-10-05T07:51:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Dragon Lord</video:title>
      <video:description>The_Dragon_Lord_s_Healing_Love_#The_Dragon_Lord_s_Healing_Love_#drama_#shortdrama_#miniseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516395/3516395_720p.mp4</video:content_loc>
      <video:duration>1373</video:duration>
      <video:publication_date>2026-10-05T07:51:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inheritance Detective (2025) Episode 1 Eng Sub</video:title>
      <video:description>Inheritance Detective - JAPAN DRAMA Haie Nao is a private detective who specializes in inheritance cases. He runs his own office, Haie Inheritance Investigation Office. He once worked as an elite lawyer, but due to a certain reason, he was kicked out of the lawyers&apos; association. He is also a coffee otaku. When he thinks, he likes to munch on plain coffee beans. He also hates the phrase, &quot;Dead men tell no tales.&quot; Haie Nao takes on challenging inheritance cases and uses his high intelligence and the help of people with colorful personalities. While respecting the will of the deceased, Haie Nao tries to solve the family conflicts and the hidden truths within the inheritance. Inheritance Detective, romancedrama, daramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #InheritanceDetective #romancedrama #daramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516394/3516394_720p.mp4</video:content_loc>
      <video:duration>2684</video:duration>
      <video:publication_date>2026-10-05T07:50:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bikini Girls Underwater Lovers Top Underwater Swimming Moments</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #girlbikini #girlbikinibottom #girlsinbikinis #bikini #fullbikini #snsbikini #bikiniline #surfbikini #bikinitops #tinybikini #bikinikill #roxybikini #70sbikini #minibikini #cubabikini #basebikini #solidbikini #microbikini #bikinibeach #bikinibottom #fullbikinibottom #volcombikini #simplybikini #girl #bikinibottoms #classicbikini #bikinidancemv #womensbikini #swimwearbikini #searcherbikini #girlbottom #billabongbikini #girls #surfbikinibottom #sbikinibottom #roxybikinibottom #nehasharmabikini #cubabikinibottompanties #bestperiodpanties #meeshopantiesforladies #toddlerpantiessoft #transgirl #cottonpantiesfortoddlers #saaltleakproofperiodpanties #meeshopantiesreviewbyjshrdha #meshocottonpantiescomboreview #toddlerwardrobeessentialsgirls #meeehopantiesqualityreviewbyjshrdha #cottonpantiesfrommeeshoreviewbyjshradha #boyshortcottonpantiesmeeshoreviewbyjshrdha #girlssoftunderwear #girlsfashionbasics #5minutecraftsgirly #underwearforlittlegirls #cut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516393/3516393_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-10-05T07:50:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 67</video:title>
      <video:description>a group of birds look beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516392/3516392_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:49:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DANCE WITH ME</video:title>
      <video:description>DANCE #mytrip #dance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516391/3516391_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:49:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the influencer</video:title>
      <video:description>business online models</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516390/3516390_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:48:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alliance Of Dark Prison (2026) Eng Sub</video:title>
      <video:description>Alliance Of Dark Prison (2026) Eng Sub Alliance Of Dark Prison, I Fell For The Girl She Feared, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #AllianceOfDarkPrison #IFellForTheGirlSheFeared #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516389/3516389_720p.mp4</video:content_loc>
      <video:duration>2711</video:duration>
      <video:publication_date>2026-10-05T07:48:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>No ritmo da batilda 😂😂</video:title>
      <video:description>No ritmo da batilda 😂😂 #realfypforyoufunnyvideofanspageLucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516388/3516388_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T07:48:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 66</video:title>
      <video:description>at forests view</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516387/3516387_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:48:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nanbabu Babu Babu</video:title>
      <video:description>My ceiling work 💪</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516386/3516386_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:48:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>线上欧博体育投注官网【235322.com】PG游戏网投官网【sts5626.com】</video:title>
      <video:description>装美女好累 幸亏姊是真的美😎 联系✈️@qingnin999 #线上欧博体育投注官网</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516385/3516385_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:47:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Princess LEONOR #princessleonor #royalfamily #princessleonorofspain #fyp #leonor</video:title>
      <video:description>#Leonor #Spanyol</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516384/3516384_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T07:47:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hoje estamos a qui, no local</video:title>
      <video:description>A visa aí, que nos somos os músicos dele. #Viagem #parís #França #Portugal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516383/3516383_720p.mp4</video:content_loc>
      <video:duration>116</video:duration>
      <video:publication_date>2026-10-05T07:46:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516382</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516382/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aman Auto Electrician</video:title>
      <video:description>Ford edge How to bypass a starter relay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516382/3516382_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T07:46:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bikini Girls Playful Underwater Pool Beauty Girls Underwater Adventures</video:title>
      <video:description>I m glad to welcome you to my profile ⁣💝 My name is Safa Mann 💟 I m a girl who spends online almost everyday searching daily picks and flicks viral videos, funny pictures and odd news blog ⁣💗 I cover all the funny, interesting and strange stuff that is buzzing around the world 💞 The weirder the better each day ⁣💖 I surf the web in an effort to find interesting, entertaining and unique videos, pictures and weird news stories 💋 Enjoying the thirst traps of the internet please like share &amp; subscribe to my channel to not miss newest videos and click the bell icon ⁣🔔 to get new video updates ⁣💓 If you like what you find here, please recommend me to your friends ⁣💘 I m already like you 💕 If you would like to support my channel 💎 I will be very grateful every donation is important to me ❤ You can tip me through ⁣💰👇 PayPal: paypal.me/selvii #girlbikini #girlbikinibottom #girlsinbikinis #bikini #fullbikini #snsbikini #bikiniline #surfbikini #bikinitops #tinybikini #bikinikill #roxybikini #70sbikini #minibikini #cubabikini #basebikini #solidbikini #microbikini #bikinibeach #bikinibottom #fullbikinibottom #volcombikini #simplybikini #girl #bikinibottoms #classicbikini #bikinidancemv #womensbikini #swimwearbikini #searcherbikini #girlbottom #billabongbikini #girls #girl70 #surfbikinibottom #70sbikinibottom #roxybikinibottom #nehasharmabikini #cubabikinibottompanties #bestperiodpanties #meeshopantiesforladies #toddlerpantiessoft #transgirl #cottonpantiesfortoddlers #saaltleakproofperiodpanties #meeshopantiesreviewbyjshrdha #meshocottonpantiescomboreview #toddlerwardrobeessentialsgirls #meeehopantiesqualityreviewbyjshrdha #cottonpantiesfrommeeshoreviewbyjshradha #boyshortcottonpantiesmeeshoreviewbyjshrdha #girlssoftunderwear #girlsfashionbasics #5minutecraftsgirly #underwearforlittle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516381/3516381_720p.mp4</video:content_loc>
      <video:duration>486</video:duration>
      <video:publication_date>2026-10-05T07:46:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Miyu Freestyle Dancer Battle in Poland</video:title>
      <video:description>Miyu is the winner of futureface freestyle Dance Competion in Poland #Dance #Freestyle #Miyu #Matamiyu #Poland</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516379/3516379_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T07:46:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coffe 8</video:title>
      <video:description>Coffe #Coffe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516378/3516378_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T07:45:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>music and nature 🌻🌹</video:title>
      <video:description>I love music 🎶🎶</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516377/3516377_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:45:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516376</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516376/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zoya Zoyamalik</video:title>
      <video:description>PGc Student</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516376/3516376_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T07:45:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Third Person (2026) Episode 4 Eng Sub</video:title>
      <video:description>Third Person (2026) Third Person, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #ThirdPerson #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516375/3516375_720p.mp4</video:content_loc>
      <video:duration>2718</video:duration>
      <video:publication_date>2026-10-05T07:45:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sana Khan Masood</video:title>
      <video:description>رقص 💃💃💃💃</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516374/3516374_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:45:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>万宝路娱乐注册开户网站【235322.com】PG游戏官网【sts5626.com】</video:title>
      <video:description>姊一上线 迷倒一片٩(//̀Д/́/)۶ 联系✈️@qingnin999 #万宝路娱乐注册开户网站</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516373/3516373_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T07:44:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I love music 🎵🎶</video:title>
      <video:description>sweet music 😍🎶🎶</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516372/3516372_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:43:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516371</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516371/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bitcoin 12</video:title>
      <video:description>Bitcoin #Bitcoin</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516371/3516371_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T07:42:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516370</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516370/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EUDORA EXP</video:title>
      <video:description>EUDORA vs SILVANA #Mobilelegen #heroeudora #herosilvana</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516370/3516370_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-10-05T07:42:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bowling and pics</video:title>
      <video:description>friends hangout</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516369/3516369_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:42:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clipper Income Reaches 100M/Month?! Total Payouts Hit Billions! 💰🔥</video:title>
      <video:description>How much can a content clipper actually make? Turns out a single clipper can earn up to 100M IDR per month! No wonder the total monthly payout for clippers can reach billions of rupiah. Watch as we discuss how this clipping business model works! 👇 #Contentclipperincome #Howmuchdoclippersmake #Shortformcontentmonetization #Videoclippersalary #Clippingbusinessmodel #Makingmoneyfromvideoclips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516367/3516367_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T07:41:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just for fun</video:title>
      <video:description>#Fun #Prabowo #viral #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516366/3516366_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T07:41:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Paid to paid</video:title>
      <video:description>Paid #Paid</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516365/3516365_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T07:41:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#princesaleonor ##leonordeborbón #royal #King #infantasofia</video:title>
      <video:description>#Spanyol #princessLEONOR #leonor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516364/3516364_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T07:40:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516363</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516363/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dance 193</video:title>
      <video:description>dance #mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516363/3516363_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:40:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Be motivated 5</video:title>
      <video:description>encourage goals 💪😉</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516362/3516362_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:39:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sabar 3</video:title>
      <video:description>ikhlas dan sabar adlh kunci #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516361/3516361_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-05T07:39:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Putus dari pacar berubah</video:title>
      <video:description>Vilmei di putuskan sama pacarnya dan dia galow berat #fypindinesiafypvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516360/3516360_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T07:38:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tyson VS Tyson Son:Like Father Like Son</video:title>
      <video:description>It is not just the legendary fighting style; that extraordinary talent runs deep in his very blood. Miguel Tyson, son of the heavyweight legend, successfully captured the public&apos;s attention when he uploaded a video of himself training in the ring. #Tyson #kickboxing #migueltyson</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516359/3516359_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T07:38:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516358</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516358/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>万宝路娱乐开户注册网址【235322.com】PG游戏投注官网【sts5626.com】</video:title>
      <video:description>哥最帥别问为什么是繁体字因为哥帥的不简单(´−｀) 联系✈️@22qingnin996 #万宝路娱乐开户注册网址</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516358/3516358_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:37:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 65</video:title>
      <video:description>poppy flower 🌼</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516357/3516357_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T07:37:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beauty and class</video:title>
      <video:description>fashion beauty class</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516356/3516356_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:37:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516355</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516355/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kurang ayang nya aja 🤣</video:title>
      <video:description>Awas mbok jatuh, kan sayang klo jatuh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516355/3516355_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T07:37:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#vidio kata kata</video:title>
      <video:description>jangan boros #perjalanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516354/3516354_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T07:37:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Snpp01</video:title>
      <video:description>A child raised by 3 living corpses</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516353/3516353_720p.mp4</video:content_loc>
      <video:duration>354</video:duration>
      <video:publication_date>2026-10-05T07:37:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NASCAR Rumble (PlayStation 1) - PARTE 11</video:title>
      <video:description>#Cars #Racing #Games #NASCAR</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516352/3516352_720p.mp4</video:content_loc>
      <video:duration>954</video:duration>
      <video:publication_date>2026-10-05T07:37:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>No tengo ese valor</video:title>
      <video:description>No tengo ese valor #fypviralforyoufunnyvideofanspagelucufypppppppppppppp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516351/3516351_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:36:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Siphon Function and Benefits</video:title>
      <video:description>Siphon or Drain Pipe is Very Important in Cultivation #CatfishCultivation #CatfishCultivationTips #catfishbreeders #catfishbusiness #pondsiphon</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516350/3516350_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T07:36:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Being happy is you&apos;re choice</video:title>
      <video:description>To never stress yourself</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516349/3516349_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:36:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sunny photoshoot</video:title>
      <video:description>photoshoot on a sunny day 🌻😎🌻</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516348/3516348_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:35:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ramaikan sayang 2</video:title>
      <video:description>ayuk follow aku saya sayang #viralfypbeautifulgirlsvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516347/3516347_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T07:35:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516346</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516346/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Princess Leonor with the Spanish national team players #princessleonor #worldcup #spain🇪🇸</video:title>
      <video:description>#PrincessLEONOR</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516346/3516346_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T07:35:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Olahraga siang dulu</video:title>
      <video:description>หุ่นทรวดทรงองเอวขาวอวบอึมน่ารักจัง #หุ่นทรวดทรงองเอวขาวอวบอึมน่ารักจัง</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516344/3516344_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:34:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Musik 94</video:title>
      <video:description>#Fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516343/3516343_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:34:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516342</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516342/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Allied School Rawal Campus</video:title>
      <video:description>Allied School Rawal Campus · Original audio Good manners are the foundation of a successful school life at Allied School, Rawal Campus.✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516342/3516342_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T07:34:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My love 55</video:title>
      <video:description>My love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516341/3516341_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:34:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>亚多利娱乐开户官网【235322.com】PG游戏网投官网【sts5626.com】</video:title>
      <video:description>姊给你面子 你揪姊小辫子(๑`^´๑) 联系✈️@qingnin999 #亚多利娱乐官网、</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516340/3516340_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T07:34:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gd Haider</video:title>
      <video:description>وومن بائیک ریلی --- سی ٹی او نے ریلی شروع ہونے سے پہلے کہا تھا خواتین اچھی ڈرائیورز ہیں انکے حادثات نہیں ہوتے</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516338/3516338_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T07:33:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wood Turning a Raw Log into a Bowl | Satisfying Lathe ASMR</video:title>
      <video:description>What happens when a sharp gouge chisel meets a rapidly spinning raw log on a high-speed wood lathe? Watch the deeply satisfying process of wood turning as the tool effortlessly hollows out the wood grain, sending thick, curly shavings flying in a crisp and highly tactile ASMR experience. #woodturningasmr #lathewoodworking #bowlcarving #rawlogturning #flyingwoodshavings #tactileasmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516337/3516337_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:33:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 64</video:title>
      <video:description>unidentified spiseis found</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516336/3516336_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:33:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My next upcoming song preview</video:title>
      <video:description>It is the preview of my next song which I am about to composing. #Song #music #gaana #Geet #bhojpurisong #bhaktisong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516335/3516335_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T07:32:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>music from mother land</video:title>
      <video:description>African music 🎵🎶🎶</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516334/3516334_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:32:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 63</video:title>
      <video:description>darjeeling good place to visit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516333/3516333_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T07:32:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tai Chi for Beginners</video:title>
      <video:description>your morning with these simple Chinese exercises 👉</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516332/3516332_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:32:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosplay 22</video:title>
      <video:description>Douying #Japanese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516331/3516331_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T07:31:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516330</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516330/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#aesthetic (1080p60).mp4</video:title>
      <video:description>DOG IS CRAZY🥶</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516330/3516330_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:31:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akaboi 62</video:title>
      <video:description>name of this fruit in your language 😁😁</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516329/3516329_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:31:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kenyan 2</video:title>
      <video:description>Birthday #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516328/3516328_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-10-05T07:31:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kamu terlihat semakin cantik dan manis hari ini. Aku ingin tahu, apakah kamu masih sendiri?</video:title>
      <video:description>Kamu terlihat semakin cantik dan manis hari ini. Aku ingin tahu, apakah kamu masih sendiri? #Fyfvidiohot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516327/3516327_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:31:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Azan khan</video:title>
      <video:description>Walking #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516326/3516326_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:31:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂😂 4</video:title>
      <video:description>rooster crowing in the morning 😂😂 #fypviralforyoufunnyvideochiken</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516325/3516325_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:30:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nature and models</video:title>
      <video:description>nature models fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516324/3516324_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:30:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan jalan 30</video:title>
      <video:description>Jalan jalan #Jalanjalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516323/3516323_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T07:30:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amalan setiap hari setelah solat subuh</video:title>
      <video:description>Diamalkan setiap hari agar senantiasa berkah #Zikirpagi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516322/3516322_720p.mp4</video:content_loc>
      <video:duration>118</video:duration>
      <video:publication_date>2026-10-05T07:30:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing cake 3</video:title>
      <video:description>The baker of this cake so amazing he/she make very wonderful #cakegathering</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516321/3516321_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T07:29:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosplay 21</video:title>
      <video:description>Douying #Japanese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516320/3516320_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:29:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516319</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516319/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good times💖</video:title>
      <video:description>Camera time</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516319/3516319_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T07:29:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Login 2</video:title>
      <video:description>Login #Login</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516318/3516318_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T07:29:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Will Myra soon find out what the real truth is? Today Full Episode YRKKH</video:title>
      <video:description>Will Myra soon find out what the real truth is? Today Full Episode YRKKH #yrkkh #todayepisode #episodeupdate #trending #viral #gossips #entertainment #yehrishtakyakehlatahain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516317/3516317_720p.mp4</video:content_loc>
      <video:duration>151</video:duration>
      <video:publication_date>2026-10-05T07:29:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MZ Realtor&apos;s Dha</video:title>
      <video:description>🏡 5 Marla Fully Furnished House for Sale – DHA 9 Town</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516316/3516316_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:29:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>playing tops</video:title>
      <video:description>I spend my spare time at work playing games with my boss and colleagues. Is there anyone else who still enjoys this game? #Tops #playingtops</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516315/3516315_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T07:28:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosplay 20</video:title>
      <video:description>Douying #Japanese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516314/3516314_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:28:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Vidio funny #Meme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516313/3516313_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T07:28:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>photoshoot under the moonlight</video:title>
      <video:description>fashion understand the 🌝🌙</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516312/3516312_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:28:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mungpung lagi sepi</video:title>
      <video:description>#Fyf</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516311/3516311_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:28:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516310</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516310/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice vedio 70</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516310/3516310_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T07:28:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Umar farooq</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516309/3516309_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T07:27:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Funny video #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516308/3516308_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-05T07:27:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moment 16</video:title>
      <video:description>A talking moment #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516307/3516307_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T07:27:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosplay 19</video:title>
      <video:description>Douying #Japanese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516306/3516306_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:27:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 376</video:title>
      <video:description>Funny video #Cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516305/3516305_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T07:26:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nazzam</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516304/3516304_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:26:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosplay 18</video:title>
      <video:description>Douying #Japaness</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516303/3516303_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:26:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>spalonbyminal</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516302/3516302_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T07:26:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ramaikan sayang</video:title>
      <video:description>jangan lupa di follow ya #beautifulvideosgirlfypviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516301/3516301_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:26:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion and nature&apos;s sun</video:title>
      <video:description>fashion and nature.fashion under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516300/3516300_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:25:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Padang</video:title>
      <video:description>Bersama ayang #Jalanjalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516299/3516299_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T07:25:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 19</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516298/3516298_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T07:25:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dr syad reman shah</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516297/3516297_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T07:24:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Di peluk 5 detik</video:title>
      <video:description>Gunting batu kertas #Vidiolucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516296/3516296_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T07:24:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Some Memories Wait Quietly for the Right Moment to Return. Emotional Short Film</video:title>
      <video:description>Sometimes, we think we&apos;ve forgotten a place, a person, or a moment… until something brings it all back. 🌙🍂 She returns to her old childhood home and discovers that some memories never truly disappear. They simply wait quietly inside us for the right moment to return. ❤️ A cinematic story about home, memories, time, and the feelings we never completely let go of. #emotionalstory #nostalgicstory #oldmemories #forgottenmemories #childhoodmemories #memoriesofhome #oldhouse #emotionalshortfilm #cinematicshort #hearttouchingstory #touchingstory #nostalgicvideo #emotionalvideo #sentimentalstory #villagelife #rurallife #homecomingstory #meaningfulstory #lifememories #beautifulmemories #emotionalanimation #animatedshortfilm #AIstory #AIvideo #AIanimation #cinematicanimation #storytelling #heartwarmingstory #peacefulmoments #DreamleafShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516295/3516295_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:24:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muzamilmalik</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516294/3516294_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:23:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lol hehe</video:title>
      <video:description>Lol #Lol</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516293/3516293_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T07:23:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atasa 😂😂</video:title>
      <video:description>Oh my God #unitedstatesjermanfypviralfunnyvideolucuforyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516292/3516292_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T07:23:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mari mas</video:title>
      <video:description>Mengisi waktu luang #Wanitacantiksexy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516291/3516291_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:22:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kidsphotographybyali</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516290/3516290_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-05T07:22:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The little black dress</video:title>
      <video:description>black dress fashion under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516289/3516289_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:21:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Family gathering puncak Bogor</video:title>
      <video:description>Acara family gathering yang diadakan di puncak Bogor Indonesia #PuncakBogor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516288/3516288_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:21:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beat by Tosh pac</video:title>
      <video:description>Hip hop beat by Tosh pac</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516287/3516287_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T07:21:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny vedio 47</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516286/3516286_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:21:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jiya rajpoot</video:title>
      <video:description>fbreel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516285/3516285_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:20:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What have you eaten today?</video:title>
      <video:description>What have you eaten today? Let&apos;s learn common English words about food! Watch until the end and share your thoughts in the comments! 🍕💬 #whathaveyoueatentoday #whatdoyoueat #learnenglish #englishvocabulary #englishforbeginners #dailyenglishconversation #foodvocabulary #englishgrammar #speakingenglish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516284/3516284_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T07:20:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sobia Malik</video:title>
      <video:description>Wafa World 😘🥀</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516283/3516283_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:19:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion beautiful Africa</video:title>
      <video:description>west African fashion under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516282/3516282_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>prince interview</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516281/3516281_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Puncak Bogor 2</video:title>
      <video:description>Acara family gathering di puncak Bogor Indonesia #PuncakBogorIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516280/3516280_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:18:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sidhukaur</video:title>
      <video:description>Kamal Grewal · Ankhaan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516279/3516279_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T07:17:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hello Amsterdam ❤️I&apos;m Coming❤️❤️❤️</video:title>
      <video:description>Hello Amsterdam ❤️I&apos;m Coming❤️❤️❤️ #Hello #Amsterdam #i #coming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516278/3516278_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T07:17:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516277</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516277/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam kampung 5</video:title>
      <video:description>Datang lagi satu ekor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516277/3516277_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T07:17:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oh my Goodness 😂😂</video:title>
      <video:description>Oh my Goodness 😂😂 #parisjermantravelfypforyoufunnyvideolucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516276/3516276_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T07:16:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OKE BRO....</video:title>
      <video:description>Ahahaha</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516275/3516275_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T07:16:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion under the sun 🌞</video:title>
      <video:description>fashion under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516274/3516274_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:15:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brother monkey can also do the laundry</video:title>
      <video:description>#Monkey #funnyvideos #funnymonkey</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516273/3516273_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T07:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good afternoon....</video:title>
      <video:description>Keep smiling, stay positive, and make the most of this beautiful day. 🌿😊 #Afternoon #NiceDay #JustGoOn</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516272/3516272_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:15:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata-kata motivasi 7</video:title>
      <video:description>Masalalu tidakbisa diubah atau dihapus ,ia hanya bisa diterima untuk menjadi pijakan hidup yang lebih baik. #Katakatamotivasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516271/3516271_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:15:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bride 42</video:title>
      <video:description>The Bride</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516270/3516270_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T07:14:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muhammad ali 2</video:title>
      <video:description>Best boxer in the world #sport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516269/3516269_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T07:13:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Do We Relationship (2026) Episode 4 Eng Sub</video:title>
      <video:description>How Do We Relationship (2026) Shy Miwa has always dreamed of finding love, but living in small-town Japan made finding the right match difficult - especially since she likes girls! Even going away to college didn’t seem to increase her romantic odds until one day her outgoing classmate Saeko suggests they might as well start dating each other since it’s not like either of them have other options. At first it seems like things won’t work out as their personalities clash and misunderstandings abound. But when their casual friendship starts to become something more Miwa begins to wonder—can a pragmatic proposal lead to true love? How Do We Relationship, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #HowDoWeRelationship #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516268/3516268_720p.mp4</video:content_loc>
      <video:duration>1440</video:duration>
      <video:publication_date>2026-10-05T07:13:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yanti with her friends at a clean and clear river.</video:title>
      <video:description>YANTI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516267/3516267_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T07:12:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I see</video:title>
      <video:description>I see #See</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516266/3516266_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:12:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam kampung 4</video:title>
      <video:description>Kebiasaan kasih makan 🐔🐔</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516265/3516265_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T07:11:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sweet African music 🎵🎶</video:title>
      <video:description>under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516264/3516264_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:11:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>White Funny bunny try to mimic a cat!</video:title>
      <video:description>funny bunny 🤣 #fypviralvideosbunnycataroundtheworldusaaustralia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516263/3516263_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:11:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shahid 3</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516262/3516262_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:11:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OK Lets Get Divorce (2026) Episode 11 Eng Sub</video:title>
      <video:description>OK Lets Get Divorce (2026) - KOREAN DRAMA This series depicts the realistic divorce experience of a wedding dress CEO and a designer couple who decide to divorce to end their exhausting married life. Baek Mi Yeong is the CEO of J&amp;White and finds herself at the center of a turbulent divorce story. Dreaming of becoming a female tailor while watching her father run a suit shop, Mi Yeong became consumed by work after losing her parents in an unexpected accident. She later married Ji Won Ho, a wedding shop designer who had long stood by her side, and together they founded J&amp;White. Although she fought to protect the company through times of crisis, after seven years of marriage, she declared her intention to divorce Won Ho. Ji Won Ho is Mi Yeong&apos;s husband, co-CEO of J&amp;White, and a designer. He fell in love with Mi Yeong at first sight when they met at his first job, drawn to the protective instincts she stirred in him, and proposed after just six months of dating. Having enjoyed a largely stable marriage with Mi Yeong, Won Ho finds himself facing a crisis after an incident that occurred during their fourth year of marriage. OK Lets Get Divorce, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, koreandrama, dramakorean, koreanromance, romancekorean, movie, moviekorean, koreanmovie #OKLetsGetDivorce #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #koreandrama #dramakorean #koreanromance #romancekorean #movie #moviekorean #koreanmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516261/3516261_720p.mp4</video:content_loc>
      <video:duration>3617</video:duration>
      <video:publication_date>2026-10-05T07:11:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dyrroth gameplay</video:title>
      <video:description>#mlbb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516260/3516260_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T07:11:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stay out of trouble 🤣</video:title>
      <video:description>Stay out of trouble 🤣 #foryoufypviralfunnyvideoLucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516259/3516259_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:10:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>90 REFRESHING DRINKS</video:title>
      <video:description>grab one.....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516258/3516258_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:10:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kelapa 2</video:title>
      <video:description>manfaat dari buah kelapa #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516257/3516257_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T07:10:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skanshine</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516256/3516256_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T07:09:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daun Kelorr</video:title>
      <video:description>manfaat daun kelor #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516255/3516255_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T07:09:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Friendly visit</video:title>
      <video:description>Just for fun #Namibia🇳🇦</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516254/3516254_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T07:08:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Style ride</video:title>
      <video:description>Style ride #Style</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516253/3516253_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:08:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ely tries to stay in the spotlight, despite all her shortcomings.</video:title>
      <video:description>Ely</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516252/3516252_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T07:08:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Herbal yg bagus untuk pernafasan</video:title>
      <video:description>Konsumsi herbal ini saat terkena gangguan pernafasan seperti asma #Herbal #obat #pernafasan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516251/3516251_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T07:08:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E08 Hindi Dubbed Korean Drama English Subtitles</video:title>
      <video:description>King The Land #Koreandrama #Hindidubbed #KoreandramaHindidubbed #Koreantvseries #KingTheland</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516250/3516250_720p.mp4</video:content_loc>
      <video:duration>4587</video:duration>
      <video:publication_date>2026-10-05T07:07:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asassin creed funny moment!</video:title>
      <video:description>#fypgameasassasinfunfunnyviralviralvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516249/3516249_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:06:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Música nova 2</video:title>
      <video:description>Música nova</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516248/3516248_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T07:06:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monkey Gives Lion a New Look! 🐒🦁🎨</video:title>
      <video:description>This video is an AI cinematic simulation created purely for entertainment. A mischievous little monkey sneaks up on a sleeping lion and uses a small brush to paint its body and legs black. The lion suddenly wakes up in shock, completely confused by its unexpected new look! All characters, scenes, and events are digitally generated. No real animals were involved or harmed. #FunnyMonkey #FunnyLion #MonkeyPrank #LionPrank #LionPaint #AnimalComedy #FunnyAnimals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516247/3516247_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:04:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E07 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The Land. #KingTheland #koreandrama #Hindidubbed #Koreantvseries #koreandramaHindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516246/3516246_720p.mp4</video:content_loc>
      <video:duration>4452</video:duration>
      <video:publication_date>2026-10-05T07:04:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>میری ا ستانی</video:title>
      <video:description>Teachers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516245/3516245_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:04:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Serendipity (2026) Episode 21 Eng Sub</video:title>
      <video:description>Serendipity (2026) - CHINESE DRAMA Su Wan, an animal psychology major, has loved animals since childhood and can&apos;t bear to see them harmed. One day, she learns that a group of dogs has been kidnapped and trafficked. Disregarding her own safety, she follows the clues alone to the kidnappers&apos; hideout, determined to rescue the dogs. Finding herself in mortal danger after being discovered, she is suddenly saved by a stranger. Unbeknownst to Su Wan, this mysterious boy is none other than Bai Tian Yu, her childhood sweetheart from sixteen years ago. The two were inseparable as children, but various unforeseen events led to their separation. This thrilling encounter brings them back together, leading to a healing and sweet love story. Serendipity, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #Serendipity #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516244/3516244_720p.mp4</video:content_loc>
      <video:duration>2801</video:duration>
      <video:publication_date>2026-10-05T07:03:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>under the sun</video:title>
      <video:description>under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516243/3516243_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:03:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tilawat e Quran Majeed 153</video:title>
      <video:description>Buy any kind website binary option trade, p2p crypto exchange web, chat web , social network web , school web , freelancer web for your business or entertainment https://www.fiverr.com/s/jjm8wxw https://www.fiverr.com/s/WEWrwYl https://www.fiverr.com/s/yvD6XoG #Tilawat #Tilawatquran</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516242/3516242_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T07:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dr Asad Abbas</video:title>
      <video:description>Dr Asad Abbas · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516241/3516241_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T07:03:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516240</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516240/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>panen buah jambu</video:title>
      <video:description>panen buah jambu Darsono #fypforyoupanenbuahjambuvidiopendek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516240/3516240_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T07:02:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MY DANCE</video:title>
      <video:description>MY TRIP #TrenTari #tantanganTariViral #TrenTariSaatIni #KompliasiTariTikTok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516238/3516238_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:01:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516237</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516237/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saif Leghari</video:title>
      <video:description>عوامی ریل سروس کوئٹہ ٹو کچلاک</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516237/3516237_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:01:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Invoker fontaine sunstrike</video:title>
      <video:description>Fontaine sunstrike while unexpected 😯 #dota #gameplay #invoker</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516236/3516236_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-05T07:00:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E06 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The Land. #Koreandrama #Hindidubbed #Koreantvseries #hindidubbedKoreantvseries #KingTheland #koreandramaHindidubbed #englishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516235/3516235_720p.mp4</video:content_loc>
      <video:duration>4624</video:duration>
      <video:publication_date>2026-10-05T07:00:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pallavi Damakta</video:title>
      <video:description>mountainview</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516234/3516234_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T07:00:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TechElectronic Bhai</video:title>
      <video:description>Solar System Installation ☀️ | How to Connect Solar, Inverter &amp; Battery?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516233/3516233_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T07:00:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menghidupkan mesin diesel</video:title>
      <video:description>Kena prank anjing 🤣 #fypforyouvidiolucuanjingorangmenghidupkanmesindiesel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516232/3516232_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:59:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Africa</video:title>
      <video:description>Beautiful Africa beautiful land</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516231/3516231_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freelancing with Danial</video:title>
      <video:description>Freelancing with Danial · Following ﻿Freelancing with Danial · Original audio Get Chatgpt Premium version free ‼️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516230/3516230_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T06:58:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat curiga datang</video:title>
      <video:description>Saat curiga datang menyapa #mitivasi #kesadaran #Motivasi #kesadaran #curiga #hubungan #quoteKesehatanmental #cintasejati</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516229/3516229_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T06:58:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mahek Malik</video:title>
      <video:description>Subha Subha Es Dua 🤲 ko 7 Baar Padhlo…💯✨ Mahek Malik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516228/3516228_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T06:57:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pls Love (2026) Episode 4 Eng Sub</video:title>
      <video:description>Pls Love (2026) Cold and seemingly-perfect business heiress Phakinee reunites with Parnupsorn, a woman she once shared a fleeting seaside romance with—now working as a hostess at a luxury club in Bangkok. Determined to keep her close, Phakinee hires her as a personal assistant, forcing them to confront unresolved feelings, pride, and painful misunderstandings. As secrets and class differences threaten to pull them apart, both women must decide if they are brave enough to trust and love each other without judgement. Pls Love, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #PlsLove #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516227/3516227_720p.mp4</video:content_loc>
      <video:duration>2803</video:duration>
      <video:publication_date>2026-10-05T06:57:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qoutes of day</video:title>
      <video:description>Qoutes of day #Qoutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516226/3516226_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:57:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E05 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The Land. #KingTheland #koreanseries #hindidubbed #Koreandrama #HindidubbedKoreandrama #HindidubbedKoreantvseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516225/3516225_720p.mp4</video:content_loc>
      <video:duration>4359</video:duration>
      <video:publication_date>2026-10-05T06:57:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>89 DROPLETS</video:title>
      <video:description>WARNING THERE&apos;S SOMETHING IN THE WATER</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516224/3516224_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:57:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sonii K Narwal</video:title>
      <video:description>Sonii K Narwal · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516223/3516223_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T06:56:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion and models</video:title>
      <video:description>fashion and models 🌻🌻🌹🌹</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516222/3516222_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:56:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516221</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516221/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Italian Deco</video:title>
      <video:description>In Venice, even eternity moves. In the ripple of the canals, the passing boats, the light dancing across centuries-old walls. Beauty that belongs to e</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516221/3516221_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:55:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tropa de Elite 🚔 Baile Funk Interrompido</video:title>
      <video:description>Cena marcante de Tropa de Elite — o clima de um baile funk na favela muda completamente quando a polícia chega. Tensão, ação e um retrato cru do confronto nas ruas do Rio. 🎬🔥 #TropadeElite #cenabailefunk #filmepolicialbrasileiro #BOPE #CapitãoNascimento #favelaRiodeJaneiro #cinemanacional #açãobrasileira #filmedepolícia #cenadeconfronto #cinemabrasileiro #thrillerpolicial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516220/3516220_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-10-05T06:55:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E04 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The Land. #Koreandrama #Hindidubbed #Koreantvseries #KingTheland #koreantvserieshindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516219/3516219_720p.mp4</video:content_loc>
      <video:duration>4182</video:duration>
      <video:publication_date>2026-10-05T06:54:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crispy Fried Chicken ASMR Mukbang Eating Sounds</video:title>
      <video:description>Enjoy an incredibly satisfying ASMR mukbang featuring golden crispy fried chicken and crunchy chicken nuggets. Listen to the crunchy eating sounds and watch every bite of this delicious fast-food feast. #friedchickenmukbang #asmreatingsounds #crispyfriedchicken #chickenmukbang #crunchyeatingsounds #mukbangshow #friedchickenasmr #chickennuggets #fastfoodmukbang #eatingvideo #crunchychicken #foodasmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516218/3516218_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T06:53:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>After The Cheer Queen Ruined Me, I Fell For The Girl She Feared (2026) Eng Sub</video:title>
      <video:description>After The Cheer Queen Ruined Me, I Fell For The Girl She Feared (2026) Eng Sub After The Cheer Queen Ruined Me, I Fell For The Girl She Feared, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #AfterTheCheerQueenRuinedMe #IFellForTheGirlSheFeared #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516217/3516217_720p.mp4</video:content_loc>
      <video:duration>2587</video:duration>
      <video:publication_date>2026-10-05T06:53:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516216</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516216/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Business Purposel for PHOENIXWEAR 3</video:title>
      <video:description>You: Hi, this is [Your Name] from PhoenixWearSports. How are you doing? I’m reaching out because we are a sportswear manufacturer and supplier based in Pakistan. We specialize in custom sportswear, uniforms, T-shirts, polos, hoodies, and jackets. I just wanted to ask—do you currently source custom sportswear or uniforms for your business or team? If YES: That’s great. What type of products do you usually order, and approximately what quantity do you need? We can manufacture according to your design, logo, fabric, and specifications. I can also send you our latest designs and product details on WhatsApp or email. What would be the best way to send you our catalog? If they say “send me information”: Absolutely. I’ll send you our catalog and company details. You can take a look whenever you have time, and if you have any requirements, just let me know. Thank you for your time. Have a great day! #World-wideUsaUkfrance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516216/3516216_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:52:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Campaign 2</video:title>
      <video:description>Campaign platform #Campaign</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516215/3516215_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T06:52:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Modeling ❤️🌹🌻🥂</video:title>
      <video:description>fashion today</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516214/3516214_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:52:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute AI Cats and Tiger Cooking and Eating Braised Fish Together</video:title>
      <video:description>Watch this adorable animated AI story of fluffy cats fishing in a clear stream and preparing a delicious braised fish meal. Joined by a hard-working tiger friend who arrives after a long day selling fruits, they all cook and enjoy a warm feast together in a cozy wooden house. #aicatcooking #cutecatfishing #aitiger #cuteanimalanimation #3dcatanimation #cookingfish #cozyvillagelife #aigeneratedvideo #cuteanimalseating #animatedcatstory #cuteaianimals #fantasycooking</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516213/3516213_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-10-05T06:52:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E03 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The land. #Koreandrama #Hindidubbed #Koreantvseries #KingTheland #hindidubbedKoreandrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516212/3516212_720p.mp4</video:content_loc>
      <video:duration>4130</video:duration>
      <video:publication_date>2026-10-05T06:51:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hell For You (2025) Episode 11 End Eng Sub</video:title>
      <video:description>Hell For You (2025) - JAPAN DRAMA Seeking revenge after being framed for murder 14 years ago, Sachiko Tachibana changes her appearance and infiltrates a popular influencer&apos;s home as a babysitter. Hell For You, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #HellForYou #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516211/3516211_720p.mp4</video:content_loc>
      <video:duration>1190</video:duration>
      <video:publication_date>2026-10-05T06:51:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aktif</video:title>
      <video:description>Aktivitas #Aktif</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516210/3516210_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:50:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amelia tries to tease the cat that is usually fierce. #2</video:title>
      <video:description>Amelia 2</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516209/3516209_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:50:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vaga para analista de crédito banco digital</video:title>
      <video:description>Vaga para analista de validação de crédito no banco efi #homeoffice #efi #bancodigital #vaga #vagadeemprego #Brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516208/3516208_720p.mp4</video:content_loc>
      <video:duration>112</video:duration>
      <video:publication_date>2026-10-05T06:49:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Little Girl Eating Asian Feast Mukbang ASMR with Seafood</video:title>
      <video:description>An adorable mukbang compilation featuring a cute little girl enjoying a wide variety of delicious Asian dishes. Watch her happily eat seafood platters with crayfish and oysters, sweet and sour pork, grilled ribs, fresh kimchi, spicy cold noodles, and large pork bones with great appetite. #cutekidmukbang #littlegirleating #asianfoodmukbang #seafoodmukbang #ribsmukbang #kimchieating #asmreating #cutemukbang #coldnoodles #spicyfood #porkribs #mukbangshow #eatingfeast #mukbangcompilation #deliciousfood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516207/3516207_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-10-05T06:47:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wajah para pendosa di padang mahsyar</video:title>
      <video:description>Inilah nasehat singkat tentang wajah para pendosa di padang mahsyar #Nasehat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516206/3516206_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T06:47:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dota 2 Invoker madness</video:title>
      <video:description>Invoker Wet dream #dota #invoker #gameplay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516205/3516205_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:46:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>First Dragon Season 1 Episode 3 In Hindi</video:title>
      <video:description>Enjoy #FirstDragon #Anime #HindiAnime #AnotherWorld #TeleportAnime #MagicAnime #SoldierAnime #TeleportSoldierAnime #SpiritsAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516204/3516204_720p.mp4</video:content_loc>
      <video:duration>992</video:duration>
      <video:publication_date>2026-10-05T06:45:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qoutes of girl</video:title>
      <video:description>Qoutes of girl #Qoutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516203/3516203_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T06:45:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>বিজনেস</video:title>
      <video:description>বিজনেস</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516202/3516202_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T06:43:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ultimate Korean Spicy Food Mukbang ASMR with Tteokbokki</video:title>
      <video:description>An energetic Korean mukbang video featuring a variety of popular Korean street foods and convenience dishes. The creator enjoys cheesy pepperoni skewers topped with mustard and mayo, spicy tteokbokki with mandu (dumplings), fiery ramen noodles topped with corn cheese, spicy rice bowls, and chicken feet. Packed with crisp ASMR eating sounds and appetizing close-ups for spicy food lovers. #koreanmukbang #spicymukbang #tteokbokkimukbang #spicynoodles #ramenmukbang #asmreating #koreanstreetfood #pepperoniskewers #cheesecornramen #spicyricebowl #mandudumpling #chickenfeetmukbang #spicyfoodchallenge #satisfyingeatingsounds #koreanfoodshow</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516201/3516201_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T06:42:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amelia tries to tease the cat that is usually fierce.</video:title>
      <video:description>AMELIA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516200/3516200_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:42:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SHAMELESS</video:title>
      <video:description>Prince Harry and Meghan Markle&apos;s #PrinceHarry #MeghanMarkles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516199/3516199_720p.mp4</video:content_loc>
      <video:duration>155</video:duration>
      <video:publication_date>2026-10-05T06:42:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semakin dipaksa lupa, kok malah makin teringat? 🧠</video:title>
      <video:description>Pernah mengalami ini? Saat mencoba melupakan seseorang atau sebuah kejadian, justru pikiran itu muncul semakin sering. Ternyata ada alasan psikologis di baliknya. Tonton sampai akhir dan lihat apakah kamu pernah mengalaminya. 👀 Menurutmu, lebih sulit melupakan seseorang atau kenangan tentangnya? #psikologi #faktapsikologi #overthinking #susahmelupakanseseorang #psikologicinta #carakerjaotak #kenapasemakinberusahamelupakansemakiningat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516198/3516198_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T06:40:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sunset 109</video:title>
      <video:description>Sunset in airport #Sunset #view #nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516197/3516197_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T06:40:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wistoria</video:title>
      <video:description>The strongest silver sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516196/3516196_720p.mp4</video:content_loc>
      <video:duration>206</video:duration>
      <video:publication_date>2026-10-05T06:40:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pekerja keraasss nyari cuan</video:title>
      <video:description>#Khanadajapanindiacina</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516195/3516195_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-05T06:40:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spicy Crunchy Fried Chicken Mukbang ASMR with Hot Sauce</video:title>
      <video:description>An appetizing mukbang video featuring crispy fried chicken drenched in vibrant hot chili sauce. Enjoy the satisfying crunch and rich spicy flavors in an authentic visual and auditory ASMR eating experience. #mukbang #friedchicken #crispychicken #spicychicken #hotsauce #chilisauce #eatingshow #asmreating #crunchsound #foodchallenge #spicymukbang #delicious #comfortfood #fastfood #spicyfoodchallenge</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516194/3516194_720p.mp4</video:content_loc>
      <video:duration>410</video:duration>
      <video:publication_date>2026-10-05T06:39:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DrSyeda Masooma Shah Qazmi</video:title>
      <video:description>DrSyeda Masooma Shah Qazmi · Original audio 🤭😁</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516193/3516193_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T06:38:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TALK ABOUT AN AKWARD PLOT TWIST</video:title>
      <video:description>Prince Harry and Meghan Markle&apos;s #PrinceHarry #MeghanMarkles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516192/3516192_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-10-05T06:37:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam kampung 3</video:title>
      <video:description>Panggil ayam mau kasih makan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516191/3516191_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T06:37:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny fails 26</video:title>
      <video:description>#funnypublicreaction</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516190/3516190_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T06:36:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mydragonncyuteeee</video:title>
      <video:description>dragonalizard #dragon #dragonar #fyp #dragonalizard</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516189/3516189_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:34:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geólogo aposentado transforma propriedade em oásis sustentável</video:title>
      <video:description>Geólogo aposentado transforma propriedade em oásis sustentável</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516188/3516188_720p.mp4</video:content_loc>
      <video:duration>427</video:duration>
      <video:publication_date>2026-10-05T06:34:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi 15 4th October 2026 Full Episode 20.</video:title>
      <video:description>Khatron Ke Khiladi 15 4th October 2026 Full Episode 20.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516187/3516187_720p.mp4</video:content_loc>
      <video:duration>5332</video:duration>
      <video:publication_date>2026-10-05T06:33:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rayan Update 2 2</video:title>
      <video:description>Check Anyone’s Property Details Online Using Name | Punjab Zameen Complete Method</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516185/3516185_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-10-05T06:31:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516184</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516184/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ambil bareng²</video:title>
      <video:description>Dijalan warga lagi panen udang #udang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516184/3516184_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T06:31:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>圣淘沙公司注册流程【电报TG： t.me/xq5990】</video:title>
      <video:description>1.有没有实体现场，了解现场的具体位置，现场玩家多不多。 2.具有雄厚的资金链，出款速度是否快速。 3.是不是先发排后下注，是不是用铅笔点排，透明排靴。 4.是否能在网上通过视频验证与实体现场同步来证实。 5.全程人工操作、必须是透明模式。 6.可切换视频的任何角度以便查看是否有真实的现场大厅。 7.如果没有达到以上条件的，那就毋庸置疑肯定是假的平台， 千万不能玩。正规的平台都具备以上条件。</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516183/3516183_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:31:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quote of year</video:title>
      <video:description>Qoutes of year #Qoutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516182/3516182_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:30:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PART 1 stranded on an island🏝️</video:title>
      <video:description>Stranded alone on a mysterious island with no way home. With limited supplies and the dangers of the wild surrounding him, survival becomes his only choice. How long can he survive? And will he ever find a way off the island? Watch until the end to discover what happens. #strandedonanisland #desertedisland #islandsurvival #survivalstory #survivaladventure #strandedalone #survivalchallenge #wildernesssurvival #lostonanisland #mysteriousisland #extremesurvival #adventurestory #survivalskills #strandedsurvival #aloneinthewilderness</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516180/3516180_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:29:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 18</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516179/3516179_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T06:29:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>⚡ menggelegar</video:title>
      <video:description>⚡ menggelegar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516178/3516178_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T06:28:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bahria Homes</video:title>
      <video:description>7 Marla Corner House Double Unit House For Sale…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516175/3516175_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T06:27:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bilal writes</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516174/3516174_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:27:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pectaa Muzaffargarh</video:title>
      <video:description>Dr. Mahjabeen Principal of PECTAA Muzaffargarh visited the class, engaged the students in a question-and-answer session, assessed their academic progr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516173/3516173_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T06:27:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516172</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516172/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comment &quot;go&quot; for full guide 3</video:title>
      <video:description>Comment &quot;go&quot; for full guide #Commentgoforfullguide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516172/3516172_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T06:26:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>leaf out of princess kate&apos;s book</video:title>
      <video:description>leaf out of princess kate&apos;s book #princess #meghanmarkle #english</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516170/3516170_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T06:26:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan alam di kabupaten Magelang</video:title>
      <video:description>&quot;Keindahan alam yang menenangkan jiwa — di mana langit, bumi, dan semuanya menyatu dalam damai. 🤍 Menatap pemandangan ini, seolah semua lelah perlahan luruh, digantikan ketenangan yang tulus. Alam mengajarkan: berhenti sejenak, tarik napas, dan nikmati keindahan yang ada di depan mata.&quot; #PemandanganAlamIndahKetenanganKeindahanAlamDamai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516169/3516169_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T06:25:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ROBLOX HORROR!!</video:title>
      <video:description>A horror roblox ai #Roblox #horror #ai #funny #robloxfunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516168/3516168_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T06:25:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Simpsons 🍩 S33E7 &quot;A Serious Flanders&quot; Part 2</video:title>
      <video:description>The gripping conclusion of The Simpsons&apos; crime-thriller parody — chaos erupts in Springfield as Marge races to save Homer and Chief Wiggum deals with an unprecedented body count. Classic Simpsons meets prestige drama satire! 😂🍩 #TheSimpsonsseason33 #Simpsonsepisode7 #ASeriousFlandersPart2 #HomerSimpson #MargeSimpson #ChiefWiggum #Springfield #Simpsonscrimeparody #animatedcomedy #cartoonshorts #TVshowclips #Foxanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516167/3516167_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-10-05T06:25:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516166</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516166/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎧 lagi mendengar kan musik</video:title>
      <video:description>🎧 mendengarkan musik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516166/3516166_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:25:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ratu assist mlbb</video:title>
      <video:description>#Game #mlbb #zetian #mobilelagends #aksiseru</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516165/3516165_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T06:24:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Duet in platform</video:title>
      <video:description>Duet in platform #Duet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516164/3516164_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T06:24:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Simpsons 🍩 S33E7 &quot;A Serious Flanders&quot;</video:title>
      <video:description>A wild clip from The Simpsons Season 33, Episode 7 — Homer gets caught up in real danger after Ned&apos;s secret stash of money attracts a dangerous criminal, turning Springfield into the set of a crime thriller parody. 😂🍩 #TheSimpsonsseason33 #Simpsonsepisode7 #ASeriousFlanders #HomerSimpson #NedFlanders #Springfield #Simpsonsfunnyclips #Simpsonscrimeparody #animatedcomedy #cartoonshorts #TVshowclips #Foxanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516163/3516163_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-10-05T06:23:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful 469</video:title>
      <video:description>#Aividio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516162/3516162_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T06:23:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What If Rhinos Plowed an Indonesian Rice Field? 🦏🌾</video:title>
      <video:description>Imagine seeing this in an Indonesian village… two powerful rhinos pulling a traditional plow through a rice field. 🦏🌾 Would you believe it if you saw this in real life? 👀 #rhinoplowingricefield #Indonesianricefield #traditionalfarming #Indonesiavillage #rhinovideo #wildlife #amazinganimals #farmerIndonesia #ricefarming #traditionalagriculture #AIgeneratedvideo #realisticAIvideo #unusualanimals #naturevideo #viralreels #Indonesianature #ruralIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516160/3516160_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:22:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>addababbas</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516159/3516159_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T06:22:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>圣淘沙娱乐公司【qq 3967995990】</video:title>
      <video:description>1.有没有实体现场，了解现场的具体位置，现场玩家多不多。 2.具有雄厚的资金链，出款速度是否快速。 3.是不是先发排后下注，是不是用铅笔点排，透明排靴。 4.是否能在网上通过视频验证与实体现场同步来证实。 5.全程人工操作、必须是透明模式。 6.可切换视频的任何角度以便查看是否有真实的现场大厅。 7.如果没有达到以上条件的，那就毋庸置疑肯定是假的平台， 千万不能玩。正规的平台都具备以上条件。</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516158/3516158_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:22:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ishq eahlybaitt</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516157/3516157_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T06:21:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516156</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516156/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Govt Graduate College Farooq Colony Sargodha 3</video:title>
      <video:description>آج قلم صرف الفاظ نہیں، محنت کا حساب لکھ رہا ہے۔ ✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516156/3516156_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:21:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>karwibatain</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516154/3516154_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T06:20:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kompilasi Adek Baru Kenangan Bersama Kakak - Animasi Doracimin - Doracimin</video:title>
      <video:description>#kartun #doracimin #animasilucuindo Selamat datang di dunia Animasi Doracimin dengan Genre Fantasi dan Komedi, Animasi Doracimin dibuat dengan menggunakan Aplikasi Flipaclip, Semoga salah satu dari kalian terhibur. Dukung Animator Doracimin Agar Lebih semangat https://sociabuzz.com/doracimin_ SOCIAL MEDIA : IG topup : doracimin_topup IG : doracimin_ Tiktok Utama : doracimin Tiktok Second : doracimin_official Snack Video : Doracimin Bstation : Doracimin Facebook : Doracimin Jangan lupa like komen dan subscribe ya ges #animasi #kartun #doracimin #animasidoracimin #animasilucuindo animasi, kartun, doracimin, animasi doracimin, vernalta, tekotok, animasi podtoon, animasi nopal, dasi gantung, dhot design, animasi lucu, kartun lucu, lucu, ngakak, video lucu, video ngakak, animasi kocak bikin ngakak.animasi sekolah,animasi lucu sekolahan,animasi lokal,animasi lucu indonesia,animasi seru sekolahan, animasi keren sekolahan, #animasikartundoraciminanimasidoraciminanimasilucuindo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516153/3516153_720p.mp4</video:content_loc>
      <video:duration>1028</video:duration>
      <video:publication_date>2026-10-05T06:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>one sidded claims</video:title>
      <video:description>When Meghan Markle recently spoke out about her experiences #MeghanMarkle #English</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516152/3516152_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-10-05T06:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Simpsons 🍩 S33E14 Funniest Moments</video:title>
      <video:description>A hilarious clip from The Simpsons Season 33, Episode 14 — Homer gets caught up in an internet scandal after footage of him makes him an overnight pariah in Springfield. Classic chaos and laughs! 😂🍩 #TheSimpsonsseason33 #Simpsonsepisode14 #HomerSimpson #Springfield #Simpsonsfunnyclips #Simpsonsviralmoment #animatedcomedy #cartoonshorts #Simpsonsseason33episode14 #TVshowclips #Simpsonshighlights #Foxanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516151/3516151_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-10-05T06:19:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic Soul</video:title>
      <video:description>Beautiful view of NH44 Jammu and Kashmir road ❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516150/3516150_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasih sayang kaka ditengah kemiskinan</video:title>
      <video:description>Di tengah keterbatasan, kasih sayang seorang kakak tetap menjadi tempat ternyaman bagi adiknya. ❤️ Mereka mungkin tak punya banyak, tapi mereka punya satu sama lain. Kecil di usia, besar di hati. 🥺❤️ #KasihSayangKakakKisahHidupSiblingLoveKeluargaMengharukan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516149/3516149_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T06:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afrika funny 3</video:title>
      <video:description>Funny video #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516148/3516148_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T06:19:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516147</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516147/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dream building</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516147/3516147_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:18:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Picnik ke pelabuhan ratu Sukabumi</video:title>
      <video:description>Tempat yang rekomendasi untuk melepas lelah... #Perjalanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516146/3516146_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T06:18:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Afrika funny #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516145/3516145_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T06:18:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ling Feels Unstoppable With Angela 💀</video:title>
      <video:description>#Mobilelegends #MLBB #MashaMLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516144/3516144_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:18:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Afrika funny #Vidiofunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516143/3516143_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T06:17:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fun n fun</video:title>
      <video:description>Ada ada aja ni kegiatannya #India</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516142/3516142_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T06:17:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nanti kalo yang aku udah ke kumpul aku beli kebahagiaan ku sendiri</video:title>
      <video:description>Semangat ngumpulin duet nya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516141/3516141_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T06:17:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love Blue 💙</video:title>
      <video:description>Love Blue 💙</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516140/3516140_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T06:16:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT FOR END 8</video:title>
      <video:description>FUNNY VIDEO #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516139/3516139_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T06:16:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Meghan Markle recently spoke out about her experiences 2</video:title>
      <video:description>When Meghan Markle recently spoke out about her experiences #MeghanMarkle #English #Harry</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516138/3516138_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-10-05T06:15:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>    The Love Behind The Legend — Inspired by Michael Jackson ❤️</video:title>
      <video:description>Behind every fame, there’s a heart that simply longs to be truly loved. 💫 True love isn&apos;t about millions — it&apos;s about being understood by the one who matters most. The most beautiful love stories live quietly in the heart 💌✨ #love #truelove #michaeljackson #quotes #heart #romance #inspiration</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516137/3516137_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:15:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KEMBALINYA RAJA NAGA</video:title>
      <video:description>KEMBALINYA RAJA NAGA #KEMBALINYARAJANAGA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516136/3516136_720p.mp4</video:content_loc>
      <video:duration>1159</video:duration>
      <video:publication_date>2026-10-05T06:14:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>گوادر اجتماع دعا مولانا خورشید صاحب</video:title>
      <video:description>گوادر اجتماع دعا مولانا خورشید صاحب #ReligiousPeaceLove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516135/3516135_720p.mp4</video:content_loc>
      <video:duration>350</video:duration>
      <video:publication_date>2026-10-05T06:14:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comment &quot;go&quot; for full guide 2</video:title>
      <video:description>Comment &quot;go&quot; for full guide #Commentgoforfullguide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516134/3516134_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T06:14:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mood qutosu</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516133/3516133_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T06:13:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comment &quot;go&quot; for full guide</video:title>
      <video:description>Comment &quot;go&quot; for full guide #Commentgoforfullguide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516132/3516132_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:13:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cheap combo</video:title>
      <video:description>cheap combo ice cup #vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516131/3516131_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-10-05T06:13:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muhammad 16</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516130/3516130_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T06:12:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 This Roblox Grandpa Can&apos;t Stop Laughing!</video:title>
      <video:description>This hilarious Roblox grandpa suddenly bursts into uncontrollable laughter! 😂 His laugh just keeps getting louder and funnier. Watch until the end! #Robloxgrandpa #funnyRoblox #Robloxfunnymoments #laughinggrandpa #Robloxcomedy #hilariousRoblox #funnygaming #Robloxanimation #RobloxShorts #funnyShorts #viralRoblox #comedyvideo #gamingShorts #funnycharacter #Robloxmeme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516129/3516129_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:12:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bigg Bigg Boss season 20 episode 28. Day 27.Salman Demands Honest Answers.720p</video:title>
      <video:description>Bigg Boss season 20 episode 28. Day 27.Salman Demands Honest Answers.720p.Salman ne kahaa ki ye season Bhoot boring ja raha hai. #Jiohotstar #Febspot.com . Please subscribe kar lo dosto toh aur bhi videos aane wali hai ❤️ Subscribe #IndiaandAmerica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516128/3516128_720p.mp4</video:content_loc>
      <video:duration>4296</video:duration>
      <video:publication_date>2026-10-05T06:10:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pakistani drivers 2</video:title>
      <video:description>Pakistani drivers #DangerousroadPakistanidrivers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516127/3516127_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T06:10:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prem Keetanu (2026)</video:title>
      <video:description>👍Don&apos;t Forget Like and Follow! #PremKeetanu2026 #PremKeetanuFullMovie #HindiMovie2026 #NewMovie2026 #yomovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516126/3516126_720p.mp4</video:content_loc>
      <video:duration>7773</video:duration>
      <video:publication_date>2026-10-05T06:10:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Want10$</video:title>
      <video:description>Want $10K/month from dropshipping? Focus on 3 things: Validating products before spending too much Ads that actually convert, not just views Scaling strategy (knowing when to push budget) Dropshipping is math + consistency. Get those 3 pieces #Want10kmonth</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516125/3516125_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:09:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aku melihatmu</video:title>
      <video:description>Aku melihatmu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516124/3516124_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:09:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sing n song</video:title>
      <video:description>This song so sweet #Song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516123/3516123_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T06:09:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hakeem ismail 2</video:title>
      <video:description>کیا آپ بھی Pus Cells کے مسئلے سے پریشان ہیں؟</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516122/3516122_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T06:08:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monster of sea</video:title>
      <video:description>Mereka Menarik Tali Itu… Tapi Apa yang Muncul dari Laut?! 😱🌊 Awalnya mereka mengira hanya menangkap sesuatu yang besar… Tapi yang muncul dari dalam laut ternyata jauh lebih mengerikan! 😳🐉 Tonton sampai akhir! #monsterlaut #monsterlautraksasa #seamonster #giantseamonster #monsterdarilaut #makhluklautmisterius #misterilaut #nelayan #fishingadventure #giantcreature #oceanmystery #seacreature #underwatermonster #scaryocean #AIvideo #AIstory #cinematicAI #viralvideo #videopendek #FYP #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516121/3516121_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:08:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>মাশাল্লাহ 2</video:title>
      <video:description>মাশাল্লাহ</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516120/3516120_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:07:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kompilasi Dunia Ghaib - Animasi Doracimin - Doracimin</video:title>
      <video:description>#kartun #doracimin #animasihorror Episode 246 : Menceritakan kompilasi Dunia Ghaib Selamat datang di dunia Animasi Doracimin dengan Genre Fantasi dan Komedi, Animasi Doracimin dibuat dengan menggunakan Aplikasi Flipaclip, Semoga salah satu dari kalian terhibur. Dukung Animator Doracimin Agar Lebih semangat https://sociabuzz.com/doracimin_ SOCIAL MEDIA : IG topup : doracimin_topup IG : doracimin_ Tiktok Utama : doracimin Tiktok Second : doracimin_official Snack Video : Doracimin Bstation : Doracimin Facebook : Doracimin Jangan lupa like komen dan subscribe ya ges #animasi #kartun #doracimin #animasidoracimin #animasilucuindo #animasihorror #animasihorrorlucu animasi, kartun, doracimin, animasi doracimin, vernalta, tekotok, animasi podtoon, animasi nopal, dasi gantung, dhot design, animasi lucu, kartun lucu, lucu, ngakak, video lucu, video ngakak, animasi kocak bikin ngakak.animasi sekolah,animasi lucu sekolahan,animasi lokal,animasi lucu indonesia,animasi seru sekolahan, animasi keren sekolahan, animasi horror, #animasi #kartun #doracimin #animasidoracimin #animasilucuindo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516119/3516119_720p.mp4</video:content_loc>
      <video:duration>1020</video:duration>
      <video:publication_date>2026-10-05T06:07:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 16</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516118/3516118_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T06:06:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fidarabia 18</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516117/3516117_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T06:06:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teskilat - Episode 187 (English Subtitles)</video:title>
      <video:description>National Intelligence Organization members are always ready to serve to destroy the enemies of Turkey. This is, Teskilat (The Order, The Intel). #teskilatepisode187 #teskilatepisode187englishsubtitles #teskilatepisode187withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516116/3516116_720p.mp4</video:content_loc>
      <video:duration>8508</video:duration>
      <video:publication_date>2026-10-05T06:06:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 15</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516115/3516115_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T06:06:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#bikin laper bule 27</video:title>
      <video:description>masakan khas Indonesia #hiburan #kuliner #wisata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516114/3516114_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T06:06:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ketika Tangan Dan Kaki Berkata</video:title>
      <video:description>Ketika Tangan Dan Kaki Berkata by Fadli &amp; Kadri Sebuah lagu yang ditulis oleh Taufik Ismail buat Chrisye dibawakan kembali oleh Fadli dan Kadri #Chrisye #TaufikIsmail #Fadli #Kadri #Lagureligi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516113/3516113_720p.mp4</video:content_loc>
      <video:duration>261</video:duration>
      <video:publication_date>2026-10-05T06:06:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 14</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516112/3516112_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T06:05:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 13</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516111/3516111_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T06:05:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 12</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516110/3516110_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T06:05:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m ladybird</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516109/3516109_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T06:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 11</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516108/3516108_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T06:05:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 10</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516107/3516107_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:04:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 9</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516106/3516106_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T06:04:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 8</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516105/3516105_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T06:04:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kompilasi di Bulan Ramadhan Part 3 - Animasi Doracimin - Doracimin</video:title>
      <video:description>#kartun #doracimin #animasilucuindo Episode 212 : Tentang Kompilasi Ramadhan Part 3 Selamat datang di dunia Animasi Doracimin dengan Genre Fantasi dan Komedi, Animasi Doracimin dibuat dengan menggunakan Aplikasi Flipaclip, Semoga salah satu dari kalian terhibur. Dukung Animator Doracimin Agar Lebih semangat https://sociabuzz.com/doracimin_ SOCIAL MEDIA : IG topup : doracimin_topup IG : doracimin_ Tiktok Utama : doracimin Tiktok Second : doracimin_official Snack Video : Doracimin Bstation : Doracimin Facebook : Doracimin Jangan lupa like komen dan subscribe ya ges #animasi #kartun #doracimin #animasidoracimin #animasilucuindo animasi, kartun, doracimin, animasi doracimin, vernalta, tekotok, animasi podtoon, animasi nopal, dasi gantung, dhot design, animasi lucu, kartun lucu, lucu, ngakak, video lucu, video ngakak, animasi kocak bikin ngakak.animasi sekolah,animasi lucu sekolahan,animasi lokal,animasi lucu indonesia,animasi seru sekolahan, animasi keren sekolahan, #animasi #kartun #doracimin #animasidoracimin #animasilucuindo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516104/3516104_720p.mp4</video:content_loc>
      <video:duration>849</video:duration>
      <video:publication_date>2026-10-05T06:04:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 7</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516103/3516103_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:03:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mianus</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516102/3516102_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T06:03:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Air minum</video:title>
      <video:description>Jangan lupa,harus perbanyak minum karena cuaca sedang tidak baik baik saja #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516101/3516101_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T06:03:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 6</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516100/3516100_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:03:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 5</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516099/3516099_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T06:02:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>real madrid vs bayern muenchen 2</video:title>
      <video:description>#realmadrid #bayernmuenchen #football #usa #uk #canada #australia #newzealand #germany #spain #france #japan #china #korea</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516098/3516098_720p.mp4</video:content_loc>
      <video:duration>152</video:duration>
      <video:publication_date>2026-10-05T06:02:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐱 Amazing Cat Facts You Probably Didn’t Know!</video:title>
      <video:description>Cats are adorable, but they also have many fascinating habits and behaviors. 🐱❤️ Do you have a cat at home? Watch closely and see if your cat does the same things! 😻 #cat #cutecat #funnycat #catfacts #adorablecat #kitten #cutekitten #catlover #catlovers #pet #pets #domesticcat #funnyanimals #cuteanimals #animalfacts #catbehavior #catvideo #catphotography #lovelycat #adorablekitten #animallover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516097/3516097_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:00:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The chicken&apos;s fate was truly unfortunate.</video:title>
      <video:description>the chicken is in the wrong place #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516096/3516096_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:00:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exploring the Peaceful Beauty of Mount Tranggulasih in Roblox!</video:title>
      <video:description>Take a peaceful breath and enjoy a cozy, aesthetic journey through Mount Tranggulasih in Roblox! Join me as I explore flower fields, ride bicycles, picnic under the trees, and enjoy the breathtaking sunset views with animals around. ​🌸 Location: Mount Tranggulasih (Roblox) 🎵 Music: Soft / Relaxing Lo-Fi Vibe ​If you enjoyed this video, please Like, Comment, and Subscribe for more aesthetic Roblox adventures! ✨🌾 #Roblox #MountTranggulasih #RobloxAesthetic #RobloxNature #CozyRobloxGameplay #RobloxVibe #RobloxPicnic #AestheticRobloxAvatar #RobloxMountTranggulasih #RelaxingRoblox</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516095/3516095_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T05:59:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freandly</video:title>
      <video:description>Pertemanan yg dulu pernah ada #Teman #freand #seorangteman #masawaktu #dimanasekarang #dimana #mereka</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516094/3516094_720p.mp4</video:content_loc>
      <video:duration>178</video:duration>
      <video:publication_date>2026-10-05T05:58:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meme afrika</video:title>
      <video:description>Funny video #Vidiofunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516093/3516093_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T05:57:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kompilasi Adek Baru Season 2 Full - Animasi Doracimin - Doracimin</video:title>
      <video:description>#kartun #doracimin #animasilucuindo Terimakasih Sudah Menonton Selamat datang di dunia Animasi Doracimin dengan Genre Fantasi dan Komedi, Animasi Doracimin dibuat dengan menggunakan Aplikasi Flipaclip, Semoga salah satu dari kalian terhibur. Dukung Animator Doracimin Agar Lebih semangat https://sociabuzz.com/doracimin_ SOCIAL MEDIA : IG : doracimin_ Tiktok Utama : doracimin Tiktok Second : doracimin_official Snack Video : Doracimin Bstation : Doracimin Facebook : Doracimin Jangan lupa like komen dan subscribe ya ges #animasi #kartun #doracimin #animasidoracimin #animasilucuindo animasi, kartun, doracimin, animasi doracimin, vernalta, tekotok, animasi podtoon, animasi nopal, dasi gantung, dhot design, animasi lucu, kartun lucu, lucu, ngakak, video lucu, video ngakak, animasi kocak bikin ngakak. #animasi #kartun #doracimin #animasidoracimin #animasilucuindo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516092/3516092_720p.mp4</video:content_loc>
      <video:duration>735</video:duration>
      <video:publication_date>2026-10-05T05:57:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gonul Dagi - Episode 225 (English Subtitles)</video:title>
      <video:description>An Anatolian Tale in the &quot;The Mountain of Hearts&quot; is the story of pale yellow soils, legends that have been voiced for years, and unforgettable loves, Gonul Dagi is the story of Anatolian children, who had big dreams in their little world, is the story of 3 cousins who pursue their dreams in the steppe and try to achieve the impossible despite all obstacles. This is, Gonul Dagi (The Mountain of Hearts) #gonuldagiepisode225 #gonuldagiepisode225englishsubtitles #gonuldagiepisode225withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516091/3516091_720p.mp4</video:content_loc>
      <video:duration>9225</video:duration>
      <video:publication_date>2026-10-05T05:57:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours episode 6  hindi dubbed</video:title>
      <video:description>K drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516090/3516090_720p.mp4</video:content_loc>
      <video:duration>3861</video:duration>
      <video:publication_date>2026-10-05T05:57:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan alam 22</video:title>
      <video:description>Pemandangan alam #Alam #pemandangan #video #trend #sunset</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516089/3516089_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:56:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>400m men s3</video:title>
      <video:description>Ifam oordegem #Belgische</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516088/3516088_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T05:56:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afrika funny 2</video:title>
      <video:description>Funny video #Videofunnyafrika</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516087/3516087_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T05:56:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Morning Shower</video:title>
      <video:description>Girl take a bath #Sexy #shower #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516086/3516086_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:56:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rush.Hour.3.2007</video:title>
      <video:description>بعد تعرض السفير (هان) لمحاولة اغتيال، يعود (لي) و(كارتر) إلى العمل معًا، ويتوجها إلى باريس لحماية امرأة فرنسية لديها معلومات عن قادة العصابات الثلاثية، فيقوم (لي) بعقد لقاء سري مع مسؤول بهيئة الأمم المتحدة، كما يقع في صراع شخصي مع أحد رجال العصابات الصينية، ويجد نفسه في سباق عبر معالم مدينة باريس. #الكلماتالمفتاحيةRushHour3 #ساعةالذروة3 #RushHour32007 #فيلمRushHour3 #فيلمساعةالذروة #JackieChan #جاكيشان #ChrisTucker #كريستاكر #Lee #Carter #InspectorLee #JamesCarter #أفلامأكشن #أفلامكوميديا #أفلامجاكيشان #أفلامكريستاكر #أفلامأكشنوكوميديا #أفلامشرطة #أفلاممطاردات #أفلامقتال #أفلامصينية #أفلامهوليوود #Paris #باريس #RushHour #ساعةالذروة3مترجم #RushHour3مترجم #RushHour3كامل #شرحفيلمRushHour3 #قصةفيلمRushHour3 #ملخصفيلمRushHour3 #تحليلفيلمRushHour3 #JackieChanmovies #ChrisTuckermovies #ActionComedyMovies #RushHour3Movie #RushHour3FullMovie #RushHour3Arabic #RushHour3Review</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516085/3516085_720p.mp4</video:content_loc>
      <video:duration>5447</video:duration>
      <video:publication_date>2026-10-05T05:56:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afrika funny</video:title>
      <video:description>Funny video #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516084/3516084_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T05:55:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POV: You&apos;re Sitting Alone In Front of The Fire at Night - So Relaxing 🔥</video:title>
      <video:description>Experience the warmth and peace of a real campfire at night. The sound of crackling wood is perfect for relaxing, sleeping, meditation, stress relief, and cozy winter nights. No music, just pure natural fire sounds. Let this fire burn in your background while you study, sleep, or relax. 🔥 If you enjoy this, watch the FULL 1 HOUR version on my channel! 💬 Where are you watching from? Comment below. 👍 Don&apos;t forget to LIKE and SUBSCRIBE for more relaxing fireplace videos. #fypcampfirefireplacecracklingfirerelaxingasmrbonfirecozyfireplacevibessleepaidmeditationapiunggunaesthetichealingsatisfying</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516083/3516083_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T05:54:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Christin pike</video:title>
      <video:description>Christin pike the eksekusi #Amerika</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516081/3516081_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T05:53:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drama, Headlines, and High Stakes</video:title>
      <video:description>Drama, Headlines, and High Stakes #PrinceHarry #MeghanMarkle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516080/3516080_720p.mp4</video:content_loc>
      <video:duration>127</video:duration>
      <video:publication_date>2026-10-05T05:52:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waw Amazing Nature</video:title>
      <video:description>#Nature #foryou #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516079/3516079_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:52:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kambing 5</video:title>
      <video:description>Kambing ternak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516078/3516078_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T05:51:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ungkapan isi hati 4</video:title>
      <video:description>Broken home #Indo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516077/3516077_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T05:50:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Work with heat</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516076/3516076_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T05:50:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 4</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516075/3516075_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:50:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 3</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516074/3516074_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:50:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Started a Business at 7 Years Old! What an Inspiring Story!”</video:title>
      <video:description>What if you started your first business at just 7 years old? 🐔💰 This is the inspiring story of how a simple chicken business became the beginning of a young entrepreneur’s journey. It’s not about how much money you have—it’s about having the courage to start, learn, and keep growing. 🚀 Would you start a business at 7? Let me know in the comments! 👇 #startedbusinessat7 #businessat7yearsold #youngentrepreneur #childentrepreneur #youngbusinessowner #chickenbusiness #chickenfarmingbusiness #startingabusinessyoung #businesssuccessstory #entrepreneurstory #youngentrepreneurstory #businessmotivation #entrepreneurship #smallbusiness #businessforbeginners #successstory #entrepreneurialmindset #businessinspiration #kidsbusiness #startingabusiness</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516073/3516073_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T05:50:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio Cat funny</video:title>
      <video:description>Cat funny #Catfunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516072/3516072_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-05T05:50:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tobey Maguire V&apos;s tom Holland 💀🥶</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍😍😍😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516071/3516071_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:49:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANOTHER CRABS THEASURE: desafio passado agora pra onde ir..</video:title>
      <video:description>ANOTHER CRABS THEASURE: desafio passado agora pra onde ir.., procurar o caminho certo #ANOTHERCRABSTHEASURE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516070/3516070_720p.mp4</video:content_loc>
      <video:duration>234</video:duration>
      <video:publication_date>2026-10-05T05:49:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 2</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516069/3516069_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T05:49:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE.</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516068/3516068_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T05:49:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat funny 65</video:title>
      <video:description>Funny video #Catfunnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516067/3516067_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-05T05:49:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Part seventy</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516066/3516066_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T05:48:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the most beautiful place in florida</video:title>
      <video:description>#beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516065/3516065_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:48:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hijre mohobbat yaara</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516064/3516064_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T05:48:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANOTHER CRABS THEASURE: desafio difícil dessa lagosta</video:title>
      <video:description>ANOTHER CRABS THEASURE: desafio difícil dessa lagosta, mordendo.. #ANOTHERCRABSTHEASURE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516063/3516063_720p.mp4</video:content_loc>
      <video:duration>125</video:duration>
      <video:publication_date>2026-10-05T05:48:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cirkin - Episode 11 (English Subtitles)</video:title>
      <video:description>Meryem, who clings to life guided only by her good intentions, as she reunites with her one true love, Kadir—now a man shaped by power, wealth, and ambition. This is, Cirkin (Ugly). #cirkinepisode11 #cirkinepisode11englishsubtitles #cirkinepisode11withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516062/3516062_720p.mp4</video:content_loc>
      <video:duration>8822</video:duration>
      <video:publication_date>2026-10-05T05:47:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joining the Brazilian style dance trend</video:title>
      <video:description>#Trendingdance #challengeViraldancetrends #Currentdancetrend #TikTokdancecompilation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516061/3516061_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:47:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perfect moment 😁</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑😍💗😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516060/3516060_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T05:47:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exploring the Majestic Nature of Mt. Aksara in Roblox!</video:title>
      <video:description>Join me on a peaceful and relaxing journey through the stunning, hyper-realistic nature of Mt. Aksara in Roblox! From lush forests and serene waterfalls to wildlife encounters like deer and elephants, explore this breathtaking map and enjoy the tranquil vibe. ​Don&apos;t forget to Like, Comment, and Subscribe for more Roblox exploration videos! 🌲✨ #​Roblox #RobloxNature #MtAksaraRoblox #RobloxRealisticGraphics #RobloxExploration #RelaxingRobloxGameplay #RobloxWildlife #RobloxWaterfall #RobloxForest #RobloxAesthetic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516059/3516059_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:46:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vina Tries Out a New App</video:title>
      <video:description>Vina Tries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516058/3516058_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:46:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Should the King show Harry and Meghan &quot;more compassion&quot; in order to prevent the Duke of Windsor from</video:title>
      <video:description>Should the King show Harry and Meghan &quot;more compassion&quot; in order to prevent the Duke of Windsor from making the same mistake? #MeghanMarkle #Harry #English</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516057/3516057_720p.mp4</video:content_loc>
      <video:duration>143</video:duration>
      <video:publication_date>2026-10-05T05:44:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dance 755</video:title>
      <video:description>Beautyfull dancer #Dancerviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516056/3516056_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T05:43:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Varsha Thakur</video:title>
      <video:description>Dr Krishan Lal Sehgal · Uba Bame Rezta 🫶🏻🤗🙏</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516055/3516055_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:43:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Biker 2</video:title>
      <video:description>Learning to ride a motorcycle at 34 years old. It’s never too late to learn something new. ❤️🏍️ #Biker</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516054/3516054_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T05:43:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🧡 love</video:title>
      <video:description>🧡</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516053/3516053_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T05:42:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pepsi Ads</video:title>
      <video:description>the best only drink is pepsi #digitalmarketer #telemarketing #directmarketing #brandawareness #digitalmarketer #telemarketing #directmarketing #brandawareness #advertising #PEPSI #pepsiinternational</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516052/3516052_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:42:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anime adult episode 1 Yowayowa Sensei Uncensored - Hindi</video:title>
      <video:description>#Animeadultwebseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516051/3516051_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-10-05T05:42:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Explore with Mobeen</video:title>
      <video:description>Naqvi Burj — Akbari Fort, Gujrat 🏰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516050/3516050_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:41:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rumah sakit</video:title>
      <video:description>Ketika anak sakit semuanya berubah #Rumahsakit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516049/3516049_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:40:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soul Land (Douluo Dalu) Season 2 Episode 15 English Subbed</video:title>
      <video:description>Soul Land (Douluo Dalu) Season 2 Episode 15 English Subbed #Tangsan #XiaoWu #DaiMuBai #Shrek #Douluo #Dalu #SoulLand #Donghua #Chinese #Anime #XiaoYan #Lindong #MuChen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516048/3516048_720p.mp4</video:content_loc>
      <video:duration>1119</video:duration>
      <video:publication_date>2026-10-05T05:40:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemecah ombak</video:title>
      <video:description>Ombaknya besar di pantai jadi di bikin pemecah biar aman #ombak #pantai #laut #pasirputih #pejalanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516047/3516047_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:39:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Marketing, explained at one party. 😄</video:title>
      <video:description>Marketing, explained at one party. 😄 You introduce yourself — that’s advertising. Your friend hypes you up — that’s word-of-mouth. Someone’s already heard great things about you — that’s branding. And just as you’re about to talk to someone interesting, a rival jumps in first — that’s competition. Funny, but true: good marketing is just knowing who you&apos;re talking to, why they should pick you, and how they&apos;ll react. Save this for later and share it with someone who likes business made simple. [Digital marketing, Captions, customer feedback, brand awareness, digital marketer, advertising, telemarketing, direct marketing, professor, explanation video, typography, motioin graphics, Anime, Animation, 3d animation, Brand promotion, Social media marketing, Korea, USA, America, China, Indonesia, Necklace, red outfit, black outfit, green outfit, captions, viral] #digitalmarketer #telemarketing #directmarketing #brandawareness #Digitalmarketing #Captions #customerfeedback #brandawareness #digitalmarketer #advertising #telemarketing #directmarketing #professor #explanationvideo #typography #motioingraphics #Anime #Animation #3danimation #Brandpromotion #Socialmediamarketing #Korea #USA #America #China #Indonesia #Necklace #redoutfit #blackoutfit #greenoutfit #vira</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516046/3516046_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T05:38:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gonul Dagi - Episode 224 (English Subtitles)</video:title>
      <video:description>An Anatolian Tale in the &quot;The Mountain of Hearts&quot; is the story of pale yellow soils, legends that have been voiced for years, and unforgettable loves, Gonul Dagi is the story of Anatolian children, who had big dreams in their little world, is the story of 3 cousins who pursue their dreams in the steppe and try to achieve the impossible despite all obstacles. This is, Gonul Dagi (The Mountain of Hearts). #gonuldagiepisode224 #gonuldagiepisode224englishsubtitles #gonuldagiepisode224withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516045/3516045_720p.mp4</video:content_loc>
      <video:duration>8883</video:duration>
      <video:publication_date>2026-10-05T05:38:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rush.Hour.1.1998</video:title>
      <video:description>بعد وقت قصير من وصول (هان) إلى أمريكا لتولي منصبه الدبلوماسي الجديد في لوس أنجلوس، تختطف ابنته (سو يونغ)، بينما كانت في طريقها إلى أول يوم لها في المدرسة. القنصل هان يدعو المفتش لي (جاكي شان) للمساعدة في هذه القضية. مكتب التحقيقات الفيدرالي يقرر إبعاد لي عن القضية وتوكل مهمة مراقبته لـ جيمس كارتر (كريس تاكر) الذي يقرر حل القضية بنفسه، عندما اكتشف بأنه قد أعطيت له مهمة وضيعة وبعد عدة مناوشات يتحد مع لي لإنقاذ الفتاة. #RushHour #RushHour1998 #RushHourmovie #JackieChan #ChrisTucker #JamesCarter #DetectiveLee #BrettRatner #actioncomedy #martialarts #buddycop #HongKongpolice #LosAngeles #JackieChanmovies #ChrisTuckermovies #RushHour2 #RushHour3 #أفلامجاكيشان #أفلامأكشن #أفلامكوميدية #أفلامشرطة #ساعةالذروة #فيلمRushHour #جاكيشان #كريستاكر</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516044/3516044_720p.mp4</video:content_loc>
      <video:duration>5868</video:duration>
      <video:publication_date>2026-10-05T05:38:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beaconhouse Main Campus (Jhang Sadar, Pun</video:title>
      <video:description>A beautiful day at Beaconhouse! 🌤️✨ Where learning meets nature.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516043/3516043_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T05:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tskills Dev</video:title>
      <video:description>💻 Learn to Add Watermark in MS Word! 💧 D…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516042/3516042_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T05:37:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sakamoto days momment 2</video:title>
      <video:description>#anime #japan #china #korea #usa #uk #newzealand #canada #australia #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516041/3516041_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-10-05T05:37:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Timnas indonesia 5</video:title>
      <video:description>Timnas. Indonesia masukfinal #Timnasindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516040/3516040_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:36:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Honda Prime</video:title>
      <video:description>Agar Apke pas bhi hai 2nd Hand motorcycle to ubi Visit Karen Honda prime🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516039/3516039_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 293</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516038/3516038_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:36:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Memulai investasi</video:title>
      <video:description>Memulai investasi #Investasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516037/3516037_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-10-05T05:34:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>B News</video:title>
      <video:description>ایک چھوٹا سا ایس ایم ایس اپ کا پورا دن بچا سکتا ہے</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516036/3516036_720p.mp4</video:content_loc>
      <video:duration>373</video:duration>
      <video:publication_date>2026-10-05T05:34:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dek anggi cantik, mari berjoget bersama</video:title>
      <video:description>✨ Sekadar hiburan tentang kecantikan 🌸 Menikmati sisi indah, anggun, dan menarik dari setiap perempuan. 💕 Bukan untuk membandingkan, hanya untuk menikmati keindahan dan berbagi vibes positif. 🌷✨ #menariberjogethiburanvideokecantikan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516035/3516035_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:34:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 375</video:title>
      <video:description>Funny video #Funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516034/3516034_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T05:33:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>this is blurrr</video:title>
      <video:description>blurrrrrr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516033/3516033_720p.mp4</video:content_loc>
      <video:duration>263</video:duration>
      <video:publication_date>2026-10-05T05:33:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat funny 64</video:title>
      <video:description>Funny cat #Cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516032/3516032_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T05:33:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Por que seu gato mia?</video:title>
      <video:description>🐱 Por que seu gato mia? Você já parou para pensar no que seu gato quer dizer quando mia? Cada miado pode ter um significado diferente: fome, carinho, atenção, medo, desconforto ou simplesmente vontade de brincar. Observe o comportamento e o tom do miado para entender melhor o seu companheiro. Descubra os principais motivos pelos quais seu gato mia e aprenda a interpretar melhor essa forma especial de comunicação. ❤️🐾 #Gato</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516031/3516031_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T05:33:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat funny 63</video:title>
      <video:description>Funny video #Cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516030/3516030_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-10-05T05:32:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeo: Bebê de 1 ano escapa de creche e caminha até o trabalho da mãe</video:title>
      <video:description>Vídeo: Bebê de 1 ano escapa de creche e caminha até o trabalho da mãe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516029/3516029_720p.mp4</video:content_loc>
      <video:duration>389</video:duration>
      <video:publication_date>2026-10-05T05:32:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tusar halder</video:title>
      <video:description>New new design ideas for</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516028/3516028_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:32:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sambil nunggu orderan,joget dulu coyy</video:title>
      <video:description>All the driver online happy only for waiting order come in #driver #happy #dancing #singing #theculture</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516027/3516027_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T05:32:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coffee roasted</video:title>
      <video:description>Original roasted coffee beans, Ready to be ground, And marketted. #Coffee #roasted #original</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516026/3516026_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T05:31:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#CriminalStoryJapan#</video:title>
      <video:description>Ngeriiiiiyyyy #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516025/3516025_720p.mp4</video:content_loc>
      <video:duration>1542</video:duration>
      <video:publication_date>2026-10-05T05:30:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daha On Yedi - Episode 19 (English Subtitles)</video:title>
      <video:description>Raised in an orphanage, 17-year-old Aras embarks on a life-changing journey from Istanbul to Bodrum in search of his sister, confronting the secrets of his family and the truth about his past. This is, Daha On Yedi, Daha 17 (Just 17). #dahaonyediepisode19 #dahaonyediepisode19englishsubtitles #dahaonyediepisode19withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516024/3516024_720p.mp4</video:content_loc>
      <video:duration>8640</video:duration>
      <video:publication_date>2026-10-05T05:30:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>강아지 두마리</video:title>
      <video:description>강아지 두마리</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516023/3516023_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:29:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kadang Kita Lupa, Ada yang Berjuang Demi Kita ❤️</video:title>
      <video:description>Di balik setiap perjuangan, ada orang yang berharap kita bisa hidup lebih baik. Jangan sia-siakan pengorbanan mereka. ❤️ #Motivasi #keluarga #katabijak #renungan #inspirasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516022/3516022_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T05:29:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Priyanka Bidhuri</video:title>
      <video:description>I have completed 53 stars, just need 47</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516021/3516021_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:29:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Your Diet Lasts Only 5 Minutes! 🍕🤣</video:title>
      <video:description>When Your Diet Lasts Only 5 Minutes! 🍕🤣 I started the day with one simple goal: “Today, I’m going to eat healthy!” 🥗 Then I saw the food… and my diet immediately resigned. 😂😭 Watch till the end for the ultimate diet fail! 🤣 🔥 Follow for daily comedy, funny acts &amp; crazy moments! #ComedyFunnyVideoDietComedyDietFailFunnyReelsComedyReelsShortsYouTubeShortsInstagramReelsFacebookReelsViralComedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516020/3516020_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:29:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Switzerland Daily</video:title>
      <video:description>witzerland 🇨🇭🚁</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516019/3516019_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T05:29:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>88 holloween2</video:title>
      <video:description>Special edition</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516018/3516018_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:28:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It Gyan 2.0</video:title>
      <video:description>🔥Windows problems Try this Recovery Repair Toolkit!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516017/3516017_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T05:28:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Celva is showing off her new phone.</video:title>
      <video:description>Celva is showing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516016/3516016_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:28:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516015</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516015/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>87 holloween 1</video:title>
      <video:description>Special edition</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516015/3516015_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T05:28:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jika lupa membaca do&apos;a sebelum makan</video:title>
      <video:description>Jangan lupa berdoa sebelum makan #Doamakanygterlupa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516014/3516014_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T05:27:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Snowy Morning That Feels Like a Dream ❄️✨</video:title>
      <video:description>A peaceful winter morning covered in fresh snow. Sometimes, nature creates the most beautiful views. 🤍❄️ #SnowWinterWinterWonderlandSnowfallCozyVibesNaturePeacefulBeautifulViewDreamyAestheticWinterVibesRelaxingViralFYPForYoufebspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516013/3516013_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T05:27:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ollhas Seychelles</video:title>
      <video:description>Ilhas Seychelles 🌴🌊 As Ilhas Seychelles são um verdadeiro paraíso no Oceano Índico, famosas por suas praias de areia branca, águas cristalinas, grandes pedras de granito e natureza exuberante. O arquipélago encanta visitantes com paisagens tropicais, rica vida marinha e momentos de tranquilidade em meio à natureza. Um destino perfeito para quem busca praias paradisíacas, aventura, romance e uma experiência inesquecível. 🏝️✨ #Viajem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516012/3516012_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T05:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goingball</video:title>
      <video:description>Have a nice day 💣 #Us #febspot #viral #news #earn</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516011/3516011_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:25:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mlbb win</video:title>
      <video:description>mlbb win</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516010/3516010_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T05:25:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>House on stilts</video:title>
      <video:description>House on stilt house standing at the foot of the mountain #Travel #tourisme #nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516009/3516009_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T05:25:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hey hello</video:title>
      <video:description>🫣🫣🫣 #Heyhello</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516008/3516008_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:25:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Statue a person</video:title>
      <video:description>A beautiful statue of a person stands in a public place. It looks realistic and shows the details of the human figure #Statue #art</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516007/3516007_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:25:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🫣🫣🫣 3</video:title>
      <video:description>🫣🫣🫣 #🫣🫣🫣</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516006/3516006_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T05:25:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Permainan skuisi</video:title>
      <video:description>Main skuisi di pantai #ombak #pantai #sunset #indah #pasir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516005/3516005_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:24:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiiii 2</video:title>
      <video:description>🤭🤭🤭 #Hii</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516004/3516004_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:24:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clay Art #7</video:title>
      <video:description>This video shows the process of creating artwork from clay. The clay is carefully shaped and crafted into unique, detailed, and interesting forms and characters. #ClayArt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516003/3516003_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T05:23:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jiya rajpoot officialpage68</video:title>
      <video:description>Udit Narayan, Ranjana Joglekar · Piya, Piya O Piya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516002/3516002_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:23:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The moment Ronaldo defeated Bayern in 2017</video:title>
      <video:description>The moment Ronaldo defeated Bayern in 2017@.fullycrx7</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516001/3516001_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-10-05T05:23:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Areeba Hoor</video:title>
      <video:description>Airport feeling</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516000/3516000_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:22:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This woman is listening to what Mr. Prabowo says.</video:title>
      <video:description>This woman is listening #woman #listening #mrpresiden</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515999/3515999_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T05:22:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Elysian Estate and Developers</video:title>
      <video:description>📲 0328 4222888 1 Kanal Brand-New Ultra Modern Fully Furnished Designer House | DHA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515998/3515998_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T05:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAAT HIDUP MENGALAMI KESULITAN  TERSESAT TIDAK TAU HARUS KEMANA,  TIDAK TAU HARUS BERBUAT APA   BACA</video:title>
      <video:description>SAAT HIDUP MENGALAMI KESULITAN TERSESAT TIDAK TAU HARUS KEMANA, TIDAK TAU HARUS BERBUAT APA BACA AYAT INI ALLAH AKAN MEMBERI JALAN KELUAR ALLAH AKAN TUNJUKKAN ARAH TUJUAN HIDUP. INSYAALLAH ​﷽ ​﴿ ٱلسَّلَامُ عَلَيْكُمْ وَرَحْمَةُ ٱللَّهِ وَبَرَكَٰتُهُ ﴾ إِنِّى وَجَّهْتُ وَجْهِىَ لِلَّذِى فَطَرَ ٱلسَّمَـٰوَٰتِ وَٱلْأَرْضَ حَنِيفًا ۖ وَمَآ أَنَا۠ مِنَ ٱلْمُشْرِكِينَ ٧٩ Aku hadapkan wajahku kepada (Allah) yang menciptakan langit dan bumi dengan penuh kepasrahan (mengikuti) agama yang benar, dan aku bukanlah termasuk orang-orang musyrik. #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #HijratulIslam #MoeslemofAmerica #QuranForEveryOne #MurrotalQuran #TafsirQuran #DoaHarian #KajianIslam #BelajarIslam #MuslimQuotes #MotivasiHijrah #IslamRahmatanLilAlamin #AlQuran #Sunnah #Istiqamah #NasihatIslami #CeramahPendek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515997/3515997_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T05:21:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cameron Walker</video:title>
      <video:description>The King has been welcomed with a Guard of Honour at Balmoral Castle ahead of his summer holiday. His Majesty met the Royal Regiment of Scotland’s She</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515996/3515996_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:21:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>he Most Satisfying Miniature Moped Build You Will Ever Watch!</video:title>
      <video:description>Watch this incredibly satisfying assembly of a 1/12 scale classic vintage moped. From unboxing the meticulously organized parts to the final polish, every step of building this miniature retro scooter is packed with relaxing visual details and precise craftsmanship. Experience the highly satisfying process as the miniature engine, suspension, wheels, and body panels come together to create a stunningly realistic mini motorbike that even features a working headlight. Perfect for model kit enthusiasts, craft lovers, and anyone who enjoys relaxing, meticulous ASMR builds. #miniaturebuilding #ASMR #satisfyingvideo #modelkit #vintagemoped #classicscooter #112scale #miniaturemotorbike #retromotorcyclebuild #relaxingassembly #diorama #hobbycraft #miniengine #precisecraftsmanship #satisfyingsounds #scalemodeling #miniatureart #vintagebike #ASMRbuilding #crafthobby</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515995/3515995_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:20:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILM HOROR TERBARU - BISIKAN IBLIS (2026) _ Full Movie</video:title>
      <video:description>FILM HOROR TERBARU - BISIKAN IBLIS (2026) _ Full Movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515994/3515994_720p.mp4</video:content_loc>
      <video:duration>5049</video:duration>
      <video:publication_date>2026-10-05T05:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>COMO SOBREVIVIR EN EL BOSQUE - THE FOREST</video:title>
      <video:description>COMO SOBREVIVIR EN EL BOSQUE - THE FOREST #theforest #terror #games #juegosdemiedo #gameplay #fernanfloo #youtubers #youtube #febspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515993/3515993_720p.mp4</video:content_loc>
      <video:duration>193</video:duration>
      <video:publication_date>2026-10-05T05:20:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A child learning to walk.</video:title>
      <video:description>A child learning to walk. #Achild #learning #to #walk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515992/3515992_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T05:19:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REZEKI MU AKAN TETAP MENGALIR  SAAT KAMU TIDUR DAN SAAT KAMU  BANGUN.   BACA AYAT INI MALAM DAN PAGI</video:title>
      <video:description>REZEKI MU AKAN TETAP MENGALIR SAAT KAMU TIDUR DAN SAAT KAMU BANGUN. BACA AYAT INI MALAM DAN PAGI ​﷽ ​﴿ ٱلسَّلَامُ عَلَيْكُمْ وَرَحْمَةُ ٱللَّهِ وَبَرَكَٰتُهُ ﴾ وَهُوَ ٱلَّذِى يَتَوَفَّىٰكُم بِٱلَّيْلِ وَيَعْلَمُ مَا جَرَحْتُم بِٱلنَّهَارِ ثُمَّ يَبْعَثُكُمْ فِيهِ لِيُقْضَىٰٓ أَجَلٌ مُّسَمًّى ۖ ثُمَّ إِلَيْهِ مَرْجِعُكُمْ ثُمَّ يُنَبِّئُكُم بِمَا كُنتُمْ تَعْمَلُونَ ٦٠ Dan Dialah yang menidurkan kamu pada malam hari dan Dia mengetahui apa yang kamu kerjakan pada siang hari. Kemudian Dia membangunkan kamu pada siang hari untuk disempurnakan umurmu yang telah ditetapkan. Kemudian kepada-Nya tempat kamu kembali, lalu Dia memberitahukan kepadamu apa yang telah kamu kerjakan. #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #HijratulIslam #MoeslemofAmerica #QuranForEveryOne #MurrotalQuran #TafsirQuran #DoaHarian #KajianIslam #BelajarIslam #MuslimQuotes #MotivasiHijrah #IslamRahmatanLilAlamin #AlQuran #Sunnah #Istiqamah #NasihatIslami #CeramahPendek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515991/3515991_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T05:19:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I just realized that church music can be this cool 🎵</video:title>
      <video:description>Church music concerts can be this cool 🎵 #ravejesusmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515990/3515990_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jj boring 🙏🏻:)</video:title>
      <video:description>Boring #Sleepboringnow</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515989/3515989_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:19:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beaconhouse School System Khyber Campus</video:title>
      <video:description>This was amazing when the energy was boosting all the time in each section</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515988/3515988_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:18:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dangdut 83</video:title>
      <video:description>dangdut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515987/3515987_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T05:18:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🪽 The Dark Angel has arrived. 💀 Death is only the beginning.</video:title>
      <video:description>🔥 ARGUS UNLEASHED! ⚔️ The Dark Angel is back on the battlefield! 😈 Watch Argus dominate the fight with insane damage, clutch moments, and an unstoppable ultimate. 💀🔥 ⚔️ Fearless fights 🔥 Massive damage 💀 Immortal moments 👑 Pure Argus domination Watch till the end and feel the power of the Dark Angel! 🪽🔥 #Gaming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515986/3515986_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T05:18:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anything Royal or Military</video:title>
      <video:description>The Prince of Wales and the Princess Royal will attend King Harald of Norways Funeral in Oslo next Wednesday</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515985/3515985_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:18:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>wleee</video:title>
      <video:description>kucinggg</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515984/3515984_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515983</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515983/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pulennn 2</video:title>
      <video:description>enakk nihhh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515983/3515983_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:17:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>86 tiktok template</video:title>
      <video:description>more templates to choose</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515982/3515982_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:17:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Idido</video:title>
      <video:description>Iriririri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515981/3515981_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:16:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Meghan Markle recently spoke out about her experiences</video:title>
      <video:description>When Meghan Markle recently spoke out about her experiences #MeghanMarkle #english</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515980/3515980_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-10-05T05:15:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Osodi</video:title>
      <video:description>Idoriro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515979/3515979_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:15:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why are Indonesians known for being laid-back?</video:title>
      <video:description>The perception of Indonesians as being &quot;laid-back&quot; stems from a fascinating blend of cultural philosophy, social structure, and climate. Rather than a lack of motivation, this demeanor is rooted in deep-seated values centered on harmony, community, and present-moment awareness. #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515978/3515978_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:15:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O que vai acontecer com Christa Pike? Mulher sobrevive a execução e gera debate sobre pena de morte</video:title>
      <video:description>O que vai acontecer com Christa Pike? Mulher sobrevive a execução e gera debate sobre pena de morte</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515977/3515977_720p.mp4</video:content_loc>
      <video:duration>477</video:duration>
      <video:publication_date>2026-10-05T05:15:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ultimate Furry Nanny: Cat Guards Sleeping Baby 🐱👶</video:title>
      <video:description>Watch this adorable moment as our protective feline refuses to leave the baby&apos;s side. From naptime monitoring to gentle supervision, this cat takes the role of &quot;big sibling&quot; very seriously. True love knows no bounds! #cat #baby #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515976/3515976_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T05:14:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>since the orchid</video:title>
      <video:description>orchid</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515975/3515975_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:14:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senja 25</video:title>
      <video:description>Senja aesthetic #Pantai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515974/3515974_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:13:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>unboxing paket anggrek Dendrobium dewasa dan knop mekar cantik</video:title>
      <video:description>anggrek unboxing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515973/3515973_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T05:13:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>85 it&apos;s me</video:title>
      <video:description>This is me.....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515972/3515972_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T05:11:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you girl&apos;s 💕😘</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515971/3515971_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:11:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GRAND MAX BALAP</video:title>
      <video:description>Joss jiss #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515970/3515970_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:11:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>moment ronaldo</video:title>
      <video:description>Cristiano Ronaldo is a famous professional football player from Portugal who is widely regarded as one of the greatest athletes of all time #football #HeightWeight #Body #Hehasanathletic #muscular #masculinebody</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515969/3515969_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Behind the beauty of the mountains lies a tragic story.</video:title>
      <video:description>Behind the beauty of the mountains lies a tragic story. #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515968/3515968_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T05:11:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515967</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515967/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>From Tiny Seed to Golden Corn 🌱🌽 | Amazing Corn Growth Time Lapse</video:title>
      <video:description>Watch a tiny corn seed transform into a tall, healthy corn plant and produce fresh corn! 🌱🌽 This satisfying time-lapse shows the incredible journey from seed to harvest. #corntimelapse #cornseedgrowth #growingcornfromseed #cornplantgrowth #corngrowing #seedtocorn #corngrowthtimelapse #growingvegetables #gardening #planttimelapse #naturetimelapse #cornharvest #satisfyingplantgrowth #agriculture #farmlife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515967/3515967_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:10:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you all 💘😘</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍😍😍😍😍😍😍😍😍🥰🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515966/3515966_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:10:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A cat is sleeping on the chair.</video:title>
      <video:description>On a hot afternoon, this cat is happily sleeping on the chair. Instead of being used for guests to sit on, the chair has been claimed by the cat for its afternoon nap.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515965/3515965_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T05:10:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Option 3: Viral Butterfly Face Filter Short 🦋 Mood Right Now!</video:title>
      <video:description>Is video me check karein bohot hi pyara aur trending butterfly face filter look! Agar aap ko ye short video achi lage toh video ko like karein, comment karke apna feedback dein aur channel ko zaroor follow karein taake mazeed aisi videos aap tak puhanch sakein. #​butterflyfilter #trendingfilterlook #cutefiltervideo #viralshort #febspotviral #funnyfiltershort #shortsvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515964/3515964_720p.mp4</video:content_loc>
      <video:duration>288</video:duration>
      <video:publication_date>2026-10-05T05:09:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The silence of the night does not mean silence forever.</video:title>
      <video:description>The silence of the night does not mean silence forever. #Sinematografi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515963/3515963_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T05:08:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Help subscribe to 1000 😁</video:title>
      <video:description>can help to 1000 subs 🤔😁😎 #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515962/3515962_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:08:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Husky puppies Falls in love kitten cat</video:title>
      <video:description>Falls in love #Husky #dog #viral #Rumble #Perfect #Febspot #kitten #kingl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515960/3515960_720p.mp4</video:content_loc>
      <video:duration>130</video:duration>
      <video:publication_date>2026-10-05T05:08:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryWithMegan#3</video:title>
      <video:description>Mantabbbb ❤️❤️ #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515959/3515959_720p.mp4</video:content_loc>
      <video:duration>1252</video:duration>
      <video:publication_date>2026-10-05T05:08:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nyoride</video:title>
      <video:description>Matahari terbenam, mesin dinyalakan. Terapi sederhana di penghujung hari. #RideR15v3</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515958/3515958_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:08:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EA SPORTS FC Mobile Gameplay on Android | Realistic Football Game ⚽🔥</video:title>
      <video:description>Watch exciting EA SPORTS FC Mobile gameplay on Android! ⚽🔥 In this video, I play a football match on mobile and showcase the gameplay, graphics, controls, and exciting goal-scoring moments. If you enjoy football games, FC Mobile, EA SPORTS FC Mobile, and Android gaming, this gameplay is for you! 👍 Like the video and follow for more mobile football gameplay. EA SPORTS FC Mobile, FC Mobile gameplay, EA FC Mobile, FC Mobile Android, football game Android, mobile football game, football gameplay, soccer game Android, Android gaming, mobile gaming, EA Sports football, FC Mobile match, FC Mobile gameplay Android, realistic football game, football games mobile #EASPORTSFCMobile #FCMobilegameplay #EAFCMobile #FCMobileAndroid #footballgameAndroid #mobilefootballgame #footballgameplay #soccergameAndroid #Androidgaming #mobilegaming #EASportsfootball #FCMobilematch #FCMobilegameplayAndroid #realisticfootballgame #footballgamesmobile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515957/3515957_720p.mp4</video:content_loc>
      <video:duration>481</video:duration>
      <video:publication_date>2026-10-05T05:08:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grimjow phantera mode game bleach</video:title>
      <video:description>#Game #gamebleach #grimjow #vidio #fyp #animebleach #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515956/3515956_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T05:07:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exam pass</video:title>
      <video:description>Exam pass #EducationPassboygairl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515955/3515955_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:07:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Refreshing Moment: Washing Hair in a Traditional Bamboo Bathroom</video:title>
      <video:description>A serene and natural scene capturing a woman gently washing her hair, lathering it with shampoo while water softly flows down her body. She stands in a charming open-air bathroom crafted from woven bamboo and wood, creating a warm, rustic atmosphere that feels close to nature. Dressed in a vibrant floral-patterned dress, she massages her scalp with both hands, surrounded by gentle streams of water and soft foam. Natural light filters through the space, enhancing the fresh, calm, and peaceful vibe of this simple yet beautiful daily routine. #Whasinghair #bathroom</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515954/3515954_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:07:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Easy to play</video:title>
      <video:description>😃😃😃</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515953/3515953_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T05:07:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cheng karate 🥋 kids 😁</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515952/3515952_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:07:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The beauty of Kora Beach, Maluku</video:title>
      <video:description>#TravelBaliJepangParis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515951/3515951_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:07:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>84 strictly for lovers only, romance!!!!!</video:title>
      <video:description>#TILLDEATH</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515950/3515950_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T05:07:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryWithMegan#2</video:title>
      <video:description>Shiip❤️❤️ #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515949/3515949_720p.mp4</video:content_loc>
      <video:duration>1697</video:duration>
      <video:publication_date>2026-10-05T05:07:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Earn money 27</video:title>
      <video:description>Have a nice day #Earn #follow</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515948/3515948_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T05:06:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI requires water to operate optimally.</video:title>
      <video:description>AI requires water to operate optimally. #AI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515947/3515947_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T05:06:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I miss you 🥺</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗😍😍😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515946/3515946_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:06:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 🤟🏻😘 bro 😘</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515945/3515945_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:05:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryWithMegan# 2</video:title>
      <video:description>Tops❤️❤️❤️ #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515944/3515944_720p.mp4</video:content_loc>
      <video:duration>1356</video:duration>
      <video:publication_date>2026-10-05T05:05:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Broken angel 💔</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515943/3515943_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T05:05:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesia Pride</video:title>
      <video:description>Beauty Landscape n Achievment Program in Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515942/3515942_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T05:04:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>$10 Food Comparison: Bangladesh vs Italy</video:title>
      <video:description>What can you buy with $10 in Bangladesh compared to Italy? From biryani, rice, fuchka and snacks to pizza, pasta, coffee and supermarket items—this video compares food prices and portions in both countries. Prices may vary depending on the city, restaurant and location. Which country offers more food for $10? Comment your opinion! #BangladeshvsItaly #10foodcomparison #foodpricescomparison #Bangladeshfoodprices #Italyfoodprices #cheapfoodinBangladesh #cheapfoodinItaly #biryani #fuchka #pizza #pasta #foodcomparisonvideo #travelcomparison #costofliving #streetfoodcomparison #internationalfoodprices #Bangladeshfood #Italianfood #budgetfoodchallenge #foodvlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515941/3515941_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T05:04:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>21966283482</video:title>
      <video:description>Kkkkkkk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515940/3515940_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T05:04:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Me dnesns</video:title>
      <video:description>Nddn</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515939/3515939_720p.mp4</video:content_loc>
      <video:duration>175</video:duration>
      <video:publication_date>2026-10-05T05:04:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A man with his pastimes</video:title>
      <video:description>A man with his pastimes #MLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515938/3515938_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T05:04:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crispy Caramel Fried Chicken with Cheese Sauce</video:title>
      <video:description>Crispy, golden-brown fried chicken coated in a sweet and savory caramel glaze, served with a rich, creamy cheese sauce. #Crispy #golden-brown #friedchicken #sweet #savory #caramel #glaze #rich #creamy #cheese #sauce</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515937/3515937_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T05:04:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>কপি  চা আড্ডা</video:title>
      <video:description>কপিচা আড্ডা</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515936/3515936_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T05:03:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alien Tries Earth Candy For The First Time!</video:title>
      <video:description>This cute little alien got lost on Earth and found the ultimate superpower: CANDY! Watch what happens when he experiences a sugar rush for the first time. 🚀 #alien #boy #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515935/3515935_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T05:03:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryWithMegan#</video:title>
      <video:description>❤️❤️❤️👍👍💯💯💯 #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515934/3515934_720p.mp4</video:content_loc>
      <video:duration>1375</video:duration>
      <video:publication_date>2026-10-05T05:03:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belum makeup aja udah cantik #marshajkt48 #jkt48</video:title>
      <video:description>Belum makeup aja udah cantik #marshajkt48 #jkt48</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515933/3515933_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:03:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Citambur Waterfall, South Cianjur</video:title>
      <video:description>Curug citambur cianjur selatan #Travel #tourism #indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515932/3515932_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T05:02:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Open mic oyet</video:title>
      <video:description>Onyet open mic aing datang make sandal, Balik make tawakal #Stanupcomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515931/3515931_720p.mp4</video:content_loc>
      <video:duration>115</video:duration>
      <video:publication_date>2026-10-05T05:02:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DongYi EP (8)</video:title>
      <video:description>سریال افسانه دونگی دوبله فارسی بدون سانسور قسمت هشتم #سریال</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515930/3515930_720p.mp4</video:content_loc>
      <video:duration>3781</video:duration>
      <video:publication_date>2026-10-05T05:01:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>crocodile grabs womans towel😰</video:title>
      <video:description>#foryou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515929/3515929_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:01:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Only you know my mind</video:title>
      <video:description>May God hold you so tightly that He heals what you don’t talk about with anyone, because there are pains that words can’t reach, wounds so deep that only God knows them in the silence of your heart, where not even your loved ones can go. He is there; you don’t need to explain anything to Him, He already knows it all and still loves you without limit. His embrace is not physical, but it wraps your soul in peace, comfort, and hope. Sometimes we think we have to look strong on the outside. #Motivation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515928/3515928_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T04:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WHOOSH HIGH SPEED TRAIN IN INDONESIA</video:title>
      <video:description>Modern Transportation in Indonesia #Travel #Train #City #Jakarta #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515927/3515927_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T04:58:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita da vovó Marta rocha Tradicional</video:title>
      <video:description>🍰 Bolo Marta Rocha Tradicional – Receitas da Vovó Uma receita clássica e irresistível! O tradicional Bolo Marta Rocha reúne camadas macias, creme, ovos, ameixas, merengue e crocantes em uma combinação deliciosa que conquista toda a família. ❤️ 👵 Receitas da Vovó: sabor, carinho e tradição em cada receita! 👉 Confira a receita completa no blog: marcelommq.blogspot.com #Bolo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515926/3515926_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:58:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Omur Usta - Episode 2 (English Subtitles)</video:title>
      <video:description>a story of family ties, betrayal, love, class conflict, and second chances, follows a woman who, despite the wounds life has left her with, finds the strength to hold on, reclaim her life, and rediscover the light within herself. This is, Omur Usta (Master Omur). #omurustaepisode2 #omurustaepisode2englishsubtitles #omurustaepisode2withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515925/3515925_720p.mp4</video:content_loc>
      <video:duration>7812</video:duration>
      <video:publication_date>2026-10-05T04:58:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Takdir Terbaikmu Nanti.</video:title>
      <video:description>#shortislami #selfreminder #hikmahkehidupan #tawakal #albaqarah216</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515924/3515924_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T04:56:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DongYi EP (7)</video:title>
      <video:description>سریال افسانه دونگی دوبله فارسی بدون سانسور قسمت هفتم #سریال</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515923/3515923_720p.mp4</video:content_loc>
      <video:duration>3750</video:duration>
      <video:publication_date>2026-10-05T04:56:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>مسلمان سائنسدان کا بتائیں جنہوں نے پہلی بار اڑنے کا تجربہ کیا</video:title>
      <video:description>اس مسلمان سائنسدان کا بتائیں جنہوں نے پہلی بار اڑنے کا تجربہ کیا؟ #reelsviralシ #shorts #foryou #solangibhai786</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515922/3515922_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T04:56:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jejdj</video:title>
      <video:description>Jrkrrk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515921/3515921_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T04:56:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sedih 7</video:title>
      <video:description>Kalau nonton india pasti nangis, walaupun sudah ditonton berulang ulang kali #Nonton</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515920/3515920_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T04:56:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ieidk</video:title>
      <video:description>Ejjdjd</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515919/3515919_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T04:55:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>soft orange sponge cake</video:title>
      <video:description>This soft orange sponge cake features a wonderfully light, cotton-like texture that melts in your mouth. Infused with fresh orange juice and fragrant citrus zest, it delivers a delightful balance of sweet and tangy flavors. The aroma of fresh citrus fills the air as you slice into the golden crumb, making it a comforting and refreshing treat to enjoy with tea or coffee #soft #orange #sponge #cake #aroma #coffe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515918/3515918_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T04:55:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>In front of the airport</video:title>
      <video:description>In front of the airport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515917/3515917_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T04:55:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bahtera nabi nuh di temukan</video:title>
      <video:description>apakah benar ini kapal nabi nuh ? 🤔 coba di komen ges #kapalnabinuh #viral #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515916/3515916_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T04:54:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você viu Essa: Robôs humanoides auxiliam em tarefas domésticas nos EUA</video:title>
      <video:description>Você viu Essa: Robôs humanoides auxiliam em tarefas domésticas nos EUA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515915/3515915_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-05T04:54:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Calm Lake Water Reflection &amp; Lush Green Hills Aerial View</video:title>
      <video:description>Enjoy peaceful aerial views of calm lake waters reflecting the sunlight, surrounded by lush green mountains and a cozy lakeside dock. Perfect for relaxation and nature vibes! #SereneLake #LakeReflection #MountainView #DroneFootage #PeacefulNature #AerialView #LakesideDock #NatureRelaxation #ScenicLandscape #CalmWater #CinematicDrone #TravelInspiration #GreenHills</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515914/3515914_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T04:54:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JAKARTA CITY LIGHT</video:title>
      <video:description>Modern Metropolitan Jakarta Indonesia #Travel #City #Citylight #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515913/3515913_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T04:52:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bermain Mobil MBG</video:title>
      <video:description>Mainan fisik berupa truk atau mobil box pengantar MBG yang melaju dengan sistem friction (tarik-dorong/putar roda) tanpa baterai #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515912/3515912_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T04:52:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Village house with waterfull view</video:title>
      <video:description>nature, village house, tourism #Travel #indonesia #cianjur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515911/3515911_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:51:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT FOR THE END (Off-target)</video:title>
      <video:description>Off-target #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515910/3515910_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T04:51:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bom dia 33</video:title>
      <video:description>☀️ BOM DIA! 🌻 E se hoje fosse o dia de começar algo novo? ✨ Deixe para trás o que pesa no coração e abra espaço para coisas boas. Que seu dia seja cheio de paz, alegria, saúde e muitas bênçãos! 🙏❤️ 🌟 Gancho: Não deixe passar o dia sem acreditar que algo maravilhoso pode acontecer! Tenha um excelente dia! 🌷 #Bomdia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515909/3515909_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:50:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Secret Behind Giraffes&apos; Long Necks</video:title>
      <video:description>The Secret Behind Giraffes&apos; Long Necks Have you ever wondered why giraffes have such incredibly long necks? It is not just to look taller—their long necks help them reach leaves high up in trees that other animals cannot reach! Watch this video to learn about giraffe evolution, how they pump blood all the way up to their huge brains, and the amazing adaptations of nature. Don&apos;t forget to like and subscribe! #GiraffeWildlifeAnimalFactsNatureWildAnimalsEvolutionAnimalAnatomyWildlifeDocumentary</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515908/3515908_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T04:50:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DongYi EP (6)</video:title>
      <video:description>سریال افسانه دونگی دوبله فارسی بدون سانسور قسمت ششم #سریال</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515907/3515907_720p.mp4</video:content_loc>
      <video:duration>3739</video:duration>
      <video:publication_date>2026-10-05T04:49:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nilailah aku sesuka hatimu</video:title>
      <video:description>sad #sad #story #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515906/3515906_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:49:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video ini menjelaskan bahwa orang licik tampak ramah</video:title>
      <video:description>Tepat sekali — orang licik yang tampak ramah justru yang paling sulit dikenali, karena kebaikan mereka hanyalah topeng. 🔎 Ciri Khas: Ramah tapi Licik - 🤠 Sangat manis bicara, memuji berlebihan, seolah-olah paling peduli padahal tidak tulus - 🎯 Selalu ada tujuannya — ramah hanya saat butuh sesuatu; hilang/berubah setelah dapat keuntungan - 🧩 Pura-pura bersimpati, diam-diam mencari celah atau informasi untuk keuntungannya sendiri - ⚖️ Tampak memihak padamu, tapi di belakang bisa mengubah cerita agar dirinya yang aman - 🧵 Halus menyusun rencana, seolah kesalahan terjadi &quot;kebetulan&quot;, padahal dia yang mengatur - 🤝 Menawarkan bantuan dengan cepat, tapi nanti &quot;menagih jasa&quot; dengan beban yang tidak adil ⚡ Bedanya Ramah Tulus vs Licik Tabel Ramah Tulus Ramah tapi Licik Konsisten di depan &amp; belakang Berubah saat kamu tidak melihat Memberi tanpa mengharap imbalan Setiap kebaikan ada &quot;harganya&quot; Jujur walau menegur Memuji lalu menusuk dari belakang Menerima apa adanya Menyesuaikan diri sesuai kebutuhan 🛡️ Cara Melindungi Diri 1. Jangan terburu-buru percaya — lihat tindakan jangka panjang, bukan kata-kata manis yang sekejap 2. Jaga rahasia — jangan buka semua kehidupan pribadi pada orang yang baru dikenal atau terlalu manis tiba-tiba 3. Perhatikan motifnya — tanya dalam hati: &quot;Kenapa dia begitu baik padaku tiba-tiba?&quot; 4. Amati perlakuan ke orang lain — cara dia berbicara soal orang lain, begitulah dia berbicara soal kamu 5. Tetap sopan tapi jaga jarak — tidak perlu bermusuhan, cukup tidak terlalu dekat &amp; tidak mudah terikat janji manis 6. Jangan balas dengan cara sama — tetap jujur, itu perlindungan terbaik bagi dirimu sendiri #Orangliciktampakramah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515905/3515905_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:48:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#21 🚑 NOCAUTE EXTREMO EM SEGUNDOS! ELE SAIU DIRETO PRA MACA! _ EA Sports</video:title>
      <video:description>🎮 12.000 JOGOS EM UM MINI FLIPERAMA DE 10 POLEGADAS! LINK DOU PRODUTO: https://s.shopee.com.br/6VO5xg9JbB Essa luta acabou antes mesmo de começar! 😱 Um golpe certeiro e o adversário foi direto pro chão, sem chances de recuperação! Foi um dos nocautes mais rápidos que já vi! Será que você consegue superar esse tempo? ⏳🔥 📢 Deixa o like, comenta o que achou desse KO INSANO e se inscreve no canal para mais lutas épicas! 🎮👊 #MMA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515904/3515904_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-10-05T04:47:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#CriminalStoryWomenCrazy#</video:title>
      <video:description>Ngeribangett #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515903/3515903_720p.mp4</video:content_loc>
      <video:duration>780</video:duration>
      <video:publication_date>2026-10-05T04:47:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral.. Rocky Gerung</video:title>
      <video:description>Dulu katanya jika waktunya datang dia menolak mentah mentah, eh giliran beneran datang tidakada alasan untuk menolak #indonesiapolitikrockygerungprabowogibran</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515902/3515902_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T04:46:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aliens and humans are friends</video:title>
      <video:description>A very rare friendship between aliens and humans #alien #man #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515901/3515901_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:46:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Simple trigger mechanism slingshot</video:title>
      <video:description>Simple trigger mechanism slingshot, how to make slingshot, DIY bamboo slingshots #Slingshot #DIY #trigger #craft</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515900/3515900_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T04:45:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>asmr Bag make up mermaid</video:title>
      <video:description>Asmr bag make-up #Asmr #asmrrelaxing #asmrbag #relaxingsatisfying #relaxingsound #relaxingsatisfyingsound #ambiensound #asmr2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515899/3515899_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:45:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bigg Boss season 20 episode 28. Day 27.Salman Demands Honest Answers.720p</video:title>
      <video:description>Bigg Boss season 20 episode 28. Day 27.Salman Demands Honest Answers.720p.Salman Speak a Borong episode. Please subscribe kar lo mujhe to more videos. #Jiohotstar #Febspot.com ❤️Subscribe. #IndiaandAmerica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515898/3515898_720p.mp4</video:content_loc>
      <video:duration>2146</video:duration>
      <video:publication_date>2026-10-05T04:43:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Free sightseeing with no ticket required</video:title>
      <video:description>Free sightseeing with no ticket required cianjur selatan #Travel #wisata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515897/3515897_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T04:41:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tiger woman</video:title>
      <video:description>dance swimming #beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515896/3515896_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T04:40:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachueiras Mais Bonitas do Brasil</video:title>
      <video:description>As cachoeiras são verdadeiros espetáculos da natureza, cercadas por paisagens exuberantes, florestas, pedras e águas cristalinas. Elas são destinos perfeitos para quem busca tranquilidade, aventura e contato com a natureza. Além da beleza das quedas d’água, muitas cachoeiras oferecem piscinas naturais ideais para se refrescar e momentos incríveis para fotografar. Cada lugar possui características únicas, tornando a experiência especial para viajantes, famílias e amantes da natureza. #Viajem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515895/3515895_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:40:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing Cucumber Time Lapse</video:title>
      <video:description>Watch a tiny cucumber seed grow into a healthy green vine and produce fresh cucumbers! 🥒🌱 This satisfying time-lapse captures the amazing journey from seed to harvest. #cucumbertimelapse #cucumberseedgrowth #growingcucumberfromseed #cucumberplantgrowth #cucumbergrowing #seedtocucumber #plantgrowthtimelapse #vegetablegrowing #gardening #cucumberplant #growingvegetables #naturetimelapse #satisfyingplantgrowth #garden #harvest</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515894/3515894_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DongYi EP (5)</video:title>
      <video:description>سریال افسانه دونگی دوبله فارسی بدون سانسور قسمت پنجم #سریال</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515893/3515893_720p.mp4</video:content_loc>
      <video:duration>3821</video:duration>
      <video:publication_date>2026-10-05T04:39:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A chicken and a cat are friends</video:title>
      <video:description>The worlds of chickens and cats are different, yet they are always friends. #cat #chiken #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515892/3515892_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T04:39:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senja aesthetic</video:title>
      <video:description>Hanya video hiburan #senja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515891/3515891_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:39:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT FOR END 7</video:title>
      <video:description>It turns out he is a shapeshifting cat. #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515890/3515890_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T04:38:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main skuisi</video:title>
      <video:description>Main pasir di pantai sambil main skuisi #permainan #skuisi #anak #pantai #pasir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515889/3515889_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T04:38:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryfromUK#</video:title>
      <video:description>Ngeriiiahhhh #Chinde900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515888/3515888_720p.mp4</video:content_loc>
      <video:duration>1550</video:duration>
      <video:publication_date>2026-10-05T04:36:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>soft ball cake</video:title>
      <video:description>Soft ball cake is a delightful bite-sized snack with a round shape. It has a very soft, fluffy, and moist texture that feels light in the mouth. Made from basic ingredients like flour, sugar, eggs, and milk, this cake offers a gentle, sweet taste with a comforting buttery or vanilla aroma. It is usually baked or steamed, making it a perfect, melt-in-your-mouth treat to enjoy with a cup of tea or coffee. #soft #ball #cake #fluffy #texture #vanilla #aroma #enjoy #coffe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515887/3515887_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-05T04:36:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night marker</video:title>
      <video:description>Indonesia’s night market is full of lights, food, games, and fun. Many people come with their families to enjoy delicious street food, colorful rides, and a lively atmosphere. #Nightmarket #lively</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515886/3515886_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T04:36:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pulau naga</video:title>
      <video:description>Pulau naga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515885/3515885_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:35:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>De R$ 30 a R$ 30.000: turista pega táxi em São Paulo e motorista cobra três zeros a mais</video:title>
      <video:description>De R$ 30 a R$ 30.000: turista pega táxi em São Paulo e motorista cobra três zeros a mais</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515884/3515884_720p.mp4</video:content_loc>
      <video:duration>504</video:duration>
      <video:publication_date>2026-10-05T04:35:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautiful scenery 12</video:title>
      <video:description>#foryou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515883/3515883_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:35:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagi santaii</video:title>
      <video:description>Selamat pagi #uwuo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515882/3515882_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T04:34:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonésia</video:title>
      <video:description>Arquipélago da Indonésia 🌴🌊 A Indonésia é um dos destinos mais fascinantes do mundo, formado por milhares de ilhas com praias paradisíacas, florestas tropicais, vulcões, cultura rica e uma biodiversidade impressionante. Entre os lugares mais conhecidos estão Bali, Java, Sumatra, Lombok e as ilhas de Komodo. Um verdadeiro paraíso para quem ama natureza, aventura, praias e paisagens inesquecíveis. #Viajem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515881/3515881_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T04:34:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy day 16</video:title>
      <video:description>Happy day #Mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515880/3515880_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T04:34:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bukan sekedar hobi</video:title>
      <video:description>Pelan pelan satu kunci dalam satu waktu #Hobiyangakansayakuasai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515879/3515879_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T04:34:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>win coy</video:title>
      <video:description>mlbb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515878/3515878_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T04:33:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cute cat 64</video:title>
      <video:description>#cat #cute #viral #car #animal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515877/3515877_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T04:33:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Person Who Destroyed Your Confidence Did It on Purpose</video:title>
      <video:description>There is a specific kind of damage that does not look like damage from the outside. It does not leave visible marks. It arrives through comments disguised as jokes. Through comparisons delivered as concern. Through criticism wrapped in the language of help. And through a consistent patient systematic dismantling of your belief in yourself that happened so gradually you did not notice it was happening. Until one day you could not remember the last time you felt capable. Confident. Worthy of taking up space. In this video we expose the full psychology of covert confidence destruction. We cover exactly how confidence gets destroyed gradually through deniable incremental damage. Why you were chosen specifically — and why the qualities that made you a target are the same qualities that make you capable of genuine depth and care. The four specific tactics used in almost every case of covert confidence destruction. And what it actually takes to rebuild confidence that was deliberately dismantled rather than simply never developed. If you have ever wondered why your self doubt feels like it came from nowhere — this video is going to show you exactly where it came from. If you have ever felt like you used to be more confident and cannot explain what changed — this video is for you. If there is a voice in your head that sounds like yours but tears you down before you have even tried — this video is going to show you whose voice it actually is. Your confidence was not lost. It was taken. And this video is the beginning of taking it back. 🔔 Subscribe for weekly psychology that goes this deep into what makes us human. 💬 Drop a comment — what is the specific thing someone said or did that you now recognise was designed to make you doubt yourself? Just describe the moment. #Psychology</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515876/3515876_720p.mp4</video:content_loc>
      <video:duration>433</video:duration>
      <video:publication_date>2026-10-05T04:32:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Small Donation Could Change His Day</video:title>
      <video:description>He is all alone, trying to make a living by selling used items. If you would like to help or make a donation, you can send it through PayPal. Every donation, no matter how small, can make a difference. I will create content and show you the moment when I deliver the donations from all of you directly to him. Thank you for your kindness and support. ❤️ paypal.me/Tuminaalfian #donate</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515875/3515875_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:32:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cincu Hijau Daun Murni</video:title>
      <video:description>Jika temen-temen punya keluhan panas dalam, radang tenggorokan. Salah satu solusinya ya Ini Cincau Hijau Daun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515874/3515874_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T04:31:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌸 Grace &amp; Serenity — Whispers of the Heart 🪷</video:title>
      <video:description>Three gentle moments of peace and beauty. Holding fresh pink lotuses in the morning light, resting beside a bamboo flute, and sitting quietly in a blooming garden. Soft pastels, blooming flowers, and a peaceful smile — where nature meets timeless grace. 🌿💫 #SerenityLotusLoveGracefulBeautyNatureMagicPeacefulMomentsPastelDreamsGardenBloomDivineBeautyTimelessElegancePureHeart</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515873/3515873_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T04:30:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hospital 6</video:title>
      <video:description>Santai enjoy #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515872/3515872_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T04:30:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main gitar 7</video:title>
      <video:description>Melodilagu #uwuo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515871/3515871_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-10-05T04:29:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Living Room Transformation with a Stunning 3D Epoxy River Floor 😱</video:title>
      <video:description>Watch this incredible living room transformation! A simple room is completely upgraded with a stunning 3D epoxy floor featuring a realistic river illusion. The final result looks absolutely amazing and mesmerizing! 🤯🔥 #3Depoxyfloor #epoxyriverfloor #3Dfloordesign #livingroomrenovation #livingroommakeover #epoxyflooring #realistic3Dfloor #riverillusionfloor #modernlivingroom #luxuryinterior #homerenovation #interiordesign #floortransformation #amazingfloor #satisfyingtransformation #modernhome #stunningrenovation #viralrenovation #homemakeover #3Dinteriordesign</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515870/3515870_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T04:29:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita da vovó bolo Musse de chocolate</video:title>
      <video:description>🍫 Receitas da Vovó – Bolo Mousse de Chocolate Uma receita irresistível para quem ama chocolate! O Bolo Mousse de Chocolate combina uma massa fofinha com um recheio cremoso e uma cobertura deliciosa. Perfeito para aniversários, sobremesas especiais ou para aquele café da tarde em família. Aprenda o passo a passo e descubra outras receitas deliciosas no nosso blog Receitas da Vovó. 👉 Acesse: marcelommq.blogspot.com #Bolo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515869/3515869_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T04:29:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oscar for BEST drama</video:title>
      <video:description>Animal funniest #Animal #funniest #Oscar #TheBEST #viral #drama #Febspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515868/3515868_720p.mp4</video:content_loc>
      <video:duration>110</video:duration>
      <video:publication_date>2026-10-05T04:28:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>সকালে এই জিকির ১০০ বার পড়লে কী হয়</video:title>
      <video:description>সকালে এই জিকির ১০০ বার পড়লে কী হয় | Islamic Shorts #shorts #tranding সকালে ১০০ বার জিকির, লা ইলাহা ইল্লাল্লাহ ১০০ বার, লা ইলাহা ইল্লাল্লাহ ফজিলত, সকালে জিকিরের ফজিলত, ১০০ বার জিকিরের ফজিলত, ১০০ নেকির আমল, ১০০ গুনাহ মাফ, শয়তান থেকে হেফাজতের আমল, শয়তান থেকে বাঁচার আমল, তাওহিদের জিকির, কালিমার ফজিলত, গুরুত্বপূর্ণ জিকির, সকালের আমল, সকালবেলার আমল, প্রতিদিনের আমল, সহিহ হাদিসের আমল, হাদিসের ফজিলত, ইসলামিক আমল বাংলা, ইসলামিক জিকির বাংলা, ইসলামিক শর্টস বাংলা, বাংলা ইসলামিক ভিডিও, La ilaha illallah 100 times, La ilaha illallah benefits, morning dhikr, morning adhkar, Islamic reminder Bangla, Islamic Shorts Bangla, Hadith Bangla #সকালে১০০বারজিকির #লাইলাহাইল্লাল্লাহ১০০বার #লাইলাহাইল্লাল্লাহফজিলত #সকালেজিকিরেরফজিলত #১০০বারজিকিরেরফজিলত #১০০নেকিরআমল #১০০গুনাহমাফ #শয়তানথেকেহেফাজতেরআমল #শয়তানথেকেবাঁচারআমল #তাওহিদেরজিকির #কালিমারফজিলত #গুরুত্বপূর্ণজিকির #সকালেরআমল #সকালবেলারআমল #প্রতিদিনেরআমল #সহিহহাদিসেরআমল #হাদিসেরফজিলত #ইসলামিকআমলবাংলা #ইসলামিকজিকিরবাংলা #ইসলামিকশর্টসবাংলা #বাংলাইসলামিকভিডিও #Lailahaillallah100times #Lailahaillallahbenefits #morningdhikr #morningadhkar #IslamicreminderBangla #IslamicShortsBangla #HadithBangla</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515867/3515867_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T04:28:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStory❤️#</video:title>
      <video:description>BagusCeritanya #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515865/3515865_720p.mp4</video:content_loc>
      <video:duration>823</video:duration>
      <video:publication_date>2026-10-05T04:27:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A train passes by</video:title>
      <video:description>The scene of a train passing along a road amidst heavy traffic on two intercity routes created a unique moment where these events coincided. #train</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515864/3515864_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T04:26:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crab Mentality</video:title>
      <video:description>The behavior of crabs pulling each other back or hindering one another when one tries to climb out of a bucket is known as &quot;Crab Mentality.&quot; #crab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515863/3515863_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T04:26:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>খেলনার দোকান</video:title>
      <video:description>খেলনার দোকান</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515862/3515862_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T04:26:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fresh fish sushi</video:title>
      <video:description>Fresh fish sushi is a traditional Japanese dish consisting of seasoned vinegared rice topped or rolled with high-quality, raw, or cooked fresh seafood #Fresh #fish #sushi #traditional #Japanese #dishconsisting #seasoned #vinegared #rice #toppedorrolled #high-quality #raw #cooked #seafood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515861/3515861_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T04:25:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#capcut #tiktok #douyin #ootd #affiliate #fbpro</video:title>
      <video:description>#Capcut #tiktok #douyin #ootd #affiliate #fbpro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515860/3515860_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T04:23:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wisata di gunung</video:title>
      <video:description>Berwisata di lereng gunung sambil makan nasi bakar #perjalanan #wisata #pegunungan #makan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515859/3515859_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:22:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carmen</video:title>
      <video:description>Carmenita so prety #Carmen #h2h #carmenita</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515858/3515858_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:22:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nasi kotak part2</video:title>
      <video:description>Chicken in Peanut Coconut SauceTender chicken pieces simmered in a rich, savory, and aromatic sauce made from blended peanuts, creamy coconut milk, and traditional Indonesian spices. #Makanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515857/3515857_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T04:22:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UNABOMBER 2026</video:title>
      <video:description>UNABOMBER 2026 #runner #trending #mustwatch #viral #fyp #viraltoday #2026movies #therage #THEUPRISING #TRUESTORY #TRUEEVENTS #UNABOMBER</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515856/3515856_720p.mp4</video:content_loc>
      <video:duration>6006</video:duration>
      <video:publication_date>2026-10-05T04:22:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fight doubts, banish negative thoughts, realize that fatigue is natural but giving up is a choice, a</video:title>
      <video:description>Fight doubts, banish negative thoughts, realize that fatigue is natural but giving up is a choice, and focus on being the best #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515855/3515855_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:21:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>olahraga gym</video:title>
      <video:description>membentuk badan dengan olahraga gym #gym</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515854/3515854_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T04:21:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita da vovó Charlotte</video:title>
      <video:description>🍰 Receitas da Vovó – Sabores que lembram momentos especiais Bem-vindo ao Receitas da Vovó, um cantinho especial para quem ama cozinhar e descobrir receitas deliciosas! Aqui você encontra receitas caseiras, bolos, doces, sobremesas, tortas, salgados, pães e muitas outras delícias que fazem parte da nossa cozinha. Nosso objetivo é trazer receitas práticas, saborosas e fáceis de preparar, inspiradas naquele gostinho especial da comida feita com carinho pela vovó. ❤️ Acompanhe nossas novidades, aprenda novas receitas e surpreenda sua família e seus amigos com pratos incríveis. 👉 Acesse o blog: marcelommq.blogspot.com #Bolo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515853/3515853_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:21:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skating lessons</video:title>
      <video:description>The video is about children having fun while enjoying the skating lesson #Skateforfun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515852/3515852_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T04:21:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing Tomato Time Lapse</video:title>
      <video:description>Watch a tiny tomato seed grow into a beautiful green plant and produce fresh, juicy tomatoes! #tomatotimelapse #tomatoseedgrowth #growingtomatoes #tomatoplantgrowth #tomatofromseed #seedtotomato #plantgrowthtimelapse #gardening #growingvegetables #tomatogrowing #naturetimelapse #satisfyingplantgrowth #garden #harvest #tomatoplant</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515851/3515851_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:20:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Candice cantip skil game bleach</video:title>
      <video:description>#Gamebleach #Candicecantip #fyp #game #vidio #view</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515850/3515850_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T04:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;JANGAN ABAIKAN! Lakukan Hal Ini Jika Kamu Gak Sengaja Nabrak Kucing Di Jalan...&quot;</video:title>
      <video:description>Mitos lokal percaya menabrak kucing bisa mendatangkan sial, kuncinya kamu harus segera menguburnya dengan layak, bahkan disarankan membungkusnya pakai baju yang kamu pakai. Kamu sendiri percaya gak sama mitos ini?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515849/3515849_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T04:18:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>enjoy it’s moment</video:title>
      <video:description>True happiness is being surrounded by good friends and sharing unforgettable moments together #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515848/3515848_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T04:17:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vendez vos entrées Facilement _ Stratégie Étudiante Gagnante</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #vendezentréesfacilementstratégieétudiantegagnante</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515847/3515847_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T04:16:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>83 art4of5</video:title>
      <video:description>Female art template</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515846/3515846_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T04:15:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uk Movie Film 🇱🇷🇺🇸</video:title>
      <video:description>BalliBotMogis #TrendingReels #FYP #ViralTikTok #MillionViews #TechMagic #SmartBot #AITrend #RobotViUK MOVIES 🇬🇧 #FypmoviefilmFilmerklärungUKMOVIES🇬🇧furyoufllowmeBalliBotMogisTrendingReelsFYPViralTikTokMillionViewsTechMagicSmartBotAITrendRobotVi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515845/3515845_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T04:15:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cute nuyy</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515844/3515844_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T04:15:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>82 art3of5</video:title>
      <video:description>Female art template</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515843/3515843_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:14:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Top USA Movie 🇱🇷🇺🇸</video:title>
      <video:description>BalliBotMogis #TrendingReels #FYP #ViralTikTok #MillionViews #TechMagic #SmartBot #AITrend #RobotVi #USA #Uk #BalliBotMogisTrendingReelsFYPViralTikTokMillionViewsTechMagicSmartBotAITrendRobotViUKMOVIES🇬🇧furyoufllowme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515842/3515842_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-10-05T04:14:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bohay 2</video:title>
      <video:description>dance bohay #foryouIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515841/3515841_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T04:14:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vente de Luxe _ 108k€ en 2 mois avec Vinted</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #venteluxe108k€2moisvinted</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515840/3515840_720p.mp4</video:content_loc>
      <video:duration>122</video:duration>
      <video:publication_date>2026-10-05T04:14:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mountain 10</video:title>
      <video:description>sarangan lake, magetan, east java #traveller</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515839/3515839_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T04:14:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>81 art2of5</video:title>
      <video:description>female art template</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515838/3515838_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:13:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌺 இன்றைய அம்மன் ல்லியமான ராசி பலன் இன்று</video:title>
      <video:description>🌺 இன்றைய அம்மன் அருள்வாக்கு &amp; துல்லியமான ராசி பலன் இன்று 05-10-2026 | திங்கட்கிழமை புரட்டாசி 19</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515837/3515837_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T04:12:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>80 ART1OF5</video:title>
      <video:description>female paint template</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515836/3515836_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:12:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UK MOVIES 🇬🇧 #furyou #fllowme</video:title>
      <video:description>UK MOVIES 🇬🇧 #UKMOVIES🇬🇧furyoufllowmeFypmoviefilmFilmerklärungBalliBotMogisTrendingReelsFYPViralTikTokMillionViewsTechMagicSmartBotAITrendRobotVi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515835/3515835_720p.mp4</video:content_loc>
      <video:duration>472</video:duration>
      <video:publication_date>2026-10-05T04:12:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prety birtd</video:title>
      <video:description>#Aividio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515834/3515834_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T04:12:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nice place in my life is a beach</video:title>
      <video:description>The beach is where I feel most at peace. The sound of the waves calms my mind, and the ocean brings a sense of tranquility to my soul. #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515833/3515833_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T04:11:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YouTube _ La Stratégie Gagnante pour des Résultats Durables</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #YouTubestratégiegagnanterésultatsdurables</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515832/3515832_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T04:10:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata mutiara 35</video:title>
      <video:description>Manusia bermuka dua = orang yang menampilkan dua sikap berbeda: manis/baik di depan, buruk/mencela di belakang . 📖 Arti - KBBI: tidak jujur, munafik, tidak konsisten - Satu wajah di depanmu, wajah lain di belakangmu; kata tidak sejalan dengan perbuatan 🔍 Ciri-ciri - Ramah &amp; memuji di depan, menyebarkan gosip/menjelekkan di belakang - Sikap berubah-ubah tergantung siapa yang dihadapi - Suka mengadu domba &amp; memanfaatkan orang lain - Janji mudah diucap tapi sering diingkari - Pura-pura netral padahal punya kepentingan pribadi ❓ Penyebab - Ingin diterima semua pihak / takut kehilangan keuntungan - Kurang percaya diri, menutupi diri aslinya - Cinta pujian &amp; kedudukan, ingin menang sendiri ⚠️ Dampak - Merusak kepercayaan, menimbulkan konflik &amp; perselisihan - Dalam ajaran agama termasuk sifat tercela (dzul wajhain) 🛡️ Cara Menghadapi - Tetap tenang, jangan ikut terlibat gosip - Batasi informasi pribadi, jaga jarak - Percaya pada tindakan, bukan sekadar kata-kata manis - Tetap jujur &amp; konsisten pada diri sendiri #Manusiabermukadua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515831/3515831_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T04:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chilli 2</video:title>
      <video:description>Agriculture of Chilli in somewhere of Sleman Yogyakarta #AgricultureChilli</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515830/3515830_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T04:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cute doll cake</video:title>
      <video:description>This is an adorable 3D teddy bear cake that looks just like a real plush toy. The cake is covered in rich chocolate buttercream, piped intricately with a grass tip to create a realistic, fluffy fur texture. It features cute round ears, dark glossy eyes made of fondant, and a small black nose. To add a festive touch, the bear is wearing a bright red fondant bowtie around its neck. It is almost too cute to eat and perfect for a child&apos;s birthday celebration. #cute #doll #cake #Character</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515829/3515829_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T04:09:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautifull kids watching tv</video:title>
      <video:description>beautifull kid girl watching tv,memories me,together with me in my life</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515828/3515828_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:09:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ataque com machado e heroísmo: o que se sabe sobre voo da Flydubai</video:title>
      <video:description>Ataque com machado e heroísmo: o que se sabe sobre voo da Flydubai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515827/3515827_720p.mp4</video:content_loc>
      <video:duration>467</video:duration>
      <video:publication_date>2026-10-05T04:08:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He intended to surprise his wife</video:title>
      <video:description>He intended to surprise his wife, but it backfired on him just look at his expression. #FunnyVideos #Comedy #Hilarious #Humor #MemesDaily #LaughOutLoud #JustForFun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515826/3515826_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T04:08:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagnez de l&apos;Argent Facilement_ Méthode Révolutionnaire!</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #gagnezlArgentfacilementméthoderévolutionnaire</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515825/3515825_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:08:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kraras river viqueque</video:title>
      <video:description>Kraras river viqueque #Kraras #viqueque #sand #river #timorleste</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515824/3515824_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T04:07:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagnez de l&apos;argent avec 0€ _ La méthode de mon ex</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #gagnezlargentméthodemonex</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515823/3515823_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:06:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing 🐱 2</video:title>
      <video:description>Kucing kabur #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515822/3515822_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T04:06:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagner de l&apos;argent facile _ Organiser des soirées étudiantes</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #gagnerlargentfacileorganisersoiréesétudiantes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515821/3515821_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T04:05:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kodok 2</video:title>
      <video:description>Kodok dan buaya #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515820/3515820_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:05:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fresh fruit cake</video:title>
      <video:description>English Fruit Cake is a kind of cake that is typical and famous from England. This cake is made of dough filled with various kinds of dried fruit, such as raisins, currants, cherries, apricots, and dried orange peels. This cake combines sweet and savory flavors with the delicacy of dry fruits, creating an indulgent and delightful experience. #fresh #fruit #cake #Topping #Garnish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515819/3515819_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T04:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hopes 3</video:title>
      <video:description>Your mind, mapping and all about yourself #mecca</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515818/3515818_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T04:04:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>paddy field art</video:title>
      <video:description>An unusual sight unfolded as a drone flew over the rice fields, revealing a form of line art resembling a labyrinthine painting. #greennature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515817/3515817_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:04:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata mutiara 34</video:title>
      <video:description>Video ini seseorang yang di manfaatkan oleh orang yang pernah Kita tolong #Musuhyangpalingmenyakitkanadalah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515816/3515816_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T04:03:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Al qur&apos;an surah Al Insyirah. Alam nashroh.</video:title>
      <video:description>Al qur&apos;an surah Al Insyirah. Alam nashroh. #Alquran #surahAlInsyirah #Alamnashroh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515815/3515815_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T04:03:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 7</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515814/3515814_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T04:02:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fish Farming 2</video:title>
      <video:description>Fish Farming Tilapia farming has become popular among local residents because it can boost the local economy. #FishFarmingTilapia #People #indonesia #world</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515813/3515813_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T04:02:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagner 2000€_mois pendant tes études _ 9 méthodes prouvées !</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #gagner2000€pendantétudes9méthodesprouvées</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515812/3515812_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T04:01:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Videos 57 2</video:title>
      <video:description>Videos 57 #Videos57</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515811/3515811_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:01:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Discord pour Créateurs _ Boostez Votre Communauté et Ventes !</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #discordcréateursboostezvotrecommunautéventes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515810/3515810_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T04:00:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>THE UPRISING</video:title>
      <video:description>#runner #trending #mustwatch #viral #fyp #viraltoday #2026movies #therage #THEUPRISING #TRUESTORY #TRUEEVENTS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515809/3515809_720p.mp4</video:content_loc>
      <video:duration>7693</video:duration>
      <video:publication_date>2026-10-05T03:58:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing Chili Pepper Time Lapse</video:title>
      <video:description>Watch a tiny chili pepper seed transform into a healthy green plant and eventually produce fresh red chilies. #chilipeppertimelapse #chiliseedgrowth #chiliplant #growingchilifromseed #pepperplantgrowth #seedtoplant #planttimelapse #gardening #naturetimelapse #growingpeppers #chiligrowing #timelapseplant #satisfyinggrowth #gardeningvideo #natureshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515808/3515808_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devenez Créateur UGC et Gagnez 2000€_mois Facilement</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #devenezcréateurUGCgagnez2000€facilement</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515807/3515807_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T03:57:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesian atmosfer 🇮🇩</video:title>
      <video:description>Indonesian football atmosphere🔥 #indonesia #football #Indonesianfootballatmosphere</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515806/3515806_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T03:57:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beak cinematic</video:title>
      <video:description>beak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515805/3515805_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:57:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Is this the world we created?</video:title>
      <video:description>Queen&apos;s song - Is this the world we created sang by Kadri Muhammad, a singer from Jakarta, Indonesia #queen #songs #beatifulsong #kadrimuhammad #indonesia #jakarta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515804/3515804_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T03:57:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A very daring blind person</video:title>
      <video:description>A blind man recklessly rode a motorcycle on the road, showing absolutely no fear; however, his recklessness led to disaster when he crashed into a truck and fell. #Comedy #HumorFunnyvideos #Comedysketch #Funnyfails #ExpectationvsReality #Plottwist #Caughtoncamera</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515803/3515803_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:56:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Démarrez votre business _ Stratégie Client Facile</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #démarrezvotrebusinessstratégieclientfacile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515802/3515802_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:56:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 6</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515801/3515801_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T03:56:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Domingou……</video:title>
      <video:description>Boa noite galera!!!! #Trend #vibe #kwai #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515800/3515800_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T03:55:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Créez Votre Propre Montre Unique et Lucrative!</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #créezvotrepropremontreuniquelucrative</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515799/3515799_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-05T03:55:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>79 FEEL</video:title>
      <video:description>tiktok template just one click</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515798/3515798_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T03:53:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Fyp#movie#film#Filmerklärung</video:title>
      <video:description>#Fyp#movie#film#FilmerklärungUK #London #BritishCelebrities #RoyalFamily #PrinceHarry #MeghanMarkle don&apos;t miss My Video 💯🚀😔🫂 #FypmoviefilmFilmerklärungUKLondonBritishCelebritiesRoyalFamilyPrinceHarryMeghanMarkledontmissMyVideo💯🚀😔🫂</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515797/3515797_720p.mp4</video:content_loc>
      <video:duration>89</video:duration>
      <video:publication_date>2026-10-05T03:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bald Eagle filmed hunting - Amazing !</video:title>
      <video:description>Professional photographer courtesy #BaldEagle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515796/3515796_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T03:52:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515795</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515795/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freesia Fantasy: Magical Fairy Forest Exploration in Roblox</video:title>
      <video:description>​Welcome to Freesia Fantasy! Join us on a peaceful and magical journey through an enchanted forest filled with glowing mushrooms, beautiful waterfalls, and magical fairy vibes in Roblox. ​Sit back, relax, and enjoy the magical scenery with serene background music. Don&apos;t forget to like, comment, and subscribe for more aesthetic Roblox adventures! ✨🧚‍♀️🍄 #​FreesiaFantasy #RobloxFreesiaFantasy #RobloxAesthetic #RobloxFairyForest #MagicalRobloxWorld #RobloxCinematic #RelaxingRobloxGameplay #FairyTaleRoblox #RobloxShowcase #RobloxCozyVibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515795/3515795_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T03:52:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gin ichimaru game bleach</video:title>
      <video:description>#Game #ginichimaru #gamebleach #vidio #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515794/3515794_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T03:52:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As the new school year begins, and with determination and resilience</video:title>
      <video:description>As the new school year begins, and with determination and resilience, the children of Gaza continue their learning journey, towards the future. ❤️🔥 #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515793/3515793_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T03:52:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Família continua sem notícias de gaúcho desaparecido na Espanha há cinco meses</video:title>
      <video:description>Família continua sem notícias de gaúcho desaparecido na Espanha há cinco meses</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515792/3515792_720p.mp4</video:content_loc>
      <video:duration>600</video:duration>
      <video:publication_date>2026-10-05T03:52:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Créez des Vidéos Virales Facilement_ La Technique Secrète Révélée!</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #créezvidéosviralesfacilementtechniquesecrèterévélée</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515791/3515791_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T03:52:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A large demonstration is taking place in Piccadilly Circus, central London, in solidarity with Pales</video:title>
      <video:description>A large demonstration is taking place in Piccadilly Circus, central London, in solidarity with Palestine. #Palestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515790/3515790_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T03:51:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing 🐈 2</video:title>
      <video:description>Kucing oren #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515789/3515789_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T03:51:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cours Particuliers_ La Méthode SECRÈTE pour Gagner GROS</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #coursparticuliersméthodeSECRÈTEgagnerGROS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515788/3515788_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-10-05T03:50:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lady car dongky</video:title>
      <video:description>Lady car dongky is happy #Cardongky</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515787/3515787_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:50:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 5</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515786/3515786_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T03:50:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A large demonstration is taking place in Piccadilly Circus, central London, in solidarity with Pales</video:title>
      <video:description>A large demonstration is taking place in Piccadilly Circus, central London, in solidarity with Palestine. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515785/3515785_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T03:50:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>monyet menyalakan kipas angin</video:title>
      <video:description>lagi duduk santai diatas kursi sambil memutar kipas angin #fypforyouviralvideopendekmonyetfanspage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515784/3515784_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T03:49:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>77 FOR LOVERS ONLY</video:title>
      <video:description>lonely and painful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515783/3515783_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T03:49:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Augmente Tes Prix_ Vendre Tes Vidéos Facilement</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #augmentetesprixvendrevidéosfacilement</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515782/3515782_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T03:49:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515780</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515780/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pro-Palestinian activists gathered in solidarity outside the Green Party conference in Brighton, Eng</video:title>
      <video:description>Pro-Palestinian activists gathered in solidarity outside the Green Party conference in Brighton, England, ahead of tomorrow&apos;s vote on a motion declaring Zionism a form of racism, and urging the party to take a firm stand against Zionism. #Palestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515780/3515780_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T03:48:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>76 SEA BED</video:title>
      <video:description>tiktok template sooooo nice</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515779/3515779_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:48:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>eaaaa</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515778/3515778_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T03:47:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5 Millions d&apos;abonnés avec Lya_ La Stratégie Secrète</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #5millionsabonnésstratégiesecrète</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515777/3515777_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-10-05T03:47:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Cat Just Did Something HILARIOUS 😂🐱</video:title>
      <video:description>You won’t believe what this cat does next 😂 Watch until the end for the funniest moment! 🐱 #cat #funnycat #funnycats #cutecat #catvideo #hilariouscat #catsbeingfunny #funnyanimal #cuteanimals #adorablecat #viralcat #catreaction #catmoments #funnypet #pets #animalvideos #viralanimals #catlovers #cutepets #funnyvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515776/3515776_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T03:47:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>⭕️ A touching moment when released prisoner Issam Abu Ghalyoun hugged his children, his mother, and </video:title>
      <video:description>⭕️ A touching moment when released prisoner Issam Abu Ghalyoun hugged his children, his mother, and his family after being released, after a month of detention following his arrest while working at the border, along with four other released prisoners. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515775/3515775_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T03:47:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tebak kata</video:title>
      <video:description>video viral dan sangat menghibur #fypforyouviralvidiolucufanspage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515774/3515774_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T03:46:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sicantik imut</video:title>
      <video:description>Kecantikan yang sempurna</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515773/3515773_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:45:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pretty with no boy</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515772/3515772_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T03:45:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The holy Quran</video:title>
      <video:description>Al Qur&apos;an #Religi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515770/3515770_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T03:44:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Israeli occupation forces set fire to a vehicle and sprayed provocative slogans during an attack on </video:title>
      <video:description>⭕ Israeli occupation forces set fire to a vehicle and sprayed provocative slogans during an attack on a house in southern Hebron, occupied West Bank. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515769/3515769_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:44:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Preman susah pensiun</video:title>
      <video:description>Pertarungan di jalan tak terelakan #Video #vidioshort #Ai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515768/3515768_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:43:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>German police attack pro-Palestinian protesters at Alexanderplatz station, Berlin</video:title>
      <video:description>German police attacked pro-Palestinian protesters at Berlin&apos;s Alexanderplatz station during a rally in support of Gaza civilians and calling for an end to Israel&apos;s genocide. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515767/3515767_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T03:42:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the beauty of the scenery</video:title>
      <video:description>This is the truly delightful beauty of nature.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515766/3515766_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:42:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>edisi lbaran idul fitri</video:title>
      <video:description>#virall #fyp #indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515765/3515765_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T03:42:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 4</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515764/3515764_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T03:41:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orang ini gak dapat dapat</video:title>
      <video:description>Kenapa aku ga dapat dapat ikan #Memancing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515763/3515763_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T03:41:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cheetah hunting - Incredible</video:title>
      <video:description>How does someone manage to film this ? #Nature #cheetah #hunting</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515762/3515762_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T03:40:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tikus buta di kawal kodok</video:title>
      <video:description>Tapi tidak di saka ada sekor rumabah yang menyerang #cartun#vidio #Jepangrusia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515761/3515761_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T03:40:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>wild forest honey harvest</video:title>
      <video:description>wild forest honey harvest #wildforesthoneyharvest</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515760/3515760_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T03:39:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sesi latihan persiapan Final nanti tanggal 5 Oktober nanti👍👍 #FIFAASEANCAP #TIMNASINDONESAI #foryou</video:title>
      <video:description>sesi latihan persiapan Final nanti tanggal 5 Oktober nanti👍👍 #FIFAASEANCAP #TIMNASINDONESAI #foryou #timnas #timnasindonesia #fifaaseancup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515759/3515759_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T03:39:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Chinese supporter waves a Palestinian flag during a friendly football match between Palestine and </video:title>
      <video:description>A Chinese supporter waves a Palestinian flag during a friendly football match between Palestine and China in Chongqing, China. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515758/3515758_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T03:39:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Police Chase Night Escape_ Guns, Drifts, and Broken Glass!</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515757/3515757_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-05T03:36:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 3</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515756/3515756_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T03:36:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sarah Connor&apos;s Parking Garage Ambush_ Intense Gunfight &amp; Mystery Metal!.</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515755/3515755_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T03:36:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Huis e huide ♥️ 64</video:title>
      <video:description>Meus bebês lindos Huis e huide ♥️ Uma estória de superação ♥️ #Calopsitas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515754/3515754_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-10-05T03:36:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hahah 3</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515753/3515753_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:35:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kidnapped_! Intense Car Fight &amp; Emotional</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515752/3515752_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T03:35:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Police Chase_ Man With Rifle &amp; Metallic Transformation!.</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515751/3515751_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T03:35:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tumbler stainless</video:title>
      <video:description>Botol air minum stainless motif tumbler sedotan 2 variasi free gantungan dengan bahan stainless steel SUS 304 yang tahan panas dan dingin, dilengkapi sedotan karet silikon lembut dan anti tumpah, bisa digunakan dua cara dengan sedotan atau tanpa sedotan, termasuk free gantungan dan free box, serta ringan dan mudah dibawa kemana saja. ✨ beli sekarang https://s.shopee.co.id/5VVesZtTyB?exp_info=tt_6ZM81JAA #Bisnis #afliate #Tumblerviral #buruanchekout</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515750/3515750_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:33:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Budaya jawa dan budaya nusantara</video:title>
      <video:description>Indah nya perbedaan budaya Indonesia #Budayatradisi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515749/3515749_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:33:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny momment 36</video:title>
      <video:description>#funny #australia #newzealand #uk #usa #canada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515748/3515748_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:33:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>after ea</video:title>
      <video:description>#makan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515747/3515747_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:32:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aerial view of Biak Aerial view of Biak City City, Papua.y, Papua.Aerial view of Biak City, Papua. A</video:title>
      <video:description>An aerial view of Biak City, Papua, reveals a stunning coastal landscape that blends tropical natural beauty with the infrastructure of a strategic port city. Situated along Cendrawasih Bay, Biak City is characterized by white sandy beaches, clear waters ranging from deep blue to turquoise, and expansive coral reefs clearly visible from above. #Papuanaturalbeauty #HiddenparadiseinPapua #PristinebeachesofPapua #UntamedbeautyofPapua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515746/3515746_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T03:32:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A verdade sobre duas civilizações.</video:title>
      <video:description>Depois de muito misterio a verdade e revelada e a humanidade vai desfrutar da tecnologia de uma raça desenvolvida . #alienigena #raças #encontro #misterios</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515745/3515745_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T03:31:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesian Independence day 2</video:title>
      <video:description>Indonesian Independence day #IndonesianIndependenceday</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515744/3515744_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:30:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MasyaaAllah pinternyaaa😍</video:title>
      <video:description>Lahap banget makan pakai kuah santan dan telur yg sudah di potong potong😍 Pintar ya!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515743/3515743_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-05T03:29:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>She Stepped Onto the Stage… Then Everyone Went Silent! 😱</video:title>
      <video:description>A breathtaking moment on stage that caught everyone’s attention! She walked in calmly, prepared for her performance, and then delivered an unexpected move that left the audience stunned. The atmosphere was incredible! #StagePerformanceDance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515742/3515742_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T03:27:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lingkaran kecil cerita besar</video:title>
      <video:description>Gak butuh tempat mewah yang penting kumpul #Ditanyakapaninsafjawabnyanantiterus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515741/3515741_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:26:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesjus music 🎵</video:title>
      <video:description>Lagu jesjus music free song internasional 🎵 #jesjusmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515740/3515740_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T03:23:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Elegant Summer Dress Walk | Beautiful Outdoor Fashion &amp; Lifestyle</video:title>
      <video:description>#ElegantDress #Fashion #SummerDress #Outdoor #Lifestyle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515739/3515739_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T03:23:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Slowmotion cat</video:title>
      <video:description>Slowmotion cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515738/3515738_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-05T03:21:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mysterious Car Talk_ What&apos;s YOUR Story</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515737/3515737_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T03:20:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;Pare de se comparar_Você e única.&quot;</video:title>
      <video:description>💔 **VOCÊ ESTÁ SOFRENDO POR COMPARAR A SUA VIDA COM A DOS OUTROS?** Você vê alguém conquistando aquilo que você deseja e começa a pensar que está atrasada, que não é capaz ou que a sua vida nunca vai mudar? Pare um instante e pense nisso: **você está comparando a sua realidade com aquilo que consegue enxergar da vida de outra pessoa.** Você não conhece todas as lutas dela. E não pode permitir que as conquistas de alguém se transformem em motivo para desvalorizar a sua própria história. 📖 “Cada um examine os próprios atos.” — Gálatas 6:4 Hoje, tome uma decisão: pare de olhar tanto para o caminho dos outros e comece a cuidar do seu. Você ainda pode aprender, crescer, reconstruir e viver novos começos com Deus. 💬 Escreva nos comentários: **MINHA HISTÓRIA TEM VALOR!** 📲 Envie este vídeo para alguém que precisa ouvir essa mensagem hoje. 📌 Salve para lembrar: você não precisa ser igual a ninguém para reconhecer o seu valor. #PareDeSeComparar #VocêTemValor #RecomeçoComDeus #Autoestima #Superação #Fé #Reconstrução #MensagemDeDeus https://recomecar.valdamultimarcas.com #PareDeSeCompararVocêTemValorRecomeçoComDeusAutoestimaSuperaçãoFéReconstruçãoMensagemDeDeus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515736/3515736_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:19:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pretty boy 2</video:title>
      <video:description>Pretty boy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515735/3515735_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T03:19:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Sailed 10,707 KM from Florida to Egypt - Here&apos;s What It Looks Like on a Map</video:title>
      <video:description>How far is Egypt from the USA by boat? Much farther than you think! This animated map shows a sailboat traveling 10,707 kilometers (6,653 miles) from Florida, USA all the way to Egypt. The epic journey crosses: 📍 The Bahamas 📍 The Atlantic Ocean 📍 Morocco &amp; North Africa 📍 The Strait of Gibraltar 📍 The entire Mediterranean Sea 📍 Finally arriving in Egypt This is one of the longest transatlantic sailing routes in the world! #USAtoEgypt #DistanceFromUSAToEgypt #AtlanticCrossing #SailingRoute #Geography #MapAnimation #TravelFacts #Egypt #USA #FloridaToEgypt #StraitOfGibraltar #MediterraneanSea #Education</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515734/3515734_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T03:19:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Walking Dead_ Expansão do Universo e Séries Derivadas.</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515733/3515733_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T03:18:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animasi semangka</video:title>
      <video:description>#Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515732/3515732_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T03:18:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Walking Dead_ Retorno_ Venda de Canais e Renda em Dólar!</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515731/3515731_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T03:18:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Promised Myself This Life</video:title>
      <video:description>I Promised Myself This Life #music #song #IPromisedMyselfThisLife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515730/3515730_720p.mp4</video:content_loc>
      <video:duration>209</video:duration>
      <video:publication_date>2026-10-05T03:17:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TERNYATA KAKI SENDIRI</video:title>
      <video:description>expresi lucu anak kaget</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515729/3515729_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T03:17:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pose nuy</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515728/3515728_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T03:17:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Negan Mata Glenn_ A Cena Mais Chocante de TWD</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515727/3515727_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T03:17:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>asmr coconut cutting skills 2</video:title>
      <video:description>asmr coconut cutting skills #asmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515726/3515726_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T03:17:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pecel</video:title>
      <video:description>Ready setiap hari kamis dan minggu depan toko tunas muda snack #pasarciawitalipurwadadi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515725/3515725_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T03:17:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Walking Dead_ audiência recorde e queda brutal.</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515724/3515724_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T03:16:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tumhein Dil Se Kaise Juda Hum Karenge l Apu Rahman l तुम्हारे दिल से कैसे जुदा हम करेंगे l</video:title>
      <video:description>Romantic Hindi Song #tumhein dil se kaise juda hum Karenge #movie song doodh ka karz #cover song hindi #coversong #bollywood song #doodh ka karz song #romantic hindi song #sad song #love song #old movie song #viral #तुम्हारे दिल से कैसे जुदा हम करेंगे Song- Tumhein Dil Se Kaise Juda Hum Karenge Covered By Apu Rahman #Main Artist- Anuradha Paudwal &amp; Mohammad Aziz Lyrics- Anand Bakhsi Music- Anu Malik Movie- Doodh Ka Karz #tumheindilsekaisejudahumKarenge #moviesongdoodhkakarz #doodhkakarzsong #coversonghindi #coversong #bollywoodsong #romantichindisong #oldmoviesong #viral #तुम्हारेदिलसेकैसेजुदाहमकरेंगे #sadsong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515722/3515722_720p.mp4</video:content_loc>
      <video:duration>402</video:duration>
      <video:publication_date>2026-10-05T03:16:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dancer 49</video:title>
      <video:description>Beautyfull dancer #Dancercantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515721/3515721_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T03:14:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Peejuang seorang ayah</video:title>
      <video:description>Perjuangan seorang ayah tentang kehidupan, semoga sehat selalu. #Pekerjaan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515720/3515720_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T03:14:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Remebering 1976 - Year of The Cat</video:title>
      <video:description>Al Stewart - Great Music ! #AlStewart #YearoftheCat #1976</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515719/3515719_720p.mp4</video:content_loc>
      <video:duration>272</video:duration>
      <video:publication_date>2026-10-05T03:13:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>current situation in the Palestinian school settlement#freepalestine</video:title>
      <video:description>current situation in the Palestinian school settlement#freepalestine #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515718/3515718_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T03:12:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful bonsai 2</video:title>
      <video:description>One of the sellers specializing in bonsai #plantstreesgreeni</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515717/3515717_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:12:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Metel slug level 2</video:title>
      <video:description>I am playing metalslug next level 2 #Metalslug #fyp #tranding #gamers #gaming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515716/3515716_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T03:12:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan Salah! 5 Trik Bikin Rapport yang Jarang Orang Tahu 🔥</video:title>
      <video:description>imana caranya bikin orang cepat nyaman, percaya, dan nyambung sama kita? 👀 Dalam video ini, kamu akan belajar 5 tips sederhana untuk membangun rapport dengan lebih cepat dan efektif. Cocok buat bisnis, networking, pertemanan, sampai membangun personal branding. Tonton sampai akhir—tips terakhir bisa mengubah cara kamu berinteraksi dengan orang lain! 🔥 #caramembangunrapport #tipsmembangunrapport #caramembuatorangnyaman #caramendapatkankepercayaan #caracepatakrabdenganorang #komunikasiefektif #tipskomunikasi #skillkomunikasi #interpersonalskills #networking #personalbranding #businessnetworking #caraberkomunikasi #rahasiakomunikasi #tipsbisnis #mindsetbisnis #socialskills #relationshipbuilding #buildrapport #howtobuildrapport #communicationskills #businesstips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515715/3515715_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-05T03:11:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monyetnya kok bisa punya cewek</video:title>
      <video:description>Si monyet naik motor merah bareng cewek baru, senyum-senyum pakai kacamata hitam, kayak anak motor paling kece! &gt; Eh di pinggir jalan, MANTANNYA nungguin! Lihat monyet lewat sama yang baru, langsung ngamuk-ngamuk 😡 Bukannya kemarin aku yang dipeluk di situ?!&quot; Terakhir, sendal melayang! 🤣🩴 Monyet satu ini emang buaya darat, eh buaya hutan! #monyetmonyetlucudramacintasegitaselingkuhviralngakakmonyetviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515714/3515714_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:11:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bagaimana menurut kalian? 2</video:title>
      <video:description>Udah cocok belum?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515713/3515713_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:11:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cry to my family broken</video:title>
      <video:description>#Quotes #sad #indonesia #family #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515712/3515712_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:09:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Miss You Still</video:title>
      <video:description>I Miss You Still #music #song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515711/3515711_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-10-05T03:08:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Virall 7</video:title>
      <video:description>Viral #Hiburan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515710/3515710_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T03:07:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Burung hama yang jadi favorit</video:title>
      <video:description>#1111</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515708/3515708_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:06:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 742</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE GARDEN PART 742 #HOST #AMERIKA #BEAUTIFUL #SEXY #GARDEN #PART742</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515707/3515707_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-05T03:05:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515706</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515706/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>littel stars one earth</video:title>
      <video:description>movie india #movieindia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515706/3515706_720p.mp4</video:content_loc>
      <video:duration>468</video:duration>
      <video:publication_date>2026-10-05T03:05:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imagens, foi filmado, por câmera 📷</video:title>
      <video:description>Mais umas, daquelas filmagens por câmeras. #sobrenaturalterror</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515705/3515705_720p.mp4</video:content_loc>
      <video:duration>356</video:duration>
      <video:publication_date>2026-10-05T03:04:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best skills 5</video:title>
      <video:description>Best skills #Olahraga #skilssepaturoda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515704/3515704_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T03:04:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 741</video:title>
      <video:description>HOST AMERIKA ERIKAT BEAUTIFUL SEXY ONNTHE BEACH MIMI PART 741 #HOST #AMERIKA #BEAUTIFUL #BEACH #MIAMI #PART741</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515703/3515703_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T03:02:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keep going...</video:title>
      <video:description>Keep going. Your story isn’t over yet. #Nevergiveup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515702/3515702_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T03:01:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Marcelo and Ronaldo s friendship 💞💞💪🏻💘</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖💖💖💖💖💖💖💖💖💖💖✨💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515701/3515701_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T03:00:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chloe Chua</video:title>
      <video:description>She plays Paganini&apos;s Violin Concerto nº 1 #Paganini #Concerto #ChloeChua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515700/3515700_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-10-05T02:59:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to earn money with febspot ? ❤️</video:title>
      <video:description>Have a nice day ❤️ #Travel #paris #france #dance #earn #money #refferal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515699/3515699_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T02:59:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kuningan Village Life - Peaceful Morning Walk in Kuningan, Indonesia</video:title>
      <video:description>Enjoy the peaceful Kuningan Village Life in West Java, Indonesia. A quiet morning walk through a village street with houses, green trees, and a beautiful mosque with a green dome. This is real daily life in Kuningan - calm, simple, and healing. Perfect for relaxing and slow living vibes. 📍Location: Kuningan, West Java, Indonesia. Follow for more Kuningan Village Life videos! #KuninganVillageLife #villagelifeKuningan #KuninganWestJava #morningwalkvillage #peacefulvillageIndonesia #KuninganKota #ruralIndonesia #slowliving #villagewalk #Indonesianvillage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515698/3515698_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T02:58:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you all 💘💘</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖✨💖✨🙏🏻💖💖✨💖💖✨💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515697/3515697_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T02:58:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>random vidio</video:title>
      <video:description>🦅 #Burung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515696/3515696_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T02:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing dan tikus 2</video:title>
      <video:description>Kucing gembul dan tikus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515695/3515695_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:58:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>सौंफ भोजन के बाद क्यों खाई जाती है?</video:title>
      <video:description>सौंफ भोजन के बाद क्यों खाई जाती है? #सौंफभोजनकेबादक्योंखाईजातीहै</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515694/3515694_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:58:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❤️Mini rescue story! 92</video:title>
      <video:description>Fun &amp; learning #Usa #China #france #Romania #britania #brazil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515693/3515693_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:57:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ichigo game bleach soul resonance</video:title>
      <video:description>#gamegamebleachvidiofyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515692/3515692_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T02:57:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Miss Who You Were, Not Who You Are</video:title>
      <video:description>I Miss Who You Were, Not Who You Are #music #song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515691/3515691_720p.mp4</video:content_loc>
      <video:duration>214</video:duration>
      <video:publication_date>2026-10-05T02:57:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUGBANG DI DALAM KELPA</video:title>
      <video:description>Ada yang tau ga ini makanan apa.? #Mugbang #makan #besar #makanan #lezat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515690/3515690_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-05T02:57:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tensura</video:title>
      <video:description>peak🔥 #paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515689/3515689_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T02:56:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thr best</video:title>
      <video:description>#Racing #motorscyle #race #bike #motor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515688/3515688_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T02:56:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❤️Mini rescue story! 91</video:title>
      <video:description>Fun &amp; learning #Usa #China #Romania #Britania #Brazil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515687/3515687_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:56:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515686</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515686/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❤️Mini rescue story! 90</video:title>
      <video:description>Fun &amp; learning #Usa #china #Brazil #Britania #Canada #Romania</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515686/3515686_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:55:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yeshanagula the paradise video song 😍🥰</video:title>
      <video:description>King 👑 is Bling 👑💖👑 👑👑👑👑👑👑👑👑💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515685/3515685_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T02:55:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing ngantuk</video:title>
      <video:description>Kucing ngantuk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515684/3515684_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:54:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>portugal vs norway 2</video:title>
      <video:description>#football #portugal #norway #newzealand #usa #uk #canada #australia #japan #korea #china #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515683/3515683_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T02:53:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you all 💞💞</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑😍💗😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515682/3515682_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T02:53:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of duty 27</video:title>
      <video:description>Call of Duty: Black Ops 6 gameplay on PS5 in 4K at 60FPS. This high-security mission features stealth action, dangerous infiltration, and intense combat within a heavily guarded, restricted facility. Experience the realistic gameplay of Call of Duty: Black Ops 6 as agents enter a secure complex, bypass enemy defenses, and uncover critical information hidden deep within. The operation involves tense encounters, close-quarters combat, and high-stakes objectives in a tightly locked-down environment. If you enjoy Call of Duty gameplay, covert missions, and ultra-realistic 4K combat experiences, this video delivers a thrilling, action-packed military experience. 🎮 About the Game Call of Duty: Black Ops 6 is a first-person shooter developed by Treyarch and Raven Software and published by Activision. The game features a campaign focused on espionage, conspiracy, covert missions, and fast-paced combat set in the early 1990s. Call of Duty: Black Ops 6 Gameplay Call of Duty: Black Ops 6 PS5 Gameplay (4K 60FPS) Call of Duty: Black Ops 6 High-Security Mission Gameplay Call of Duty: Black Ops 6 Facility Infiltration Gameplay #callofduty #callofdutymw4 #newcallofduty #callofduty2026 #worstcallofduty #callofdutynext #callofdutyfacts #callofdutygames #callofdutywarzone #cpredscallofduty #callofdutydetails #callofdutysecrets #callofdutyshorts #callofdutygameplay #callofdutyvanguard #callofdutyminecraft #minecraftcallofduty #callofdutycontroller #callofdutyremastered #callofdutycampaign #callofdutymultiplayer #callofdutycoldwar #worstcallofdutygames #callofdutynext2026 #bestcallofdutygame #trending #shooter</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515681/3515681_720p.mp4</video:content_loc>
      <video:duration>2125</video:duration>
      <video:publication_date>2026-10-05T02:53:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby yamal fun at the work 😝😘</video:title>
      <video:description>King 👑 is Bling 👑💖👑 👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515680/3515680_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T02:53:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SIN CITY (2005) 2</video:title>
      <video:description>*Sin City* transports viewers to Basin City, a sinful metropolis where crime, corruption, and violence are part of everyday life. The narrative unfolds through several intersecting stories: Marv, a brutal man seeking vengeance for the death of the woman he loved; Hartigan, an aging cop fighting to protect a girl from a powerful predator; and Dwight, a man entangled in a world of *femme fatales* and bloody betrayal. Every corner of the city is fraught with dark moral choices—in a place built on sin and blood, is justice still attainable, or is it merely an illusion for those foolish enough to hope? #Unitedstates #crime #thriller #film #movie #movies #sincity2005 #sincity</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515679/3515679_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T02:52:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Classic TT</video:title>
      <video:description>#Motorcycle #bike #race #isleofman #indah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515678/3515678_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T02:52:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WOR DANCING IN JAPANESE GOA BINSARI | Relics of World War II on Biak Island, Papua</video:title>
      <video:description>In Biak culture, *Wor* is viewed from two perspectives: as a traditional ceremony and as a traditional song. As a ceremony, *Wor* holds symbolic significance in Bias life, embodying cultural values that govern their relationships with the Creator, with one another, and with their natural environment. Within Bias religious tradition, *Wor* is regarded as a sacred ceremony. This is reflected in the Biak philosophy &quot;*Nggo Wor Baindo Na Nggo Mar*,&quot; which means &quot;without the traditional ceremony or festival, we would die.&quot; Consequently, traditional ceremonies are of vital importance to the Bias people. One such ceremony is performed to safeguard an individual during the various transitions of social roles throughout their life. #BiaktribePapua #Papuantraditionaldance #PapuanbodypaintingPapuanindigenoustribes #savepapua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515677/3515677_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-10-05T02:52:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute baby 🥰 kindness with animals 💗</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑😍💗💗😍😍😍😍🥰🥰😍😍🥰🥰😍😍🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515676/3515676_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T02:51:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The story of CR7&apos;s development and his beautiful dribbling.🐐</video:title>
      <video:description>The story of CR7&apos;s development and his beautiful dribbling.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515675/3515675_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T02:49:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kalian pilih siapa nih ?</video:title>
      <video:description>Kalian pilih siapa nih ?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515674/3515674_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T02:49:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Power against snow</video:title>
      <video:description>Locomotives facing snow #Locopmotives #snow #power</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515673/3515673_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T02:48:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Baby Elephant Playing in the Rain | Adorable Elephant Splashing in Tropical Jungle</video:title>
      <video:description>Watch this adorable baby elephant playing joyfully in the rain! Set in a lush tropical jungle with a stunning waterfall, the little elephant splashes in the river, sprays water with its trunk, and shelters under a giant leaf as raindrops fall. #cutebabyelephant #elephantplayinginrain #babyelephantsplashingwater #cuteanimalsinjungle #tropicalwildlife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515672/3515672_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:48:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Isle of man</video:title>
      <video:description>#Motorcycle #race #bike #indah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515671/3515671_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T02:48:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuma modal Rp20 ribu bisa jadi Rp1,9 juta? Kok bisa? 🤯 Jangan skip, hitungannya bikin melongo!”</video:title>
      <video:description>Siapa sangka modal kecil bisa menghasilkan angka yang fantastis! 💰 Simak hitungannya sampai akhir dan cari tahu bagaimana peluang bisnis bisa dimulai dari modal sederhana.” #modal20ribu #modalkeciluntungbesar #bisnismodalkecil #usahamodal20ribu #caramenghasilkanuang #peluangbisnis #idebisnis #bisnispemula #usahamenguntungkan #tipsbisnis #bisnisdarinol #carajadisukses #cuandarimodalkecil #menghasilkanuangdarimodalkecil #strategibisnis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515670/3515670_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T02:48:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Show speed inside 💠</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515669/3515669_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T02:47:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Old lady Locomotive</video:title>
      <video:description>Old syle, but still working... #Locomotives #style</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515668/3515668_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T02:47:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515667</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515667/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Having coffee by the beach</video:title>
      <video:description>Having coffee by the beach #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515667/3515667_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T02:46:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soldier 🪖💪🏻 didn&apos;t expect him</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗💗😍💗💗😍💗</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515666/3515666_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T02:46:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MONTAIN AGUNG</video:title>
      <video:description>Pemandangan GUNING AGUNG yang sangat indah dan cantik menemani pagi ini #gunungagung #bali #alamai #natural #vibes #infoubud #infobali #budayabali #tradisiadatbali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515665/3515665_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T02:46:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>como a vida humilha um pobre 😂😂😂 3</video:title>
      <video:description>#mundo #brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515664/3515664_720p.mp4</video:content_loc>
      <video:duration>797</video:duration>
      <video:publication_date>2026-10-05T02:45:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stylish make you more charming 💓💓✨</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨🙏🏻👼🏻😊💕💕💕💕💕💕</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515663/3515663_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T02:45:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pencak silat Indonesia</video:title>
      <video:description>Pencak silat Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515662/3515662_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-05T02:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>prepare billiard</video:title>
      <video:description>#billliard</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515661/3515661_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T02:44:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lush Green Rural Paddy Field View</video:title>
      <video:description>A stunning aerial view capturing vast, lush green rice fields stretching across the peaceful countryside. Surrounded by dense trees and coconut palms, this natural landscape creates a refreshing, tranquil, and picturesque scenery. #ricefields #paddyfield #aerialview #lushgreen #countryside #rurallandscape #naturalbeauty #tropicallandscape #agriculture #scenicview #coconuttrees #naturebackground #peacefulvillage #greenfields #droneperspective</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515660/3515660_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T02:44:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>free fire gaming video 4</video:title>
      <video:description>Free fire gaming video #Gaming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515659/3515659_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T02:44:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby ❤️ king 👑</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖💖💖💖 💖💖💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515658/3515658_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T02:42:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bride 41</video:title>
      <video:description>The Bride</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515657/3515657_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T02:42:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ronaldo Neymar s little girl 💞</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑👑👑👑👑💖💖✨💖💖✨💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515656/3515656_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T02:41:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Just Noticed Something Strange Growing on This Tree! 😱🌿”</video:title>
      <video:description>Have you ever seen something like this growing on a tree? 🌿😳 At first glance, it looks completely normal… but the closer you look, the more interesting it gets! What do you think this is — a root, a vine, or something else? 🤔👇 Drop your answer in the comments! #NaturePlantsPlantLoversNatureLoversTreeVinesGardeningPlantFactsAmazingNatureNatureVideoInterestingDidYouKnowViralVideoReels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515655/3515655_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-10-05T02:40:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gabut 7</video:title>
      <video:description>nunggu org lama jadi weh #bandung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515654/3515654_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T02:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>netherland vs serbia</video:title>
      <video:description>#football #netherland #australia #usa #uk #canada #newzealand #japan #korea #china</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515653/3515653_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-10-05T02:39:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ballibotmogis</video:title>
      <video:description>movie cliping #movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515652/3515652_720p.mp4</video:content_loc>
      <video:duration>599</video:duration>
      <video:publication_date>2026-10-05T02:39:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lamine 💓💗</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗😍 💗💗😍💗💗💗💗😍💗😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515651/3515651_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T02:38:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alan Walker know</video:title>
      <video:description>Alan Walker know who&apos;s the GOAT #CristianoRonaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515650/3515650_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T02:38:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 😘🤟🏻 all</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖💖💖💖✨💖✨💖💖✨💖💖✨💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515649/3515649_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T02:37:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>anime.</video:title>
      <video:description>#amvanimeamv4kanimeedit4k</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515648/3515648_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-10-05T02:37:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My dream car BMW</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515647/3515647_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T02:36:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I love this city 😍</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515646/3515646_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T02:35:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gravel</video:title>
      <video:description>Gravel production site #Gravel #production #site #Hera #timorleste</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515645/3515645_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T02:35:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When 16 year old yamal shocked 😳</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515644/3515644_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T02:34:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just dance ❤️</video:title>
      <video:description>Hii, follow to foolback ❤️ thx Have a nice day ❤️ #Travel #paris #france #earning #meaning #withdraw</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515643/3515643_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T02:33:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My dream car 🚗</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515642/3515642_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T02:33:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Walking in New York City 🏙️</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨🙏🏻💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515641/3515641_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T02:32:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bread vendor in the village</video:title>
      <video:description>#Bread #vendor #village</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515640/3515640_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T02:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bocanilce 52</video:title>
      <video:description>Agora vai viu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515639/3515639_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-10-05T02:30:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mann Mera</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515638/3515638_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T02:30:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cebolinha</video:title>
      <video:description>Escutou td e babado</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515637/3515637_720p.mp4</video:content_loc>
      <video:duration>102</video:duration>
      <video:publication_date>2026-10-05T02:29:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral 211</video:title>
      <video:description>LAGU POP MELAYU PLAYLIST SLOW ROCK TERBAIK🔥MUTIARA IPANK🔥DI RANTAI DI GELANGI RINDU EXIST🔥 #Viral #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515636/3515636_720p.mp4</video:content_loc>
      <video:duration>3476</video:duration>
      <video:publication_date>2026-10-05T02:29:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dance , dance , dance</video:title>
      <video:description>Fantastic ! #StreetDance #musicclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515635/3515635_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T02:28:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>all great history🐐</video:title>
      <video:description>All of CR7&apos;s magnificent history and his insane dribbling skills.🐐@gtinxz #crazydrible #cr7🐐 #realmadrid #primecr7</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515634/3515634_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T02:26:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why African Mums Use Their Torchlight Like This! #shorts  #africanmothers</video:title>
      <video:description>The infamous African mum torchlight inspection remains the ultimate test of childhood stealth in 2026. Whether you are living in Lagos or Nairobi, that sudden beam of light hitting your room instantly triggers memories of every secret you tried to hide. Most people still get flashbacks whenever they see a flashlight in the dark. 🔦 Rate your mum&apos;s inspection skills from 1-10! 👇 #africanparents #africancomedy #naijacomedy #parenting #Africancomedy #Africandrama #Africanmemes #Africanmum #Africanparents #Africanshorts #Africanskits #Ghanacomedy #GrowingupinAfrica #Lagos #Nairobi #africamemes #africanhumor #comedy #comedyshorts #funny #funnyafrica #ghanaianskits #ifblueyhadafricanparents #naijacomedy #naijaskits #parenting #parentinghumor #parentingskits #raissaartista #shorts #viralskits</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515633/3515633_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:25:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivasi hidup 49</video:title>
      <video:description>Fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515632/3515632_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T02:24:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baru kali ini aku liat Erine pose nya pake jempol</video:title>
      <video:description>Baru kali ini aku liat Erine pose nya pake jempol #erinejkt48 #odc48 #jkt48</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515631/3515631_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T02:23:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515630</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515630/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video lucu 30</video:title>
      <video:description>video lucu tiktok #yuordudh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515630/3515630_720p.mp4</video:content_loc>
      <video:duration>158</video:duration>
      <video:publication_date>2026-10-05T02:22:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waktunya olah raga</video:title>
      <video:description>Waktunya olah raga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515629/3515629_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T02:22:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Family enjoy in park</video:title>
      <video:description>Family enjoy in park #park #enjoy #family</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515628/3515628_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T02:21:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan indah di pantai</video:title>
      <video:description>Saat aku melihat pemandangan yang sangat indah di suatu pantai #Pantai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515627/3515627_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T02:20:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUANDO A FÉ FOR SUA ÚNICA FORÇA 🙏 ORE ISSO E CONFIE EM DEUS</video:title>
      <video:description>Sua fé está fraca e os caminhos parecem incertos? 🙏 Faça esta oração, entregue seus medos a Deus e confie que Ele está à frente dos seus passos. ❤️ #oraçãodafé #oraçãoparafortalecerafé #oraçãoparaaumentarafé #oraçãoparaconfiaremDeus #oraçãopoderosa #oraçãoforte #oraçãocristã #oraçãodefé #oraçãoparamomentosdifíceis #oraçãoparaquemestádesanimado #oraçãopararenovaraesperança #Deusfortaleceminhafé #Deusestáàfrente #confiaremDeus #féemDeus #oraçãoparacomeçarasemana #oraçãodedomingo #oraçãoparavenceromedo #oraçãoparaabrircaminhos #JesusCristo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515626/3515626_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T02:19:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Can’t Stay Away? Meghan Markle’s New Video Triggers backlash Over &quot;Private Life&quot;</video:title>
      <video:description>Can’t Stay Away? Meghan Markle’s New Video Triggers backlash Over &quot;Private Life&quot; #royalfamily</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515625/3515625_720p.mp4</video:content_loc>
      <video:duration>118</video:duration>
      <video:publication_date>2026-10-05T02:18:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515624</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515624/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Konnersport vs Red Bull no Red Bull Ring Braking Point</video:title>
      <video:description>In Chapter 2 of Braking Point 3 in F1 25, Konnersport takes on Red Bull at the legendary Red Bull Ring in Austria. Callie Mayer and Aiden Jackson face moments of tension and rivalry in a race packed with drama and excitement. 🚀 🎮 PC Gameplay with: 🖥️ Intel i5-13400F 🎮 RTX 3060 12GB 💾 32GB RAM 🏎️ Logitech G29 #F125 #BrakingPoint #AustriaGP #RedBullRing #CallieMayer #AidenJackson #F125storymode #BrakingPointChapter2 #CorridanaÁustria #F125freeweekend #Formula1Game #GameplayPC #RTX3060 #LogitechG29 #SimRacing #volanteg29 #volante #Wheelg29 #wheel #Racing #simulador #arcade #W68TqL64</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515624/3515624_720p.mp4</video:content_loc>
      <video:duration>892</video:duration>
      <video:publication_date>2026-10-05T02:17:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Evanescence 5</video:title>
      <video:description>Evanescence</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515623/3515623_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T02:16:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR straight from my noggin 🤓</video:title>
      <video:description>#asmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515622/3515622_720p.mp4</video:content_loc>
      <video:duration>127</video:duration>
      <video:publication_date>2026-10-05T02:16:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video funny18198</video:title>
      <video:description>Video funny18198 #Cryfunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515621/3515621_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T02:16:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayub park enjoying</video:title>
      <video:description>Ayub park enjoying #Enjoy #park #sports</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515620/3515620_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T02:15:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mi semana</video:title>
      <video:description>Una semana de entreno #Gym #deportes #esfuerzo #pasion #sacrificio #motivacion #hierros</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515618/3515618_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T02:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SIN CITY (2005)</video:title>
      <video:description>Sin City membawa penonton ke Basin City, sebuah kota penuh dosa tempat kejahatan, korupsi, dan kekerasan menjadi bagian dari keseharian. Inti cerita terjalin melalui beberapa kisah yang saling bersinggungan: Marv, pria brutal yang mencari pembalasan atas kematian wanita yang dicintainya; Hartigan, polisi tua yang berjuang melindungi seorang gadis dari predator berkuasa; dan Dwight, pria yang terjebak dalam dunia femme fatale dan pengkhianatan berdarah. Setiap sudut kota ini dipenuhi pilihan moral yang kelam — di kota yang dibangun di atas dosa dan darah, apakah keadilan masih mungkin ditegakkan, atau hanya ilusi bagi mereka yang terlalu berani berharap? #Film #movie #sincity2005 #sincity #movies</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515617/3515617_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T02:12:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 88</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515616/3515616_720p.mp4</video:content_loc>
      <video:duration>333</video:duration>
      <video:publication_date>2026-10-05T02:10:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UnRefugioParaElAmor 2</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515615/3515615_720p.mp4</video:content_loc>
      <video:duration>628</video:duration>
      <video:publication_date>2026-10-05T02:10:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UnRefugioParaElAmor</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515614/3515614_720p.mp4</video:content_loc>
      <video:duration>260</video:duration>
      <video:publication_date>2026-10-05T02:09:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>movie scan</video:title>
      <video:description>the printing money movie #moviescan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515613/3515613_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-05T02:09:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Baby Triceratops in the Rain | Adorable Dino Shelter in Jurassic Jungle</video:title>
      <video:description>Meet the cutest baby Triceratops caught in a tropical rainstorm! This tiny dino explores a lush Jurassic jungle with waterfalls, splashes in muddy puddles, then finds shelter under a rock cave and a giant leaf as the rain falls. #cutebabydinosaur #babytriceratops #dinosaurintherain #cutedinovideo #jurassicjungleanimals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515612/3515612_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:09:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 50</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515611/3515611_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-10-05T02:09:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeo de Jesus orando 15</video:title>
      <video:description>História bíblica #SãoPaulo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515610/3515610_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T02:08:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 119</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515609/3515609_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T02:08:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hypernovae: The Universe’s Most Powerful Stellar Explosions</video:title>
      <video:description>Hypernovae are extraordinarily powerful stellar explosions associated with the deaths of some massive stars. These dramatic events can release immense amounts of energy and launch powerful jets of material into space. Scientists study hypernovae to understand stellar evolution, cosmic explosions, and how heavy elements are created and distributed throughout the universe. #HypernovaeSpaceFactsStellarExplosionAstronomyUniverseSpaceScienceCosmicEventsStarDeathDeepSpaceAmazingUniverse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515608/3515608_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:08:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 118</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515607/3515607_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T02:08:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 49</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515606/3515606_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T02:07:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This is called *martabak manis*—the most delicious food in the world. If you like this video, feel f</video:title>
      <video:description>This is called *martabak manis*—the most delicious food in the world. If you like this video, feel free to leave a comment!, thankyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515605/3515605_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T02:07:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of duty 26</video:title>
      <video:description>Battlefield Hardline gameplay on PS5 in 4K 60FPS. A dangerous prison escape unfolds inside Miami Federal Prison as the mission turns into a desperate fight for freedom. Experience ultra realistic Battlefield Hardline gameplay as the characters move through restricted areas, navigate prison corridors, and attempt to escape the heavily guarded facility. The mission features tense encounters, close-quarters action, dramatic escapes, and intense urban environments. If you enjoy Battlefield Hardline gameplay, prison escape missions, police action, and immersive 4K gameplay, this video delivers an intense experience. 🎮 About Game Battlefield Hardline is a 2015 first-person shooter developed by Visceral Games and published by Electronic Arts. The game focuses on police and criminal conflicts, featuring a single-player campaign, investigations, pursuits, and action across urban environments. Battlefield Hardline gameplay Battlefield Hardline PS5 gameplay 4K 60FPS Battlefield Hardline prison escape Battlefield Hardline Miami mission #callofduty #thecallofduty #callofdutymw4 #newcallofduty #callofduty2026 #worstcallofduty #callofdutynext #everycallofduty #callofdutynews #callofdutywarzone #callofdutymobile #callofdutyvanguard #callofdutyremastered #callofdutyminecraft #minecraftcallofduty #tdawgsmittycallofduty #callofdutymultiplayer #callofdutydocumentary #callofdutycoldwar #worstcallofdutygames #callofdutynext2026 #blackopscallofduty #callofdutywarzone3 #modernwarfarecallofduty #game #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515604/3515604_720p.mp4</video:content_loc>
      <video:duration>1443</video:duration>
      <video:publication_date>2026-10-05T02:07:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Moss Resembling The Edelweiss</video:title>
      <video:description>A Moss Resembling the Edelweiss. If we look even closer, this moss flower bears a striking resemblance to the Edelweiss flower. #edelweisshikersclimbers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515603/3515603_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T02:07:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SaborATi 21</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515602/3515602_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T02:07:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 87</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515601/3515601_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T02:06:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 86</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515600/3515600_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T02:06:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SaborATi 20</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515599/3515599_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T02:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 48</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515598/3515598_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T02:05:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan-jalan 8</video:title>
      <video:description>Sedang jalan menuju ke bendara #jakarta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515597/3515597_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:04:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌊 What If Humans Could Live Under the Ocean?</video:title>
      <video:description>Imagine waking up in a beautiful underwater home surrounded by colorful sea life… 🌊🐠🏡 Would you live here? #Amazing #underwaterhouse #underwaterworld #underwaterhome #oceanhouse #lifeunderthesea #underwatercity #oceanlife #deepsea #underwaterliving #fantasyworld #beautifulocean #marinelife #oceanadventure #underwaterarchitecture #AIvideo #AIgenerated #amazingplaces #hiddenworld #futuristichome #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515596/3515596_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:04:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 85</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515595/3515595_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T02:04:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 117</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515594/3515594_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T02:04:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 47</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515593/3515593_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T02:04:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan tanya keadaan aku bagaimana ?</video:title>
      <video:description>Jangan tanya keadaan aku bagaimana ? #trishajkt48 #trishaonly48</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515592/3515592_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T02:03:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 116</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515591/3515591_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T02:03:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SaborATi 19</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515590/3515590_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T02:03:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 84</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515589/3515589_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T02:02:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 115</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515588/3515588_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T02:02:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 83</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515587/3515587_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T02:02:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video lucu 29</video:title>
      <video:description>lucu #cartonanimasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515586/3515586_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T02:01:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 46</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515585/3515585_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-10-05T02:01:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 114</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515584/3515584_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T02:01:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 113</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515583/3515583_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T02:00:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just beautiful 2</video:title>
      <video:description>Just beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515582/3515582_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:00:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SaborATi 18</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515581/3515581_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T02:00:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>just beautiful</video:title>
      <video:description>Just beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515580/3515580_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:00:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 112</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515579/3515579_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-10-05T01:59:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 111</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515578/3515578_720p.mp4</video:content_loc>
      <video:duration>129</video:duration>
      <video:publication_date>2026-10-05T01:59:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zetian</video:title>
      <video:description>Support me #Mobilelegends #virals #highlight #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515577/3515577_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-10-05T01:59:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515576</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515576/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rumah 5</video:title>
      <video:description>Pagi di rumah yang cerah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515576/3515576_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-05T01:59:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 82</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515575/3515575_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T01:58:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 81</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515574/3515574_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T01:58:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Cutest Cat Wink You&apos;ll See Today!</video:title>
      <video:description>Did this adorable chubby tabby just wink at you? Watch this cute kitty steal the show with its big round eyes and irresistible charm! #CatWinkCuteCatsTabbyCatFunnyCatsCatsOfTikTokReelsInstagramCutePetsCatShortsChubbyCatWholesomeContent</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515572/3515572_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T01:58:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stones bacan satisfaying</video:title>
      <video:description>Proses pembuatan batu cincin #stone #batuakik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515571/3515571_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:56:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIBAYE DIBAYO SONG OF THE MAMUNA TRIBE OF PAPUA</video:title>
      <video:description>one of the traditional songs from Papua, which tells about the nature of Papua #Savepapua #Song #Papuarainforest #Papuabiodiversity</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515570/3515570_720p.mp4</video:content_loc>
      <video:duration>320</video:duration>
      <video:publication_date>2026-10-05T01:53:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mogu Mogu Monkey - Janji Manis (Cover Closehead)</video:title>
      <video:description>Cover musik #musikindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515569/3515569_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T01:52:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>........ 11</video:title>
      <video:description>........</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515568/3515568_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T01:52:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cristiano Ronaldo 147</video:title>
      <video:description>Thank you capt #cristianoronaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515567/3515567_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T01:51:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time of the 2026 world cup season 2</video:title>
      <video:description>Back then, it was World Cup season. I was rooting for England, and their flag was flying in front of my house.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515566/3515566_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-10-05T01:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CCTV at the Kalikangkung toll gate on the outskirts of Semarang, Central Java, Indonesia.</video:title>
      <video:description>The moment cars and trucks pass through the toll gate.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515565/3515565_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T01:51:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best build from wooden</video:title>
      <video:description>Amazing building car #Car #build #model</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515564/3515564_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-05T01:50:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eternal peace</video:title>
      <video:description>Welcome to my chanel #musicsoundeffectinspiration</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515563/3515563_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-10-05T01:49:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful sunrise 5</video:title>
      <video:description>Best sunrise to see #Sunrise</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515562/3515562_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T01:48:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tubarão 3</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515561/3515561_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T01:47:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tubarões</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515560/3515560_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T01:45:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asana</video:title>
      <video:description>Cool pour une ambiance hot #Fun #danse #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515559/3515559_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T01:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desenho animado 58</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515558/3515558_720p.mp4</video:content_loc>
      <video:duration>387</video:duration>
      <video:publication_date>2026-10-05T01:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat Nabi Ayyub Kehilangan Segalanya, Inilah Doa yang Ia Panjatkan</video:title>
      <video:description>Kisah tentang ujian terberat nabi ayyub sepanjang hidupnya #Kisahislam #kisahnabi #nabiayyub #sejarahislam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515557/3515557_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-10-05T01:44:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ronaldo&apos;s prime goat era 😍</video:title>
      <video:description>Ronaldo&apos;s prime goat era 😍 #goatcristianoronaldo #primecr7</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515556/3515556_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T01:43:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Can This Industrial Shredder Destroy an Entire Motorcycle?</video:title>
      <video:description>An old motorcycle meets a massive industrial twin-shaft shredder. Watch the wheels, frame, engine, fuel tank, and exhaust get pulled downward and destroyed piece by piece. #IndustrialShredder #Motorcycle #HeavyMachinery #Recycling #Shredding #Satisfying</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515555/3515555_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T01:39:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 6</video:title>
      <video:description>Reencontro dos desconhecidos Parte 12 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515554/3515554_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-10-05T01:36:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keindahan di pedesaan alam sunda</video:title>
      <video:description>Keindahan pemandangan pedesaan Sunda yang begitu indah dengan alam yang asli nuansa ketenangan. #Pemandangan #pedesaan #keindahanalam #alamsunda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515553/3515553_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:36:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motifasi 16</video:title>
      <video:description>#Usa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515552/3515552_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T01:35:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time of the 2026 world cup season</video:title>
      <video:description>Back then, it was World Cup season. I was rooting for England, and their flag was flying in front of my house. #Wordcup #inggris #love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515551/3515551_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:34:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Evanescence 4</video:title>
      <video:description>Evanescence</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515550/3515550_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T01:34:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video terbaru silahkan nonton 2</video:title>
      <video:description>Video drama #Videodrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515549/3515549_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:33:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Evanescence 3</video:title>
      <video:description>Evanescence</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515548/3515548_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T01:33:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This 1 Minute Will Make You Forget All Your Problems</video:title>
      <video:description>&gt; Sometimes we don&apos;t need expensive healing... &gt; Just sit in front of a campfire, listen to the wood crackling, watch the sunset over the lake. For a moment, all your problems just disappear. 🍂 &gt; Are you in a phase where you need this kind of peace too? &gt; Don&apos;t skip it, feel the warmth till the end. 🔥 &gt; #healing #sunset #fyphealinghealingjourneysunsetsenjaapiungguncampfiredanaunatureaestheticcalmrelaxingasmrsuaraalamoverthinkingtenangviralmasukberandanatureloverssunsetview</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515547/3515547_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T01:32:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dark Energy: The Mystery Expanding the Universe</video:title>
      <video:description>Dark energy is one of the greatest mysteries in modern cosmology. Scientists believe it is responsible for the accelerating expansion of the universe. Although it cannot be directly seen, its effects appear across enormous cosmic distances. Understanding dark energy could reveal fundamental secrets about the universe and its ultimate fate. #DarkEnergyUniverseSpaceFactsCosmologyAstronomySpaceScienceDeepSpaceCosmicMysteryScienceFactsAmazingUniverse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515546/3515546_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:32:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO SÉ PROTEGER</video:title>
      <video:description>GATO MUITO ESPETO SÉ PROTEGE #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515545/3515545_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:32:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video terbaru silahkan nonton</video:title>
      <video:description>Video drama #Videodrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515544/3515544_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:31:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diretor geral da PF faz balanço sobre a segurança nas eleições</video:title>
      <video:description>Diretor geral da PF faz balanço sobre a segurança nas eleições</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515543/3515543_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-10-05T01:31:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You’ve NEVER seen a cat do this before! 😳🐱</video:title>
      <video:description>You’ve NEVER seen a cat do this before! 😳🐱 #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515542/3515542_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:31:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aktivitas keseharian 2</video:title>
      <video:description>Menjaga kestabilan masyarakat yang sedang jualan di pinggiran jalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515541/3515541_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T01:30:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 5</video:title>
      <video:description>Reencontro dos desconhecidos Parte 11 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515540/3515540_720p.mp4</video:content_loc>
      <video:duration>148</video:duration>
      <video:publication_date>2026-10-05T01:30:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beach atmosphere in Biak City, Papua</video:title>
      <video:description>the beautiful beach atmosphere makes the heart calm #Beachvibes #Vitaminsea #Endlessblue</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515539/3515539_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T01:29:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO SABE MEXER  NA MÁQUINA</video:title>
      <video:description>GATO SABE MUITO BEM MEXER NA MÁQUINA #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515538/3515538_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T01:28:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat ada uang teman mendekat</video:title>
      <video:description>Ketika ada uang teman mendekat, giliran tak ada uang teman menjauh #Ceritakehidupan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515537/3515537_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-10-05T01:28:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atún 2</video:title>
      <video:description>Atún</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515536/3515536_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T01:28:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milionário 2</video:title>
      <video:description>Aprenda #God</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515535/3515535_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T01:27:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aqui se faz aqui se paga</video:title>
      <video:description>Frutas falantes em uma lição de moral #moralmoralidademoraldevida</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515534/3515534_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-10-05T01:26:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATA VAI AS COMPRAS</video:title>
      <video:description>GATA FOI AS COMPRAS NO SHOPPING #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515533/3515533_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T01:25:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uv lagyvsl kags</video:title>
      <video:description>HsgsocyBv #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515532/3515532_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T01:23:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 4</video:title>
      <video:description>Reencontro dos desconhecidos Parte 10 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515531/3515531_720p.mp4</video:content_loc>
      <video:duration>191</video:duration>
      <video:publication_date>2026-10-05T01:21:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATINHO SABE COMO PEGAR O PEIXE</video:title>
      <video:description>GATINHO MUITO INTELIGENTE #GATO #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515530/3515530_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T01:20:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Names of modes of transportation</video:title>
      <video:description>Can you name these vehicles? From motorcycles to trucks and taxis. #Vehiclesforkids #kidslearning #Englishvocabulary #learnwithfun #Educationalvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515529/3515529_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T01:19:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>motivation 79</video:title>
      <video:description>beban #motivation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515528/3515528_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T01:17:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>15 mil por semana</video:title>
      <video:description>Um guarda florestal chamado laranjinha irá ganhar mesmo 15 mil por semana humor e comédia desenho animado #humorcomédia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515527/3515527_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-10-05T01:17:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VEJÁ O PRESENTE QUE O GATO GANHOU</video:title>
      <video:description>GATO NÃO GOSTOU DO PRESENTE GANHOU #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515526/3515526_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:17:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 16th</video:title>
      <video:description>Lovely act #Hit💯💥💢💪💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515525/3515525_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-10-05T01:16:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NATUREZA MARAVILHOSA</video:title>
      <video:description>NATUREZA QUE DEUS CRIOU PARA NOS ALEGRAR. #Brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515524/3515524_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T01:16:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 15th</video:title>
      <video:description>Lovely act #Hit💯💥💢💪💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515523/3515523_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-05T01:14:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO GULOSO</video:title>
      <video:description>GATO NÃO GOSTOU DA FES #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515522/3515522_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:14:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 14th</video:title>
      <video:description>Lovely act #😘😘</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515521/3515521_720p.mp4</video:content_loc>
      <video:duration>106</video:duration>
      <video:publication_date>2026-10-05T01:13:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Learn gardening</video:title>
      <video:description>Not escaping netizens&apos; comments even though he lives in the mountains #Farming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515520/3515520_720p.mp4</video:content_loc>
      <video:duration>212</video:duration>
      <video:publication_date>2026-10-05T01:12:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 3</video:title>
      <video:description>Lovely act #Hit💯💥💢💪💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515519/3515519_720p.mp4</video:content_loc>
      <video:duration>128</video:duration>
      <video:publication_date>2026-10-05T01:12:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Martial Master Eps 686</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515518/3515518_720p.mp4</video:content_loc>
      <video:duration>476</video:duration>
      <video:publication_date>2026-10-05T01:12:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 2</video:title>
      <video:description>Lovely act #Hit💯💥💢💪💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515517/3515517_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-05T01:11:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO APRONTANO 2</video:title>
      <video:description>GATO SEMPRE APRONTANO #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515516/3515516_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T01:11:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Digimon Beatbreak Eps 43</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515515/3515515_720p.mp4</video:content_loc>
      <video:duration>1413</video:duration>
      <video:publication_date>2026-10-05T01:11:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smart dog 13</video:title>
      <video:description>This dog is smart taking making him self a food and enjoy with his hightech services #Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515514/3515514_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T01:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Good day to Ascend Eps 7</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515513/3515513_720p.mp4</video:content_loc>
      <video:duration>1198</video:duration>
      <video:publication_date>2026-10-05T01:10:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bosan😒</video:title>
      <video:description>Butuh penyemangat🙂 #Singapore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515512/3515512_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T01:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO QUEBROU A TELEVISÃO</video:title>
      <video:description>GATO FICOU NERVOSO QUEBROU A TELEVISÃO #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515511/3515511_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T01:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Smiliing little baby with nice fish when his taking sunbathing #Travail</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515510/3515510_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T01:08:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cristiano Ronaldo&apos;s cool bicycle kick 😍</video:title>
      <video:description>Cristiano Ronaldo&apos;s amazing overhead kick left Buffon stunned and rooted to the spot. #CristianoRonaldo #realmadrid</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515509/3515509_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T01:07:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 3</video:title>
      <video:description>Reencontro dos desconhecidos Parte 9 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515508/3515508_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-10-05T01:06:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Proses Pemasangan Atap Bambu</video:title>
      <video:description>Akhirnya atap sirap proyek Ubud selesai juga! 3 bulan kerja dari maket kecil ini. Gimana menurut kalian? Rate 1-10 dong di komen 🌿🙏 #atapbambu #villabambu #disain #Kontruksi #bambubar #tukangbambu #kreatip #seni #orangbali #taksubali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515507/3515507_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T01:05:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mostafa Elsaadi - I Am the Storm (Legendado)</video:title>
      <video:description>“I Am the Storm”, de Mostafa Elsaadi, é uma música sobre transformar dor, pressão e momentos difíceis em força. A letra acompanha uma jornada de alguém que passou muito tempo tentando fugir da escuridão, carregando o peso dos próprios problemas, até perceber que aquilo que parecia destruí-lo também estava despertando uma força que sempre esteve dentro dele. A tempestade deixa de ser algo a temer e passa a representar a própria transformação. Cada queda, cada cicatriz e cada momento difícil se tornam parte do caminho para recuperar a confiança e seguir em frente. ⚡ Você não precisa fugir da tempestade. Às vezes, precisa descobrir que você também é a tempestade. 🎵 Mostafa Elsaadi - I Am the Storm 🎬 Legendado em português Se essa música falou com você, deixe seu comentário, curta o vídeo e compartilhe com alguém que também está atravessando uma fase de transformação.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515506/3515506_720p.mp4</video:content_loc>
      <video:duration>317</video:duration>
      <video:publication_date>2026-10-05T01:04:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POWER OF KONJI 2</video:title>
      <video:description>Konji is the only thing that can humble any man in the side of a woman no matter how strong the man is“ konji go humble am. For example just watch this guy begin a woman for sex because of konji! This is crazy and funny nehm!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515505/3515505_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T01:03:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nouveau série : Tom et Jerry of pyramide Egypte part 1</video:title>
      <video:description>Tom et Jerry of pyramide Egypte</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515504/3515504_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T01:02:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amor eterno</video:title>
      <video:description>Amor eterno realidade ou fantasia #amoreternoamoramar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515503/3515503_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-10-05T01:00:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uma lição de vida</video:title>
      <video:description>Exemplo de lição de vida em forma de animação #liçãodevidasigaestadica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515502/3515502_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T00:55:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atún</video:title>
      <video:description>Atún</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515501/3515501_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T00:54:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NINJA R STOPIE</video:title>
      <video:description>Motorbike stopie #Motorcycle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515500/3515500_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T00:52:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuide de sua beleza seja sempre linda</video:title>
      <video:description>Dicas úteis de como cuidar de sua beleza sem agredir a pele #belezasemprelindavisual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515499/3515499_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T00:50:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khanpur dam and rainy weather</video:title>
      <video:description>Khanpur dam and rainy weather #Khanpurdam #rain #boats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515498/3515498_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T00:50:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata hari ini 195</video:title>
      <video:description>Kata kata bijak menginspirasi #katabijakmotivasiqoutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515497/3515497_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T00:49:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Empty road car drive</video:title>
      <video:description>Empty road car drive #Car #drive #emptyroad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515496/3515496_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T00:49:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Travling Quetta</video:title>
      <video:description>Travling Quetta #Buses #TravlingQuetta #beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515495/3515495_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T00:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥🔥🔥💪</video:title>
      <video:description>New single track</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515494/3515494_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T00:46:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Race Tamiya 2026</video:title>
      <video:description>Race tamiya 2026 best time for racing #Tamiya #tamiya2026 #fyp #trending #fyp2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515493/3515493_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T00:46:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>No trabalho sempre</video:title>
      <video:description>#Brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515492/3515492_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T00:46:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seriusly Movie</video:title>
      <video:description>#Movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515491/3515491_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-10-05T00:45:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 2</video:title>
      <video:description>Reencontro dos desconhecidos Parte 8 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515490/3515490_720p.mp4</video:content_loc>
      <video:duration>138</video:duration>
      <video:publication_date>2026-10-05T00:45:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Two highway bikes</video:title>
      <video:description>Two highway bikes #Motorcycle #bike #together</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515489/3515489_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T00:43:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O inferno existe não vai para lá</video:title>
      <video:description>Busque a Deus não vai para inferno Livre se dos pecados,seja santo Porque sem Santidade ninguém verá a Deus #Cristão #evangelho #gospel #igreja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515488/3515488_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T00:42:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lion Farts, Monkey Falls From the Tree! 🦁🐒💨</video:title>
      <video:description>This video is an AI cinematic simulation created purely for entertainment. A lion is relaxing under a tree beside the river when suddenly it lets out a funny fart. At the same moment, a monkey sitting in the tree loses its balance and falls down, creating an unexpected comedy moment! All characters, scenes, and events are digitally generated. No real animals were involved or harmed. #FunnyLion #FunnyMonkey #LionFart #MonkeyFalls #AnimalComedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515487/3515487_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T00:42:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fire 🔥🔥🔥🚒</video:title>
      <video:description>The guy so good</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515481/3515481_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T00:40:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Travling Islamabad beautiful view</video:title>
      <video:description>Travling Islamabad beautiful view #Islambad #beauty #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515476/3515476_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T00:38:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afternoon ride on a 2 stroke ninja motor bike</video:title>
      <video:description>Afternoon ride on a 2 stroke ninja motor bike #Ninjarr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515473/3515473_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T00:37:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good morning ❤️ 2</video:title>
      <video:description>Have a nice day ❤️ #Travel #paris #fyp #new</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515471/3515471_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:37:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Set a strategy for XAU/USD.</video:title>
      <video:description>Set a strategy for XAU/USD now</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515468/3515468_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T00:36:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The shaking is steady</video:title>
      <video:description>#Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515466/3515466_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T00:36:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TVアニ</video:title>
      <video:description>Tonight, V stepped into the crowd, taking in live performances at Vogue World: Hollywood. Known for his own standout fashion moments, he kept it effortlessly stylish in a look worthy of the runway. #anime #AMV #video #ai #trending #animation #edit #viral #new</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515465/3515465_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T00:34:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Car drive in tunnel</video:title>
      <video:description>Car drive in tunnel #Tunnel #car #drive</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515461/3515461_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T00:32:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My shop and business</video:title>
      <video:description>My shop and business #Shop #business #finance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515453/3515453_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T00:29:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lihat ceramah dulu yuk☺</video:title>
      <video:description>Lemahnya keikhlasan kita #Ceramahislam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515449/3515449_720p.mp4</video:content_loc>
      <video:duration>610</video:duration>
      <video:publication_date>2026-10-05T00:28:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pink Floral Elegance 🌷 | A Sweet &amp; Feminine Look</video:title>
      <video:description>A little pink, a touch of floral, and a whole lot of elegance. 🌸💕 Sometimes, the simplest outfit makes the sweetest statement. #PinkOutfitFloralFashionFeminineStyleOOTDStyleInspoCuteOutfitFashionInspoShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515448/3515448_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:28:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful morning walk on a beach</video:title>
      <video:description>Beautiful morning walk on a beach #Beach #sea #walk #alone</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515447/3515447_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T00:28:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautiful fish 3</video:title>
      <video:description>beautiful fish #fish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515445/3515445_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T00:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful building and rainy weather</video:title>
      <video:description>Beautiful building and rainy weather #Weather #beautiful #rain #building</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515444/3515444_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T00:26:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful nature voices at early morning</video:title>
      <video:description>Beautiful nature voices at early morning #Morning #natural #outdoor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515443/3515443_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T00:24:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Cosmic Web: The Universe’s Hidden Structure</video:title>
      <video:description>The universe is shaped like a vast cosmic web, where billions of galaxies gather along enormous filaments of matter. Between these structures lie gigantic cosmic voids containing very few galaxies. This mysterious network stretches across unimaginable distances, revealing how gravity has shaped the large-scale structure of our universe. #CosmicWebSpaceFactsUniverseAstronomyGalaxyCosmologyDeepSpaceSpaceScienceAmazingUniverseCosmicMystery</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515442/3515442_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:23:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sihasyikk</video:title>
      <video:description>#Girls #beautiful #spillmata #ayu #gadisdesa #gadis #bungadesa #cantik #seksi #wanita #videopendek #shorts #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515441/3515441_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T00:22:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Impossible Shift: The Area 51 Satellite Photos That Defy Logic6</video:title>
      <video:description>For decades, Area 51 has remained one of the most heavily guarded and secretive locations on Earth. But unclassified satellite images reveal a shocking phenomenon: entire hangars and experimental test structures seem to shift their physical coordinates across the desert floor overnight! #​Area51UFOMysterySatelliteImagesConspiracySecretMilitaryAnomaliesTechnology</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515440/3515440_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T00:22:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terikat janji..</video:title>
      <video:description>Film seru #Film</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515439/3515439_720p.mp4</video:content_loc>
      <video:duration>3083</video:duration>
      <video:publication_date>2026-10-05T00:22:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Game English or spanish</video:title>
      <video:description>Video para countryballs indonesia bermain game English or Spanish #countryballs #Bumi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515438/3515438_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T00:19:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodstoryThailandWomen#</video:title>
      <video:description>Vloger from tahailand #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515437/3515437_720p.mp4</video:content_loc>
      <video:duration>1210</video:duration>
      <video:publication_date>2026-10-05T00:16:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Cat Prank Goes Wrong! 🐱🧽</video:title>
      <video:description>She was washing the dishes when he brought a stack of dirty plates... and tried to make it up to her with an iPhone! 🐱📱 But wait until she opens the box... it&apos;s a sponge! 🧽😂 Watch until the end to see her priceless reaction! Don&apos;t forget to like, comment, and subscribe for more funny cat animations! ✨🐱 #​funnycatprank #catanimation #iphoneprank #catwashingdishes #funnyanimationfyp #catvideo #funnycatstory #3Dcatanimation #cutecats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515436/3515436_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T00:15:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Highway driving</video:title>
      <video:description>Perfect view</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515435/3515435_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T00:15:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why Is Mbappé Laughing Like This? 😂⚽</video:title>
      <video:description>#Realmadrrid #mbbape #psg #mbappelaughing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515434/3515434_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T00:15:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 17</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515433/3515433_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T00:15:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Proficional #saúde #piadascurtas #comedia #humor bora se</video:title>
      <video:description>#Seescrevam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515432/3515432_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T00:15:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It&apos;s okay 🔥🔥🔥</video:title>
      <video:description>It&apos;s okay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515431/3515431_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T00:14:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title># Nunca é tarde para aprender !</video:title>
      <video:description>Os idosos também pode aprender a se conectar. #Nuncaétarde</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515430/3515430_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:14:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waseem tariq 5</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515429/3515429_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T00:14:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fidarabia 17</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515428/3515428_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T00:14:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nutgrass / rumput teki</video:title>
      <video:description>#travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515427/3515427_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T00:10:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aamiin 3</video:title>
      <video:description>Amin ya rabbal alamiin</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515426/3515426_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T00:10:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Latihan voli 2</video:title>
      <video:description>Latihan voli di sore hari bersama rekan kerja #Volley</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515425/3515425_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T00:10:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CLEANING CAR POLICE</video:title>
      <video:description>This close-up shot captures the detailed process of cleaning a vehicle’s exterior. A soft-bristled detailing brush with a black handle gently scrubs the surface, swirling through thick, creamy white soap suds and foam that cover the bodywork. The vehicle features a white base with bold blue lettering and a circular emblem, partially hidden beneath the lather. Glistening water droplets and bubbles cling to the paint, creating a fresh, wet appearance that highlights the careful, thorough cleaning work being done. The lighting emphasizes the texture of the foam and the smooth finish of the vehicle’s surface, conveying a sense of precision and professional care. #Car #toy #police</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515424/3515424_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:09:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>up to down</video:title>
      <video:description>Sexy Lady #sexy #beauty #umderware</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515423/3515423_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T00:08:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kuha River Viqueque</video:title>
      <video:description>In the morning at the kuha river Viqueque municipal - Timor Leste #Kuha #river #viqueque #trip #timorleste</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515422/3515422_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T00:07:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>top 5 fishing</video:title>
      <video:description>this video is very interesting for anglers #fish #fishing #top5moment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515421/3515421_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-10-05T00:07:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bet.h.lehem Kud.umb.a Unit 2026</video:title>
      <video:description>Bethlehem Kudumba Unit 2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515420/3515420_720p.mp4</video:content_loc>
      <video:duration>9313</video:duration>
      <video:publication_date>2026-10-05T00:06:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Music DJ Pesta Babi - HSA MUSIC</video:title>
      <video:description>Play again the DJ remix entitled &quot;Pig Party&quot; made by HSA MUSIC #Dj #remix #music #horeg #Indonesia #CentralJava #India #audio #sound</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515419/3515419_720p.mp4</video:content_loc>
      <video:duration>401</video:duration>
      <video:publication_date>2026-10-05T00:05:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It&apos;s okay 2</video:title>
      <video:description>A shot video for the new single track</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515418/3515418_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T00:04:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nusa Penida - Bali</video:title>
      <video:description>Beautiful island in bali - Nusa Penida #balinusapenidabeautifulislandnatureindonesiafyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515417/3515417_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T00:02:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comedia 13</video:title>
      <video:description>Humor e comédia sorria sempre #comédiahumorcomédiahumor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515416/3515416_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T23:55:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515415</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515415/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot &amp; Sexy Indian Beautiful Desi Woman Sensational Erotic Video - Bong Model Reel Video</video:title>
      <video:description>Hot &amp; Sexy Indian Beautiful Desi Woman Sensational Erotic Video - Bong Model Hot, Desi, Beauty, girl, woman, model, best, top, new, sexy, saree, indian, india, arabic, teen, Desire, video, reel, post, fb, insta, ticktok, live, news, trending, viral, vids, #Amazing, #beauty, #fbreels, #beautiful, #girlfriend, #Women, #beach, #health, #fitness, #design, #artist, #trendingreels, #reelsvideo, #trending, #trend, #business, #gym, #fb, #instagram, #viralvideo, #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids #Amazing #fbreels #beautiful #girlfriend #Women #beach #health #fitness #design #artist #trendingreels #reelsvideo #trend #business #gym #instagram #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515415/3515415_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T23:54:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>R@jwant-2024</video:title>
      <video:description>Rajwant-2024</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515414/3515414_720p.mp4</video:content_loc>
      <video:duration>3579</video:duration>
      <video:publication_date>2026-10-04T23:54:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daria 4</video:title>
      <video:description>David #Mosabimque</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515413/3515413_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:53:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waste of time ? Maybe. But it is so Cute... [2]</video:title>
      <video:description>AI Delirious. Delicious. #Aihumor #cats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515412/3515412_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T23:53:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desi Hot_Model Beautiful Shital Shaw Hot &amp; Sexy video</video:title>
      <video:description>Desi Hot_Model Beautiful Shital Shaw Hot &amp; Sexy video #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids #Amazing #fbreels #beautiful #girlfriend #Women #beach #health #fitness #design #artist #trendingreels #reelsvideo #trend #business #gym #instagram #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515411/3515411_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-10-04T23:53:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coffee 24</video:title>
      <video:description>The Coffee will be roasted to be turned into perfect ground coffee #Coffee #Powder #roasted</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515410/3515410_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T23:52:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waste of time ? Maybe. But it is so Cute...</video:title>
      <video:description>AI Delirious. Delicious. #AI #Humor #Cats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515409/3515409_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:52:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como evitar as bactérias em casa</video:title>
      <video:description>Dicas úteis para você evitar as bactérias em casa #higienehigienizarhigieneencasa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515408/3515408_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T23:50:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣🤣🤣🤣🥹🤣</video:title>
      <video:description>#🤣🤣</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515407/3515407_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T23:48:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mensagem de Deus Para Quem Não Sabe Qual Caminho Seguir</video:title>
      <video:description>Sentindo incerteza ou medo do futuro? Pare 1 minuto e escute esta mensagem que vai renovar a sua fé e trazer paz ao seu coração. 🙏✨ Mesmo quando a névoa encobre os seus passos e o caminho parecer escuro, Deus conhece o horizonte e cuida de cada detalhe da sua caminhada. Entregue sua ansiedade e confie. Capítulos: 00:00 - Confiando além da névoa 00:25 - A esperança no meio do vale 00:50 - Deus nos caminhos desconhecidos 01:20 - O futuro que pertence a Deus Deixe o seu &apos;Amém&apos; nos comentários, curta para que esta mensagem alcance mais pessoas e inscreva-se para fortalecer sua fé todos os dias! #fé #deus #reflexão #motivaçãocristã #palavradedeus #shorts Pegar imagens: https://www.facebook.com/profile.php?id=100046773042863 #mensagemdedeus #reflexãobíblica #palavradefé #confiaremdeus #oraçãoparaansiedade #motivaçãocristã #deuscuidadevocê #versículododia #paznocoração #superação #vídeoscurtosdefé #deusestánocontrole #shortscristãos #pregaçãomotivacional</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515406/3515406_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-10-04T23:47:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wait Until You See This Sunset 🌅😍</video:title>
      <video:description>A peaceful sunset that feels like a dream. 🌅✨ Sometimes, all we need is a beautiful view and a quiet moment. 🌊❤️ #beautifulsunset #sunsetbeach #oceansunset #breathtakingview #nature #relaxingscenery #tropicalbeach #goldenhour #beautifulnature #cinematicscenery #peacefulocean #sunsetvibes #travelinspiration #relaxingvideo #scenicview #naturelovers #amazingsunset #beachvibes #4knature #viralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515405/3515405_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:46:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pooj@ Meri J@@n 2026</video:title>
      <video:description>Pooja Meri Jaan 2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515404/3515404_720p.mp4</video:content_loc>
      <video:duration>7052</video:duration>
      <video:publication_date>2026-10-04T23:45:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chased by a mad cow</video:title>
      <video:description>Funny video 🤣 #Comedy #funnyvideo #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515402/3515402_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:44:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NIRVANA - LITHIUM - Song Lyrics</video:title>
      <video:description>Song Lyrics NIRVANA - LITHIUM #Nirvana #LITHIUM #songlyrics #liriklagu #oldsongs #lagulawas #music #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515401/3515401_720p.mp4</video:content_loc>
      <video:duration>256</video:duration>
      <video:publication_date>2026-10-04T23:42:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Resposta da Sua Oração Vai Chegar no Momento Certo</video:title>
      <video:description>Está passando por um momento difícil ou esperando a resposta de uma oração? Essa mensagem foi preparada para o seu coração hoje! Neste vídeo curto de reflexão e fé, compreenda como Deus trabalha nos bastidores da sua vida mesmo durante as noites escuras e os caminhos difíceis. Lembre-se: o choro dura uma noite, mas a alegria chega pela manhã. Capítulos: 00:00 - A alegria vem pela manhã 00:25 - O propósito no caminho imperfeito 00:50 - Deus trabalha no silêncio 00:75 - O tempo certo do florescer Se esta palavra tocou seu coração, deixe seu &apos;Amém&apos; nos comentários, compartilhe com quem precisa e inscreva-se para receber paz diária! #mensagemdedeus #fé #deus #oracao #palavradedeus #shorts #versiculododia Pegar imagens: https://www.facebook.com/profile.php?id=100046773042863 #mensagemdedeus #deus #fe #oracao #palavradodia #jesus #versiculobiblico #deusestaagindo #respostadeoracao #consolodedeus #motivacaocrista #esperanca #shortscristaos #devocional #milagre</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515400/3515400_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-04T23:41:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Was Leaving… And His Best Friend Couldn&apos;t Hold Back 😢</video:title>
      <video:description>Some goodbyes are harder than words can explain. 😢 Two best friends. One unforgettable moment. Even when distance separates them, true friendship never disappears. ❤️ If you have a best friend you never want to lose, send this to them. 🤝 #emotionalfriendship #goodbyefriends #bestfriendsforever #sadfriendship #emotionalvideo #friendshipstory #touchingmoment #heartbreakinggoodbye #truefriendship #friendsforever #bestfriend #emotionalshorts #sadvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515399/3515399_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:41:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>oyen nih boss</video:title>
      <video:description>kucing gaul</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515398/3515398_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:41:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515397</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515397/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beauty of Starship Landing</video:title>
      <video:description>Wonderful #Starship #Landing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515397/3515397_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T23:41:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#StoryCriminalFromOregon#</video:title>
      <video:description>goodStory #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515396/3515396_720p.mp4</video:content_loc>
      <video:duration>2140</video:duration>
      <video:publication_date>2026-10-04T23:41:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beauty os Starship Launch</video:title>
      <video:description>Wonderful #Starship #Launch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515395/3515395_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T23:39:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Feel the Breeze: Embrace Your Inner Freedom and Fresh Beginnings</video:title>
      <video:description>Let the wind carry away your doubts and refresh your spirit. Embrace the freedom of the present moment and step into your day with renewed energy and optimism. #​Freshstartmotivation #​Innerfreedommindset #​Outdoorinspiration #​Positiveenergydaily #​Mindfulmoments</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515394/3515394_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-04T23:39:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuidados com a saúde feminina</video:title>
      <video:description>Siga estas dicas simples e úteis para a saúde feminina #saúdesaudefemininasaudavel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515393/3515393_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T23:38:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Y@@r Jigree K@sooti Degree 2026</video:title>
      <video:description>Yaar Jigree Kasooti Degree 2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515392/3515392_720p.mp4</video:content_loc>
      <video:duration>10233</video:duration>
      <video:publication_date>2026-10-04T23:38:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chaos Erupts at Traditional Indonesian Art Performance</video:title>
      <video:description>Chaos broke out during a traditional Indonesian art performance as tensions between people in the crowd escalated. Watch what happened as the situation became increasingly difficult to control. #ThechaosandclashesbetweenpeopleintheareawheretraditionalIndonesianartswereperformedgotoutofcontrol #chaos #Noise #commotion #viral #popular #security #Indonesia #police #citizens #people #humans #teenagers #fyp #Facebook #tiktok #world #videos #latest #traditional #traditionalarts #인도네시아전통예술공연이열리던지역에서사람들간의혼란과충돌이통제불능상태에빠졌다혼란 #소음 #소동 #바이러스처럼퍼지는 #인기있는 #혼란 #보안 #인도네시아 #경찰 #도시 #خرجتالفوضىوالاشتباكاتبينالناسفيالمنطقةالتيتُقامفيهاعروضالفنونالإندونيسيةالتقليديةعنالسيطرة在印尼傳統藝術表演區，人群之間的混亂和衝突失控。</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515391/3515391_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-10-04T23:38:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sound Horeg Jawa Timur</video:title>
      <video:description>Ceksound Karnaval MalangSuko #Soundhoreg</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515390/3515390_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T23:37:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Your Best Friend Makes Everything 10x Funnier 😂</video:title>
      <video:description>Everything is funnier when you&apos;re with your best friend! 😂 From random conversations to unforgettable moments, these are the memories that make friendship special. ❤️ Send this to your funniest best friend! 🤣🤝 #funnyfriends #bestfriends #funnyfriendship #bestfriendmoments #friendshipgoals #funnyvideo #comedyshorts #friendsbeingfunny #bestie #funnymoments #hilariousfriends #friendship #friendsforever #viralfunnyvideo #funnyshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515389/3515389_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:37:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kisahku 2</video:title>
      <video:description>Cerita perjalan hidup yg penuh liku dan tak pernah bisa di tebak endingnya. Semua ku pasrahkan pada sang pencipta Allah swt. #Kisahku #sukaduka #manusia #rahasiahidup #aku #dunia #semuaorang #beranda #cinta #sedih #galau #tuarenta #lahir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515388/3515388_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:37:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eminem without me 2</video:title>
      <video:description>Subscribe for More videos 😁 #Eminem #withoutme #rap #song #good #TikTok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515387/3515387_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:37:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wait for end 😂🤣</video:title>
      <video:description>Funny video #Funnyvideo #comedy #funny #humor #meme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515386/3515386_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T23:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aprenda a Ter Paz e Sabedoria em Momentos Difíceis 📖</video:title>
      <video:description>Precisa de paz e sabedoria para hoje? Assista a esta reflexão inspiradora e renove suas energias espirituais! 🙏✨ Neste vídeo curto, compartilhamos mensagens profundas sobre ser um promotor da paz, o verdadeiro significado de amar o próximo através da escuta atenta e a clássica prece por serenidade, coragem e sabedoria para enfrentar os desafios da vida. 📍 Capítulos: 00:00 - Bem-aventurados os que promovem a paz 00:25 - Amar o próximo é saber ouvir 00:50 - Oração da Serenidade e Sabedoria 💬 Curta, comente amém e compartilhe com quem precisa ouvir isso hoje! 🔔 Se inscreva no canal para mais reflexões diárias de fé e esperança. #FeEmDeus #MensagemEspirutal #ReflexaoDiaria #DeusNoComando #PazESereno #ShortsCristaos Pegar imagens: https://www.facebook.com/profile.php?id=100046773042863 #mensagemdedeus #reflexaododia #versiculododia #oracaodaserenidade #deus #jesus #pazdeespirito #palavradedeus #motivacaocristã #fe #amoraoproximo #sabedoria #devocionaldiario #shortsdefe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515385/3515385_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-04T23:35:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dicas de igiene e proteção feminina</video:title>
      <video:description>Dicas úteis de igiene e proteção feminina #igienesadavel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515384/3515384_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-04T23:34:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BEST ORGASMS - MASSIVE CUMSHOTS - Real Homemade Porn Mr Pussy Licking</video:title>
      <video:description>Content intended for adult audiences (18+). This video is intended for audiences who have met the applicable age restrictions. Please watch wisely and in accordance with the platform&apos;s policies and terms. 🔞 #Pussyzoom</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515383/3515383_720p.mp4</video:content_loc>
      <video:duration>506</video:duration>
      <video:publication_date>2026-10-04T23:34:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat Training</video:title>
      <video:description>Funny Video #Funny #Cat #Zoo #Cute #Animal #Love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515381/3515381_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T23:33:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FRAG Pro Shooter - Gameplay | How to Beat a Defensive Deck</video:title>
      <video:description>FRAG Pro Shooter - Gameplay | How to Beat a Defensive Deck #FragProShooter​ #MobileGame​​​ #Multiplayer​ #fragproshooteredit #fragproshooterofficial #fragproshootergameplay #fragprosootergame #fragprosooter #mobilegameplay #mobilegame #mobilegames #gamesmobile #oldmobilegames #funmobilegames #mobilegaming #bestmobilegames #funnymobilegame #mobilegamesplay #crazymobilegames #funnymobilegames #viralmobilegames #mobile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515380/3515380_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-10-04T23:32:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Está confuso? Entregue seus medos nas mãos de Deus agora</video:title>
      <video:description>Se o seu coração está pesado ou com medo do amanhã, pare tudo e assista até o fim! Deus tem uma resposta clara para o seu caminho hoje. 🙏✨ Neste vídeo reflexivo, você encontrará palavras de esperança para momentos em que tudo parece um labirinto escuro. Descubra a força que nasce ao soltar suas preocupações e permitir que Deus transforme seus desertos em jardins floridos. Capítulos: 00:00 - Entregando os medos a Deus 00:25 - Os passos guiados pelo Senhor 00:50 - Luz na confusão e no labirinto 01:20 - Quando o deserto floresce com a fé Deixe o seu &apos;AMÉM&apos; nos comentários, compartilhe com quem está precisando de esperança e inscreva-se para fortalecer a sua fé todos os dias! ❤️ #PalavraDeDeus #MensagemDeFé #DeusNoControle #ShortsCristãos #OraçãoDoDia Pegar imagens: https://www.facebook.com/profile.php?id=100046773042863 #mensagemdedeus #palavradefé #oraçãoparaacalmarocoração #deuscuidadevocê #deuséfiel #vídeomotivacionalevangélico #passosdedeus #confiançaemdeus #shortsdeoração #mensagembíblicadeconforto #versículosdabíblia #féeesperança #superaçãoefé</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515379/3515379_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-04T23:30:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Was Alone… Until His Best Friend Showed Up ❤️</video:title>
      <video:description>Sometimes, you don&apos;t need many friends. You just need one true friend who stays when everyone else leaves. ❤️ A beautiful reminder that true friendship means being there through the good times and the hard times. 🤝 Tag your best friend! ❤️ #truefriendship #bestfriends #friendshipgoals #friendship #bestfriendforever #loyalfriend #emotionalfriendship #wholesomevideo #friendsforever #friendshipmoment #emotionalvideo #heartwarming #touchingstory #supportivefriend #goodfriends #friendshipstory #bestie #friendshiplove #inspirationalvideo #viralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515378/3515378_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:29:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Suck and lick my sister-in-law&apos;s dick while my husband is away at work</video:title>
      <video:description>Watch till the end</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515377/3515377_720p.mp4</video:content_loc>
      <video:duration>427</video:duration>
      <video:publication_date>2026-10-04T23:28:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DubaiStory</video:title>
      <video:description>Cerita kehidupandubai #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515375/3515375_720p.mp4</video:content_loc>
      <video:duration>1472</video:duration>
      <video:publication_date>2026-10-04T23:26:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>They collided at the start</video:title>
      <video:description>Car racing accident #Carracing #accident</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515374/3515374_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T23:26:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣🤣🤣🤣🤣 10</video:title>
      <video:description>Comedy #Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515373/3515373_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T23:24:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A grande jogada</video:title>
      <video:description>Divertidas frutas falantes em uma grande jogada frutebolesca do fim de copa #esporteesportiva</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515372/3515372_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T23:24:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515371</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515371/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spectacular speedboat accident</video:title>
      <video:description>High-speed #Speedboat #accident</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515371/3515371_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T23:24:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Running over those who were watching the rally</video:title>
      <video:description>Accident during a rally #Rally #car #accident</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515369/3515369_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:22:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Normal skill VS Kings of trampoline 3</video:title>
      <video:description>Watch these crazy skateboard &amp; roller skating tricks! 🔥 Watch till the end for a beautiful surprise ✨ If you enjoyed this video, don&apos;t forget to Like, Share, and Subscribe/Follow for more amazing short clips! #ViralShortsTrendingKaabaArtEntertainmentShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515368/3515368_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T23:21:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Improperly assembled overhead crane</video:title>
      <video:description>Accident at work #Accidents #overheadcrane</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515367/3515367_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:21:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>True Friendship Is Rare… But When You Find It ❤️</video:title>
      <video:description>Some friendships are more than just memories—they become a part of our journey. ❤️ Through laughter, support, and every little moment, a true friend always stays by your side. 🤝✨ Tag your best friend and let them know how much they mean to you! ❤️ #FriendshipBestFriendsTrueFriendshipFriendsForeverFriendshipGoalsBestFriendEmotionalWholesomeViralVideoShortVideoFebspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515366/3515366_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:20:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤫 Dad and Baby have a secret! 👶😂</video:title>
      <video:description>🤫 Dad and Baby have a secret! 👶😂 Dad thinks their little secret is safe… but the baby has other plans! 😆 Will the baby keep the secret or accidentally expose Dad to Mom? 🤣❤️ Watch until the end for the funniest moment! 👍 Like, 💬 Comment, and ❤️ Follow for more adorable family fun! #FunnyBaby #comedy #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515365/3515365_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣😹🦴🤣</video:title>
      <video:description>Comedy #Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515364/3515364_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T23:18:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>playing volleyball</video:title>
      <video:description>Volleyball practice in the afternoon with colleagues. #Volleyball</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515362/3515362_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T23:17:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Heavy bass. NUSA X</video:title>
      <video:description>NUSA X, Firestorm Nusa, Nusantara EDM, Nusantara Electronic, Indonesian EDM, Indonesia DJ, DJ instrumental, Bass House, Festival Bass House, EDM Indonesia, Electronic Dance Music, Festival EDM, DJ Music, Powerful EDM, Heavy Bass, Bass Music, Indonesian Electronic Music, Modern Nusantara Music, Nusantara DJ, EDM Festival, Bass Drop, Festival Drop, Original DJ Instrumental, NUSA X Music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515361/3515361_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T23:16:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 WAIT FOR THE DROP!</video:title>
      <video:description>🔥 **WAIT FOR THE DROP!** FIRESTORM NUSA — NUSA X 132 BPM. Heavy bass. Full festival energy. Turn it up. 🔊</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515360/3515360_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T23:14:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Lion and The Deer: An Impossible Love Story 🦁❤️🦌</video:title>
      <video:description>&quot;Watch this emotional and thrilling story of an impossible love in the jungle. A brave young lion risks his kingdom, his throne, and defies the laws of nature to protect a innocent deer from a fierce wolf and his own pride. Will love change the rules of the wild forever? If you loved this intense and dramatic video, please like, comment, and follow for the next part!&quot; #Lionanddeerstory #impossiblelove #junglerules #lionprotectingdeer #wolfvslionfight #emotionaljunglevideo #animaldrama #predatorandpreylove #beautifulnatureanimations #fantasystory #lionkingdrama #viralvideoFebSpot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515359/3515359_720p.mp4</video:content_loc>
      <video:duration>269</video:duration>
      <video:publication_date>2026-10-04T23:13:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#theFairygodmother#</video:title>
      <video:description>Bagus ceritanya #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515357/3515357_720p.mp4</video:content_loc>
      <video:duration>1134</video:duration>
      <video:publication_date>2026-10-04T23:13:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The economy is very difficult. Is there any solution</video:title>
      <video:description>The economy is very difficult. Is there any solution #TheeconomyisverydifficultIsthereanysolution #home #economics #bussinies #money #residence #night #story #words #meal #video #viral #fyp #trend #latest #WhatsApp #poor #success #work #income</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515356/3515356_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:12:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515355</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515355/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>iPhone Duo 2026 in 2003</video:title>
      <video:description>Time traveler #iPhone #iPhoneduo #smartphone #gadget #teknologi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515355/3515355_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T23:12:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mantenha seus cabelos sempre lindos</video:title>
      <video:description>Dicas simples para você manter seus cabelos sempre lindos e brilhantes #saúdecapilarcabelosaudavel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515354/3515354_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T23:11:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GhostStorySingapore#</video:title>
      <video:description>GhostStorySingapore #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515353/3515353_720p.mp4</video:content_loc>
      <video:duration>1393</video:duration>
      <video:publication_date>2026-10-04T23:10:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>👶😂 A BABY WITH BIG DREAMS!</video:title>
      <video:description>👶😂 A BABY WITH BIG DREAMS! He’s only one year old, but he’s already thinking about getting a luxury car! 🚗🤣 He can barely walk, but his dreams are already bigger than ours! 😂❤️ #FunnyBaby #comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515352/3515352_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:09:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ibu ibu Viral joget di pinggir pantai</video:title>
      <video:description>Ibu ibu Viral joget di pinggir pantai #Mother</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515351/3515351_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T23:08:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣🤣🤣🤣🤣 9</video:title>
      <video:description>#Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515350/3515350_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T23:08:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>home sweet home 🏡</video:title>
      <video:description>no where like home</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515349/3515349_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:07:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>الاسد الصحراء عمر المختار جزء 1</video:title>
      <video:description>الاسد الصحراء عمر المختار جزء 1</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515348/3515348_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T23:06:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mantenha seu corpo saudável</video:title>
      <video:description>Dicas úteis de ginástica para você manter seu corpo sempre saudável #saúdeesportesaudesporte</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515347/3515347_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T23:05:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515346</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515346/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stunning Pair of Lemon Oscar Fish in a Clear Water Tank 💛</video:title>
      <video:description>&quot;Watch this beautiful and vibrant pair of Golden / Lemon Oscar fish swimming gracefully in a crystal-clear aquarium. Their bright yellow color and playful movements make this a truly relaxing and captivating underwater scene for all fish lovers. If you love aquatic life and creative tank setups, please like, comment, and follow the channel for more stunning fish videos!&quot; #GoldenOscarfish #LemonOscar #yellowOscarfish #aquariumfish #beautifulfishtank #freshwatercichlids #relaxingaquariumvideo #petfish #clearwatertank #exoticfish #fishaquariumsetup #FebSpotfishvideo #aquaticlife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515346/3515346_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:05:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515345</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515345/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Man&apos;s best friend</video:title>
      <video:description>animal lover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515345/3515345_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:04:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jupiter’s Ocean of Metallic Hydrogen</video:title>
      <video:description>Deep inside Jupiter, enormous pressure transforms hydrogen into a strange liquid metallic state. This electrically conductive layer is believed to play a major role in generating Jupiter’s powerful magnetic field. #JupiterMetallicHydrogenHydrogenOceanJupiterFactsSpaceFactsAstronomyUniverseSpaceSciencePlanetFactsMagneticFieldSolarSystemNASAScienceFactsCosmicMysteryAmazingUniverseSpaceExplorationSpaceShortsYouTubeShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515344/3515344_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:04:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion 16</video:title>
      <video:description>photoshoot dsy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515343/3515343_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:03:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515342</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515342/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dghjjvc</video:title>
      <video:description>Xfghvcxxsssd #Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515342/3515342_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T23:02:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Корни Сага о вампирах</video:title>
      <video:description>Корни Сага о вампирах #КорниСагаовампирах</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515341/3515341_720p.mp4</video:content_loc>
      <video:duration>4774</video:duration>
      <video:publication_date>2026-10-04T23:02:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Models 🥂🌹</video:title>
      <video:description>fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515340/3515340_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:01:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Majestic Red Arowana Fish Encounter with a Crab! 🐉🦀</video:title>
      <video:description>&quot;Watch this incredible footage of a magnificent Red Arowana fish swimming gracefully and encountering a brave crab at the bottom of a beautifully aquascaped tank. The intense standoff and the vibrant colors of the Arowana make this a must-watch for all aquarium and aquatic life enthusiasts! If you enjoyed this underwater action, please like, comment, and follow the channel for more amazing fish videos!&quot; #RedArowana #Arowanafish #crabencounter #aquariumfish #dragonfish #underwaterface-off #aquascaping #freshwaterpredator #beautifulfishtank #rareaquariumfish #aquaticlife #exoticpets #FebSpotviralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515339/3515339_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T23:01:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Playing the game Mobile Legends.</video:title>
      <video:description>Playing the game Mobile Legends. Hero miya #Mobilelegen #gemeheromiya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515338/3515338_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T22:55:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The pleasure of fucking my sister-in-law in the kitchen in the morning</video:title>
      <video:description>A high school girl has intimate relations with her own sister-in-law #ASEANwomen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515337/3515337_720p.mp4</video:content_loc>
      <video:duration>541</video:duration>
      <video:publication_date>2026-10-04T22:55:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 **You Won’t Stop Laughing! 🤣**</video:title>
      <video:description>😂 **You Won’t Stop Laughing! 🤣** Get ready for a hilarious video packed with funny moments, crazy reactions, unexpected surprises, and nonstop laughter! 😆🔥 Watch until the end—you never know what’s going to happen next! 😂 👍 Like | 🔔 Subscribe | ❤️ Share #FunnyComedyFunnyVideoHilariousFunnyMomentsLaughEntertainmentViral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515336/3515336_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:53:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Red Spotted Discus Fish in Aquarium 🐠</video:title>
      <video:description>&quot;Watch this beautiful and vibrant Red Spotted Discus Fish swimming gracefully in a beautifully set up aquarium. Watch how it interacts with a school of tiny fish and another tank mate in this relaxing underwater scene. Perfect for aquarium lovers and anyone looking for a peaceful nature vibe. Don&apos;t forget to like, comment, and follow for more stunning fish and aquarium videos!&quot; #Discusfish #reddiscusfish #aquariumfish #beautifulaquarium #underwaterworld #relaxingfishvideo #schooloffish #tropicalfish #freshwaterfish #petfish #aquariumsetup #fishfeeding #FebSpotfishvideo #naturevibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515335/3515335_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T22:52:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice video good 2</video:title>
      <video:description>....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515334/3515334_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-04T22:46:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Robot Kartun Main Layang-Layang</video:title>
      <video:description>Video kartun pendek — robot lucu main layang-layang 🪁 #kartun #animasi #lucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515333/3515333_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:46:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 292</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515332/3515332_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:45:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EL MUNDO LA RAE CON UN PROBLEMA DE SALUDO un diálogo en tiempo real entre Géminis de Google y el Poe</video:title>
      <video:description>OJO: solo para personas con clase que no sean ociosos, cortos y tengan tiempo de oír, ver y leer. ¿Hasta cuándo vamos a seguir aguantando normas y academias que se ahogan en un vaso de agua mientras el mundo real busca una respuesta? 🌍✍️No te pierdas este encuentro frontal, crudo y necesario: &quot;El mundo y la RAE con un problema de saludo&quot;. Un diálogo profundo, sin caretas, entre la inteligencia artificial de Google y el poeta Eliad Jhosué, donde desnudamos los enredos del lenguaje, la rigidez institucional y la chispa del pensamiento actual. Este diálogo confirma con veracidad que entre máquina y humano se puede estabilizar una convivencia asincrónica, perfecta y productiva, donde no existen fronteras ni deshumanización que corrompan su hegemonía socio-científica y cultural. Hoy en día le hacen una crítica destructiva a la IA sin ver que existen perspectivas capaces de mejorar la calidad humana al servicio de cualquier materia de la vida. Así como se critica de forma destructiva la música creada enteramente en Suno de manera artificial —algo que corrompe y daña la esencia de convivencia entre la Inteligencia Humana y la IA—, cuando esa creación lleva mano humana, aportes genuinos y sensibilidad, la historia cambia por completo: la convivencia pasa de ser corrompida a convertirse en algo limpio y de gran provecho para la sociedad. Que este diálogo, creado de manera interactiva y en tiempo real, funcione como un juicio sanatorio contra todas aquellas entidades que atacan a la IA en lugar de señalar a quienes la usan de manera indebida e injusta para delinquir. 💻 Nota técnica de producción: Este audiovisual fue editado y producido con PowerDirector, una auténtica fiera que corre como el viento, cero tirones, sin caídas de render y sin la ladilla de estar comprando créditos </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515331/3515331_720p.mp4</video:content_loc>
      <video:duration>341</video:duration>
      <video:publication_date>2026-10-04T22:45:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515330</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515330/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chekh out this</video:title>
      <video:description>....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515330/3515330_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T22:43:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Falcon 9 launch</video:title>
      <video:description>Slim. Elegant. Efficient. #Falcon9 #Musk #SpaceX #rocket</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515329/3515329_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T22:42:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Artemis II launch 2</video:title>
      <video:description>From an near public observation point #Artemis #rocket #launch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515328/3515328_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T22:41:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Artemis II launch 1</video:title>
      <video:description>Great view #Artemis #rocket #launch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515327/3515327_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T22:39:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wild Life 4</video:title>
      <video:description>&quot;This is a wildlife video found on the internet. Someone captured a very good moment. Please explain everything about it. #wildlife #cinematicanimalfacts #caughtoncamera #tiger #wildcat #amazingmoment #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515326/3515326_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-10-04T22:38:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2026-10-04T200637.638.mp4</video:title>
      <video:description>https://www.febspot.com/ref/1217291/</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515325/3515325_720p.mp4</video:content_loc>
      <video:duration>111</video:duration>
      <video:publication_date>2026-10-04T22:38:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gimme Gimme Gimme to Me One of It</video:title>
      <video:description>A toy for all of us #Decoration #space #rocket</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515324/3515324_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:38:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>American street</video:title>
      <video:description>A Peaceful Drive Through One of the Most Beautiful American Neighborhoods #america</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515323/3515323_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:36:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus Caminha com Você - Parte 2 / Letra Dola / Intérprete: Francisco Sérgio.</video:title>
      <video:description>Jesus Caminha com Você - Parte 2. Letra Dola / Intérprete: Francisco Sérgio. Letra - Parte 2: Tens escolhas a fazer, caminho para percorre. Mas fique ligado, para não se perder. Entregue tudo ao senhor, Nele pode confiar. Ele vai te guiar, e vai te proteger. Jesus Caminha com você, não importa aonde você vá. Quando você está rezando, Ele está ao teu lado te escutando. &quot;Lembre -se não importa a dificuldade, Jesus está sempre ao seu lado caminhando com você. Peça orientação a Ele, e com certeza Ele vai te dar&quot;. Deixe &quot;Jesus está comigo&quot; nos comentários! #JesusCaminhaComVocê #Fé #DeusTeAma #Criança #FranciscoSérgio #Amor #JesusWalksWithyou #Faith #GodLovesYou #GodlsLove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515322/3515322_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-04T22:35:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This guy does it with his hands</video:title>
      <video:description>Do you guys like this? #Gayboys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515321/3515321_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:33:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DEUS É A SOLUÇÃO PARA TODOS OS SEUS PROBLEMAS.</video:title>
      <video:description>Deus é a solução para todos os seus Problemas. “Pare por um instante e ouça esta palavra: o Senhor é o seu pastor, e nada vai lhe faltar. Mesmo quando o caminho parecer difícil, Deus continua cuidando de você. Confie, porque Ele conhece o caminho e nunca abandona aqueles que Nele esperram&quot;. #Deus #fe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515320/3515320_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T22:33:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515319</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515319/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indo Hijab Slut Fingers Her Wet Pussy</video:title>
      <video:description>What would you feel and do if a woman did this in front of you? #Hijabwomen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515319/3515319_720p.mp4</video:content_loc>
      <video:duration>367</video:duration>
      <video:publication_date>2026-10-04T22:29:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi Season 15 Episode 20 (Grand Finale)</video:title>
      <video:description>Khatron Ke Khiladi Season 15 Episode 20 (Grand Finale)</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515318/3515318_720p.mp4</video:content_loc>
      <video:duration>5328</video:duration>
      <video:publication_date>2026-10-04T22:29:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PCX mode sad🙂</video:title>
      <video:description>Balapan motor seru di GTA dengan kecepatan tinggi dan berbagai rintangan ,saksikan sampai hakir #GTA5 #GTAV #balapmotor #GTAbalapmotor #GTAracing #motorcycleracing #GTAmotorcycle #GTAgameplay #GTAIndonesia #racinggame #motorGTA #balapanGTA #gameplayIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515317/3515317_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T22:28:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Notícias do Brasil e do mundo</video:title>
      <video:description>Notícias atualizadas de hoje #NotíciasdoBrasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515316/3515316_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-10-04T22:26:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cristiano Ronaldo 146</video:title>
      <video:description>Flashback of GOAT era #cristianoronaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515315/3515315_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T22:26:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The ordinary jackpot Ep 8 Hindi dubbed full latest K-drama</video:title>
      <video:description>The ordinary jackpot Ep 8 Hindi dubbed full latest K-drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515314/3515314_720p.mp4</video:content_loc>
      <video:duration>2770</video:duration>
      <video:publication_date>2026-10-04T22:25:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brassage</video:title>
      <video:description>Multitude linguistique et culturelle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515313/3515313_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-04T22:23:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bird  funny video</video:title>
      <video:description>#Birdspakhi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515312/3515312_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T22:21:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesian women #4</video:title>
      <video:description>Want to see Indonesian women like this? Follow my channel and give me support. |Look at this Indonesian woman, a seductive Asian woman | #Asianwomen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515311/3515311_720p.mp4</video:content_loc>
      <video:duration>594</video:duration>
      <video:publication_date>2026-10-04T22:20:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515310</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515310/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Free mode</video:title>
      <video:description>For enjoyment purpose</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515310/3515310_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T22:17:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>romantic gitar</video:title>
      <video:description>romantic gitar #romanticgitar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515309/3515309_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:16:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Look at this Indonesian woman&apos;s expression</video:title>
      <video:description>Indonesian woman who is feeling the pleasure #HijabWomen #IndonesianHijab #Masturbation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515308/3515308_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T22:13:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This girl is living in future filming herself</video:title>
      <video:description>This girl is living in future filming herself #Travel #girl #girls #drone #kamera #fashion #future #video #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515307/3515307_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:12:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>trader anomali</video:title>
      <video:description>#FYP #trader #viral #funny #money</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515306/3515306_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T22:10:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#foryoupage #foryoupage #foryoupage ##fyp #foryou #foryoupage #fypシ #movieclips #film #movie #netfli</video:title>
      <video:description>#foryoupage #foryoupage #foryoupage ##fyp #foryou #foryoupage #fypシ #movieclips #film #movie #netflix #trending #new #foryourpage#tiktok #foryoupageforyoupageforyoupagefypforyouforyoupagefypシmovieclipsfilmmovienetflixtrendingnewforyourpagetiktok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515305/3515305_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-10-04T22:10:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asmr relaxing satisfying water</video:title>
      <video:description>Beauty asmr relaxing satisfying water #Asmr #relaxing #asmrrelaxing #asmrshorts #asmrsatisfying #asmrstyrofoam #earcandy #deepsleep #ambientsound #sleepsound</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515304/3515304_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T22:10:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>US Ambassador to Israel Mike Huckabee praised Hayun&apos;s heoism Siring the attempted attack on the Flyd</video:title>
      <video:description>US Ambassador to Israel Mike Huckabee praised Hayun&apos;s heroism during the attempted attack on the Flydubai flight. Hayun told the ambassador: &quot;All the little miracles that happened there—they all added up to one big miracle.&quot; #Channel7TikTok #Dubai #Flydubai #YanivHayun #US #Ambassador #praise #Hayun #hero</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515303/3515303_720p.mp4</video:content_loc>
      <video:duration>142</video:duration>
      <video:publication_date>2026-10-04T22:09:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PLAY GROUND</video:title>
      <video:description>Siapa di sini yang punya mimpi punya rumah bambu di tengah sawah Ubud? Absen di komen! Nanti aku DM inspirasi desainnya gratis 🌾 #villabamboo #playground #disainbamboo #kontruksi #arsitektur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515302/3515302_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T22:09:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beauty 45</video:title>
      <video:description>beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515301/3515301_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:05:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thank you CR7</video:title>
      <video:description>End era of GOAT #cristianoronaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515300/3515300_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T22:04:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UNBELIEVABLE</video:title>
      <video:description>She thought he already left, only to see him still lying down after a no Well spent in sweetness. Just imagine the shock on her face!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515299/3515299_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T22:03:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fanny video 115</video:title>
      <video:description>Nice video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515298/3515298_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T22:02:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RKM LEGACY ♒ 341</video:title>
      <video:description>RKM LEGACY ♒ #RKMLEGACY♒</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515297/3515297_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:01:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GM GM🫢</video:title>
      <video:description>#Game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515296/3515296_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T21:59:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>For you all</video:title>
      <video:description>Beautifull woman #sexy #lingeri #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515295/3515295_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T21:58:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Musik melayu 2</video:title>
      <video:description>Dengan ada musik galau ya hilang #Pulaupanjang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515294/3515294_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T21:57:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie 5</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515293/3515293_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T21:57:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie 4</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515292/3515292_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:57:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie 3</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515291/3515291_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T21:56:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie 2</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515290/3515290_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T21:56:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LADIES CHOICE</video:title>
      <video:description>Have never try this before but when I did” I realised how cute it looks on me. But then, I said to myself I’ll do this more often as my new style.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515289/3515289_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T21:56:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515288/3515288_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-10-04T21:56:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful nature 375</video:title>
      <video:description>Beautiful nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515287/3515287_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T21:55:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Playing Roblox games with friends</video:title>
      <video:description>Photo content with Roblox friends #Fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515286/3515286_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T21:55:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berkah 3</video:title>
      <video:description>#Hidup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515285/3515285_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:55:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bertahan</video:title>
      <video:description>#Hidup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515284/3515284_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:55:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🦊 **Hyena vs. Fox — A Fight for Survival in the Harsh Desert! 🐺🔥**</video:title>
      <video:description>🦊 **Hyena vs. Fox — A Fight for Survival in the Harsh Desert! 🐺🔥** In a scorching and unforgiving desert, every drop of water and every meal can mean the difference between life and death. When a powerful hyena encounters a determined fox, a fierce battle for survival begins. 😱🏜️ Who will survive this dangerous confrontation? Watch until the end to witness the struggle, tension, and incredible survival instincts of these wild animals. 👍 Like | 🔔 Subscribe | ❤️ Share</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515283/3515283_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-10-04T21:54:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤲 bersyukur</video:title>
      <video:description>#Doa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515282/3515282_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:54:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Is this what you want?</video:title>
      <video:description>Let&apos;s see how many viewers this video gets. #Indonesianwomen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515281/3515281_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:54:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amin🤲</video:title>
      <video:description>#Doa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515280/3515280_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:54:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kehidupan 20</video:title>
      <video:description>#Kehidupan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515279/3515279_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:53:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geol geol</video:title>
      <video:description>#Goyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515278/3515278_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T21:53:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515277</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515277/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naked woman playing</video:title>
      <video:description>How do you feel?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515277/3515277_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T21:52:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Traditional way.</video:title>
      <video:description>Cultural show up 🥰 #Dancers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515276/3515276_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:50:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Blast buzzzeerrr</video:title>
      <video:description>Buzeeer dollar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515275/3515275_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T21:50:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot hot pop🫢</video:title>
      <video:description>#Goyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515274/3515274_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T21:50:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>James Blunt</video:title>
      <video:description>Mistake #JamesBlunt #Mistake #Music #viral #song #Febspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515273/3515273_720p.mp4</video:content_loc>
      <video:duration>256</video:duration>
      <video:publication_date>2026-10-04T21:49:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goyang sis</video:title>
      <video:description>#Goyangdlu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515272/3515272_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T21:48:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sitting alone at night</video:title>
      <video:description>Alone without anyone in the middle of the night #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515270/3515270_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-04T21:46:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tehnik sadari pikiran emosi dan tubuh</video:title>
      <video:description>Luangkan waktu hanya 60 detik untuk pulang kembali ke diri Anda. Audio pemandu singkat ini dirancang untuk membantu Anda menyadari kondisi pikiran, merangkul perasaan, dan merilekskan tubuh yang tegang di tengah padatnya aktivitas. Duduklah dengan nyaman, gunakan earphone, dan ikuti panduannya. #MindfulnessIndonesiaMeditasi1MenitKesadaranDiriKesehatanMentalSelfAwarenessRelaksasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515269/3515269_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-04T21:46:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sakit itu ketika wanita yang kita sayang selingkuh 😭</video:title>
      <video:description>#sad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515268/3515268_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T21:44:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prat satu kaisar pedang penjaga gununf awal.mula</video:title>
      <video:description>#Indonesiadrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515267/3515267_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T21:44:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 2</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515266/3515266_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-04T21:42:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeon meshi ep24</video:title>
      <video:description>Sub indo #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515265/3515265_720p.mp4</video:content_loc>
      <video:duration>1497</video:duration>
      <video:publication_date>2026-10-04T21:42:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>aset berharga saat umur 20tahu</video:title>
      <video:description>#edukasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515264/3515264_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T21:41:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeon meshi ep23</video:title>
      <video:description>Sub indo #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515263/3515263_720p.mp4</video:content_loc>
      <video:duration>1702</video:duration>
      <video:publication_date>2026-10-04T21:40:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BATTLE THROUGH THE HEAVENS EPISODE 213</video:title>
      <video:description>Donghua Battle Through The Heavens,season 5,episode 213 Xiaoyan #xiaoyan #btth #donghua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515262/3515262_720p.mp4</video:content_loc>
      <video:duration>1094</video:duration>
      <video:publication_date>2026-10-04T21:40:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skuy mabar</video:title>
      <video:description>#game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515261/3515261_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T21:40:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeon meshi ep22</video:title>
      <video:description>Sub indo #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515260/3515260_720p.mp4</video:content_loc>
      <video:duration>1452</video:duration>
      <video:publication_date>2026-10-04T21:39:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Master Aiim</video:title>
      <video:description>#Game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515259/3515259_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T21:39:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ECO Villa Bamboo</video:title>
      <video:description>Menyatukan mimpi dengan alam melalui detail bambu. Keindahan yang berkelanjutan dari jantung pulau bali #Bali #bambukontruksi #arsitektur #naturevibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515258/3515258_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T21:39:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantic Music</video:title>
      <video:description>Romantic Music #RomanticMusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515257/3515257_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:39:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Push Renked</video:title>
      <video:description>#Game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515256/3515256_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T21:39:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PUSH CS RENKED</video:title>
      <video:description>#Game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515255/3515255_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-04T21:38:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515254/3515254_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-04T21:37:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeon meshi ep21</video:title>
      <video:description>Sub indo #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515253/3515253_720p.mp4</video:content_loc>
      <video:duration>1617</video:duration>
      <video:publication_date>2026-10-04T21:37:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yummy fish</video:title>
      <video:description>Time to eat and taste yummy fish😊 #healthyfood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515252/3515252_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T21:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pedang KAISAR ISTSHAR</video:title>
      <video:description>#Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515251/3515251_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-04T21:36:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😱 **A Terrifying Swing 1,000 Feet Above the Ground!**</video:title>
      <video:description>😱 **A Terrifying Swing 1,000 Feet Above the Ground!** Imagine sitting on a swing at an incredible height of **1,000 feet**! 😳🌍 The fear, suspense, and mystery make this unforgettable moment feel like something out of a movie. But what really happened to this girl? 😨 Did she stay calm, or did something unexpected happen? Watch until the end to discover the shocking moment! 🔥 👍 Like | 🔔 Subscribe | ❤️ Share #ExtremeSwing1000FeetScaryMomentAdrenalineThrillingMysteryExtremeAdventureViralVideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515250/3515250_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T21:35:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>quotes 21</video:title>
      <video:description>quotes geng #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515249/3515249_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T21:34:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love other than yours Episode 6  Hindi dubbed full latest K-drama</video:title>
      <video:description>A Love other than yours Episode Hindi dubbed full latest K-drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515248/3515248_720p.mp4</video:content_loc>
      <video:duration>3861</video:duration>
      <video:publication_date>2026-10-04T21:34:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cry trend on capcut</video:title>
      <video:description>Trend, tiktok, capcut, douyin #Trend #tiktok #capcut #douyin</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515247/3515247_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:33:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hollywood Black Actors Are Richer Than You Think</video:title>
      <video:description>Hollywood Black Actors Are Richer Than You Think #Luxury #Millionaire #Billionaire #Money #Viral #Expensive #Actors #Watches #Celebrities #Boats #Jets #Yachts #TheRichest #KingLuxury #Top10 #ExpensiveThings #MrLuxury #TopLuxury #LuxuryKing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515246/3515246_720p.mp4</video:content_loc>
      <video:duration>2113</video:duration>
      <video:publication_date>2026-10-04T21:32:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Food design</video:title>
      <video:description>Simple very nice clean food arrangements #foodlover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515245/3515245_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T21:32:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gameplay Master Cs Renked</video:title>
      <video:description>Skuy join Mabar...jangan lupa like end komen,🙏 #Gamefirefire</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515244/3515244_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T21:29:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tidak bisa tidur</video:title>
      <video:description>JM 02.24 .mata belum ngantuk . Kenapa ini mata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515243/3515243_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T21:28:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>White gueen</video:title>
      <video:description>#Datealive</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515242/3515242_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T21:26:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean.</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515241/3515241_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-04T21:25:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515240</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515240/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot; Welcome to the Netherlands 🇳🇱❤️❤️❤️</video:title>
      <video:description>&quot; Welcome to the Netherlands 🇳🇱❤️❤️❤️ #Welcome #to #theNetherlands🇳🇱❤️❤️❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515240/3515240_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-04T21:25:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515239</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515239/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TERKUTUK FILM HOROR INDONESIA TERBARU</video:title>
      <video:description>TERKUTUK FILM HOROR INDONESIA TERBARU #TERKUTUKFILMHORORINDONESIATERBARU</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515239/3515239_720p.mp4</video:content_loc>
      <video:duration>2726</video:duration>
      <video:publication_date>2026-10-04T21:24:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kyunki Saas Bhi Kabhi Bahu Thi 5 October 2026 Full Episode</video:title>
      <video:description>Good #Google</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515238/3515238_720p.mp4</video:content_loc>
      <video:duration>1451</video:duration>
      <video:publication_date>2026-10-04T21:23:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515237</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515237/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Maafi Mang Lo 💔 | Emotional Romantic Song | Roman Urdu Song 2026 | Love &amp; bits Presents</video:title>
      <video:description>🎵 📝 Description ❤️ Love &amp; bits Presents — Maafi Mang Lo ❤️ Ek dil ko chhoo lene wala heart touching romantic song jo mohabbat, judai, regret aur maafi ki kahani bayan karta hai. 💔❤️ “Maafi Mang Lo” ek emotional Roman Urdu love song hai, jismein ek dil apni mohabbat se apni ghalti ki maafi maangta hai aur toote hue rishte ko dobara jorne ki koshish karta hai. 🎵 Song: Maafi Mang Lo 🎤 Style: Professional Human Style ❤️ Genre: Romantic / Emotional 🌙 Language: Roman Urdu 🎬 Presented By: Love &amp; bits 🎧 Music Feel: Soft Piano, Acoustic Guitar, Warm Strings &amp; Cinematic Emotion 💎 Quality: 4K UHD 🎼 Original Song Credits ✍️ Original Lyrics: Love &amp; bits 🎼 Original Composition: Love &amp; bits 🎤 Vocals: Love &amp; bits 🎧 Music Production: Love &amp; bits 🎬 Concept, Editing &amp; Presentation: Love &amp; bits © Copyright Owner: Love &amp; bits Lyrics, composition, music arrangement aur presentation is song ke liye original hain aur Love &amp; bits ki milkiyat hain. Lyrics ka emotional hook: “Maafi mang lo… maafi mang lo, Dil se jo toot gaya, woh jod lo…” Agar aapko heart touching songs, romantic songs, emotional love songs aur Roman Urdu songs pasand hain, to video ko ❤️ LIKE karein, apne friends ke saath SHARE karein aur Love &amp; bits ko SUBSCRIBE karein. 🔔 Subscribe for more original romantic &amp; emotional songs. ⚠️ Copyright Disclaimer © 2026 Love &amp; bits. All rights reserved. Yeh song, iske lyrics, composition, music, vocals, arrangement, artwork aur video presentation Love &amp; bits ka original content hain. Is content ko bina ijazat copy, reproduce, re-upload, distribute, modify, remix, sample ya commercial use karna sakht mana hai. Kisi bhi third-party copyrighted material ka jaan-boojh kar istemal nahi kiya gaya. Agar kisi content owner ko is video se mutalliq koi concern ho, to barah-e-karam Love &amp; bits se rabt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515237/3515237_720p.mp4</video:content_loc>
      <video:duration>293</video:duration>
      <video:publication_date>2026-10-04T21:23:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Romantic Hindi Songs ❤️ | Hindi Love Song | Heart Touching Romantic Music</video:title>
      <video:description>❤️ Romantic Hindi Song – Beautiful Love Song &amp; Heart Touching Hindi Music Enjoy this beautiful romantic Hindi song filled with love, emotion, and soulful melodies. Perfect for anyone who loves romantic Hindi music, heartfelt love songs, and relaxing Bollywood-style melodies. 🎵 Listen, relax, and enjoy the beautiful feeling of love through music. Perfect for: ❤️ Romantic moments 💕 Love and relationship videos 🌙 Relaxing evenings 🎧 Hindi music lovers 💖 Fans of romantic Bollywood-style music Keywords: romantic Hindi song, beautiful love song, heart touching Hindi music, Hindi romantic song, Hindi love song, romantic Hindi music, soulful Hindi song, Bollywood love song, beautiful Hindi song, heart touching love song. #romantichindisong #hindilovesong #romanticsong #beautifullovesong #hearttouchinghindisong #hindiromanticmusic #romantichindimusic #hindisong #hindimusic #lovesong #hearttouchingsong #soulfulhindisong #beautifulhindisong #romanticbollywoodsong #bollywoodlovesong #indianromanticsong #indianlovesong #hindilovemusic #emotionalhindisong #romanticmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515236/3515236_720p.mp4</video:content_loc>
      <video:duration>348</video:duration>
      <video:publication_date>2026-10-04T21:23:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUNKAR _ HOROR INDONESIA TERBARU</video:title>
      <video:description>MUNKAR _ HOROR INDONESIA TERBARU #KeywordSEOmunkar #munkarhoror #malaikatmunkar #kisahmunkar #misterimunkar #hororindonesiaterbaru #ceritahororindonesia #kisahhororterbaru #kisahmistis #ceritamistisindonesia #alamkubur #siksakubur #azabkubur #kisahkematian #misterikematian #kisahseram #ceritaseramterbaru #hororreligi #kisahhororreligi #ceritahororviral #pengalamanmistis #misterialamkubur #malaikatkubur #kisahnyatahoror #horrorindonesia #horormalam #ceritahororterbaru #kisahmengerikan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515235/3515235_720p.mp4</video:content_loc>
      <video:duration>530</video:duration>
      <video:publication_date>2026-10-04T21:22:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Poppy little wtch</video:title>
      <video:description>&quot;Poppy the Little Witch&quot; (Poppy la petite sorcière) is a charming children&apos;s story about a young witch named Poppy who is learning to master her magical powers. ​The Protagonist: Poppy is a kind, curious, and bright young witch who lives in a magical world alongside her clever animal companions. ​The Plot: The story follows Poppy&apos;s daily adventures as she attends magic lessons, learns to fly on her broomstick, and tries to cast spells—which often leads to funny, accidental mishaps. ​The Theme: Through trial and error, Poppy learns important life lessons about patience, friendship, helping others, and believing in herself, showing that making mistakes is just a normal part of growing up.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515234/3515234_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-10-04T21:22:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>رحله متنزه منطقه راجب وفرحه اولادي</video:title>
      <video:description>متنزه عائله عام من أروع متنزاهات منطقة راجب #متنزهمنطقهراجب</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515233/3515233_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-04T21:22:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love other than yours Episode 5 Hindi dubbed full latest K-drama</video:title>
      <video:description>A Love other than yours Episode 5 Hindi dubbed full latest K-drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515232/3515232_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T21:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantic Engagement In Blooming Orchard</video:title>
      <video:description>Romantic engagement scene featuring a couple deeply in love during a beautiful proposal in a blooming orchard. Surrounded by flowering trees and soft natural light, the couple shares genuine emotions as an engagement ring becomes part of their special moment. The picturesque spring landscape creates a dreamy atmosphere for content about marriage proposals, relationships, wedding celebrations, love, happiness, and unforgettable memories. #marriageproposal #romanticcouple #engagement #coupleinlove #proposalmoment #engagementring #romanticproposal #bloomingorchard #springflowers #weddingromance #lovingcouple #romanticmoment #outdoorproposal #relationship #lovestory #weddingengagement #happycouple #springorchard #proposalday #coupleromance #engagementcelebration #weddinginspiration #romanticlove #specialmoment #outdoorromance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515231/3515231_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T21:20:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asteroid heading  to the earth</video:title>
      <video:description>An asteroid heading toward Earth Kamoʻoalewa is an asteroid measuring approximately 20 meters across that is known as Earth&apos;s &quot;quasi-satellite&quot;: it orbits the Sun but remains close to Earth. Some scientists hypothesize that it is a fragment of the Moon ejected during an impact 1–10 million years ago. On July 2, 2026, China&apos;s uncrewed spacecraft Tianwen-2 imaged the object from a distance of about 20 km. However, preliminary data from the James Webb Telescope (currently in preprint) and the images themselves have cast doubt on this hypothesis, so its origins remain uncertain. Samples are scheduled to arrive on Earth in late 2027. #kamooalewa #asteroidserpihanbulan #bulansemu #quasimoon #tianwen-2 #asteroiddekatbumi #kuasisatelit #misteribulan #giordanobruno #asteroidterbaru #faktaangkasa #faktaluarangkasa #astronomi #penemuanterbaru #spacefacts #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515230/3515230_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T21:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E451 3rd October 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E451 3rd October 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515229/3515229_720p.mp4</video:content_loc>
      <video:duration>1349</video:duration>
      <video:publication_date>2026-10-04T21:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E450 2nd October 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E450 2nd October 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515228/3515228_720p.mp4</video:content_loc>
      <video:duration>1326</video:duration>
      <video:publication_date>2026-10-04T21:19:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E449 1st October 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E449 1st October 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515227/3515227_720p.mp4</video:content_loc>
      <video:duration>1330</video:duration>
      <video:publication_date>2026-10-04T21:19:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E448 30th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E448 30th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515226/3515226_720p.mp4</video:content_loc>
      <video:duration>1310</video:duration>
      <video:publication_date>2026-10-04T21:19:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E447 29th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E447 29th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #TumSeTumTakZeetvS01E44729thSeptember2026Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Anu #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515225/3515225_720p.mp4</video:content_loc>
      <video:duration>1380</video:duration>
      <video:publication_date>2026-10-04T21:19:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantic Hindi Song ❤️ | Beautiful Love Song | Heart Touching Hindi Music</video:title>
      <video:description>❤️ Romantic Hindi Song – Beautiful Love Song &amp; Heart Touching Hindi Music Enjoy this beautiful romantic Hindi song filled with love, emotion, and soulful melodies. Perfect for anyone who loves romantic Hindi music, heartfelt love songs, and relaxing Bollywood-style melodies. 🎵 Listen, relax, and enjoy the beautiful feeling of love through music. Perfect for: ❤️ Romantic moments 💕 Love and relationship videos 🌙 Relaxing evenings 🎧 Hindi music lovers 💖 Fans of romantic Bollywood-style music Keywords: romantic Hindi song, beautiful love song, heart touching Hindi music, Hindi romantic song, Hindi love song, romantic Hindi music, soulful Hindi song, Bollywood love song, beautiful Hindi song, heart touching love song. #latesthindiromanticsong #besthindiromanticsong #romanticsongshindi #hindiromanticsongs #hindilovesongs #bestlovesonghindi #romanticindiansong #indianlovesongs #hindimelodysong #hindiemotionalsong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515224/3515224_720p.mp4</video:content_loc>
      <video:duration>348</video:duration>
      <video:publication_date>2026-10-04T21:18:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Madam, why you lie? You said you were just looking!</video:title>
      <video:description>E be like say market matter no dey finish especially when you talk say you dey just look. This funny encounter for one busy Lagos market stall shows exactly how we dey bargain for Naija. Most traders don experience this kind confusion when customer change mind sharp-sharp. You go see say the way we handle market drama for this 2026 comedy scene is pure vibes. 😂 Rate this customer her serious face 1-10! 👇 #Drama #naijacomedy #marketgist #money #Nollywood #funnyjoke #marketprank</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515223/3515223_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T21:17:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ALAS ROBAN _ HOROR INDONESIA TERBARU</video:title>
      <video:description>Tentu, ini deskripsi yang cocok untuk konten YouTube bertema horor: Deskripsi YouTube — Alas Roban Horor **ALAS ROBAN — HOROR INDONESIA TERBARU** Alas Roban dikenal sebagai salah satu kawasan yang menyimpan banyak cerita mistis dan kisah horor di Indonesia. Di balik jalan yang panjang, hutan yang lebat, dan suasana yang sunyi, beredar berbagai cerita tentang kejadian aneh yang dialami para pengendara maupun orang-orang yang pernah melewati kawasan ini. Dalam video kali ini, kita akan menyelami **kisah horor Alas Roban**, mulai dari pengalaman misterius, penampakan makhluk tak kasatmata, hingga kejadian-kejadian yang sulit dijelaskan dengan logika. ⚠️ **PERINGATAN:** Video ini mengandung cerita horor dan dapat membuat sebagian penonton merasa takut atau tidak nyaman. Disarankan untuk tidak menonton sendirian jika mudah merasa takut. Simak ceritanya sampai selesai dan temukan misteri apa yang sebenarnya tersembunyi di balik **Alas Roban**. #Berikutkeywordyangcocokuntuk“ALASROBAN–HORORINDONESIATERBARU”alasroban #alasrobanhoror #alasrobanangker #misterialasroban #kisahalasroban #ceritahororalasroban #hororindonesiaterbaru #ceritahororindonesia #kisahmistisindonesia #tempatangkerindonesia #hutanangker #jalanangker #kisahnyatahoror #pengalamanmistis #penampakanalasroban #misterihutan #ceritahororterbaru #horormalam #kisahmisteri #urbanlegendindonesia #ceritamististerbaru #horrorindonesia #hororviral #kisahseram #ceritaseram</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515222/3515222_720p.mp4</video:content_loc>
      <video:duration>1890</video:duration>
      <video:publication_date>2026-10-04T21:15:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515221</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515221/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>First Dragon Season 1 Episode 2 In Hindi</video:title>
      <video:description>Enjoy #FirstDragon #Anime #HindiAnime #TeleportAnime #MagicAnime #SoldierAnime #TeleportSoldierAnime #SpiritsAnime #AnotherWorldAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515221/3515221_720p.mp4</video:content_loc>
      <video:duration>1002</video:duration>
      <video:publication_date>2026-10-04T21:15:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MOON SHRINGKING LIKE RAISIN</video:title>
      <video:description>The Moon is shrinking like a raisin! It is shrinking because its interior continues to cool. As the crust contracts, it cracks and buckles, forming stair-like cliffs that are tens of meters high and several kilometers long. NASA&apos;s uncrewed spacecraft, the Lunar Reconnaissance Orbiter, has photographed more than 3,500 of these cliffs. According to NASA, the Moon&apos;s width has decreased by about 50 meters over the last few hundred million years—a process often likened to a grape turning into a raisin. Coming up tomorrow: temperatures on the Moon—daytime heat hotter than boiling water. Subscribe for daily space facts. #bulanmenyusut #bulanmengecil #bulansepertikismis #nasa #lunarreconnaissanceorbiter #lro #tebingbulan #faktabulan #faktaangkasa #faktaluarangkasa #astronomi #faktanasa #moonshrinking #spacefacts #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515220/3515220_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T21:15:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A better tomorrow</video:title>
      <video:description>short story</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515219/3515219_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:13:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grilled Fish 2</video:title>
      <video:description>Take a short break while eating grilled fish. #Fish #eat #Timorleste #manatuto #trip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515218/3515218_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T21:13:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funniest Cute Animals Compilation 😂🐶🐱 | Try Not to Laugh!</video:title>
      <video:description>Get ready for a dose of happiness! 🐶🐱🐼❤️ Watch this adorable compilation of funny animals, silly moments, cute reactions, and hilarious pet fails that will make your day! From playful puppies to mischievous cats and other adorable animals, these funny moments are guaranteed to put a smile on your face. 😍 Which animal made you laugh the most? Let us know in the comments! 👇 👍 Like, 💬 Comment, and 🔔 Subscribe for more funny and adorable animal videos! #CuteAnimals #FunnyAnimals #AnimalCompilation #FunnyPets #CutePets #TryNotToLaugh #AnimalLovers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515217/3515217_720p.mp4</video:content_loc>
      <video:duration>1707</video:duration>
      <video:publication_date>2026-10-04T21:11:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515216</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515216/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kafir jasad di tolak bumi</video:title>
      <video:description>kafir jasad di tolak bumi #Keywordyangbisadipakaikafir #jasadditolakbumi #jenazahditolakbumi #mayatditolaktanah #jasadtidakhancur #kisahjenazah #kisahkematian #azabkematian #kematianmengerikan #kisahnyata #misterikematian #tandaazab #pelajarankematian #alamkubur #siksakubur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515216/3515216_720p.mp4</video:content_loc>
      <video:duration>653</video:duration>
      <video:publication_date>2026-10-04T21:11:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nenhuma arma contra ti prosperará</video:title>
      <video:description>Nenhuma arma forjada contra ti prosperará. Ele garante a tua proteção e a tua vitória. Isaías 54:17 Compartilha com quem precisa de ouvir isto hoje. #devocional #palavradedeus #fé #isaías #bíblia #versículododia #proteção Podes usar o mesmo texto no CapCut ou no YouTube. Se for para o modelo do CapCut, diz-me e encurto. #Fé #certezanaaçãodeDeus #alegria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515215/3515215_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T21:10:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Magic Repo Man Dumped by My Party, Ill Cash In With a Cute Support Fairy to Become the Strongest Epi</video:title>
      <video:description>Kashita Maryoku wa Ribobarai de Kyousei Choushuu Youzumi to Party Tsuihousareta Ore wa, Kawaii Support Yousei to Issho ni Toritateta Maryoku wo Unyou shite Saikyou wo Mezasu Episodes 1 Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515214/3515214_720p.mp4</video:content_loc>
      <video:duration>1371</video:duration>
      <video:publication_date>2026-10-04T21:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Mistério do Concreto Romano: Ele se Repara?</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515213/3515213_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T21:09:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Ingrediente Secreto que Parecia um Erro</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515212/3515212_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T21:07:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não Era Mágica: A Verdadeira Receita do Concreto Romano</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515211/3515211_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T21:06:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FUNNY VIDEO 38</video:title>
      <video:description>If you want to find this video funny, laugh and don&apos;t forget to follow and leave a comment about this video, thank you. 🤗 #Comedy #funnyvideo #funny #meme #humor #news #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515210/3515210_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T21:06:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Haiwaan (2026) | Hindi Dubbed Full Movie | Latest South Indian Action Thriller</video:title>
      <video:description>Watch Haiwaan (2026) in Hindi — an intense South Indian action thriller packed with suspense, drama, powerful characters and thrilling action sequences. A gripping story filled with mystery, revenge and unexpected twists. #Haiwaan #HindiDubbed #2026Movie #SouthMovie #Action #Thriller #FullMovie #HindiMovie #LatestMovie #SouthIndian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515209/3515209_720p.mp4</video:content_loc>
      <video:duration>9570</video:duration>
      <video:publication_date>2026-10-04T21:06:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Experimento Chocante Recria Concreto que se Cura</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515208/3515208_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T21:05:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot; Rotterdam#South Holland❤️❤️❤️</video:title>
      <video:description>&quot; Rotterdam#South Holland❤️❤️❤️ #Rotterdam #south #Holland</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515207/3515207_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-04T21:05:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Engenharia Não é Competição: Concreto Antigo</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515206/3515206_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-04T21:04:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como Funciona a Química da Auto-Reparação</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515205/3515205_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T21:03:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Hipótese da Mistura a Quente dos Romanos</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515204/3515204_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T21:02:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Concreto Romano Que Parece Se Reparar</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. #ConcretoRomano #EngenhariaRomana #História #EngenhariaAntiga #Ciência #Arqueologia #ConcretoAutorreparável #MateriaisdeConstrução #ImpérioRomano #AlémdaEvidência</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515203/3515203_720p.mp4</video:content_loc>
      <video:duration>635</video:duration>
      <video:publication_date>2026-10-04T21:01:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jupiter’s Great Red Spot: The Giant Storm</video:title>
      <video:description>Jupiter’s Great Red Spot is a gigantic rotating storm in the planet’s atmosphere. It has been observed for centuries and is wider than Earth, making it one of the Solar System’s most fascinating atmospheric phenomena. #GreatRedSpotJupiterJupiterStormSpaceFactsAstronomyUniverseSpaceSciencePlanetFactsSolarSystemNASACosmicMysteryScienceFactsAmazingUniversePlanetaryScienceSpaceExplorationSpaceShortsYouTubeShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515202/3515202_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:01:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ao no Hako Season 2 Episodes 1</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515201/3515201_720p.mp4</video:content_loc>
      <video:duration>1540</video:duration>
      <video:publication_date>2026-10-04T21:01:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drishyam: The Conclusion (2026) | Hindi Full Movie | Ajay Devgn | Tabu | Crime Thriller</video:title>
      <video:description>Watch Drishyam: The Conclusion (2026), the final chapter of the gripping Drishyam franchise. Starring Ajay Devgn, Tabu, Shriya Saran and Jaideep Ahlawat, this intense crime mystery thriller brings Vijay Salgaonkar&apos;s story to its ultimate conclusion, filled with suspense, secrets, twists and unexpected turns. #DrishyamTheConclusion #Drishyam3 #2026Movie #AjayDevgn #Tabu #HindiMovie #CrimeThriller #MysteryMovie #Thriller #Bollywood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515200/3515200_720p.mp4</video:content_loc>
      <video:duration>8377</video:duration>
      <video:publication_date>2026-10-04T21:00:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Kitten Watching Rain on Window | Cozy Rainy Day Sleep</video:title>
      <video:description>A tiny tabby kitten watches raindrops fall on the window on a cozy rainy evening. With big curious eyes, the kitten looks outside, then snuggles into a soft blue blanket and falls asleep peacefully by the warm window light. Super cute, calm, and cozy — perfect for relaxing and falling asleep. In this video: 🐱 Adorable tabby kitten by a rainy window 🌧️ Raindrops rolling down the glass 🕯️ Warm cozy light and peaceful evening mood 🧶 Kitten snuggling in a soft knit blanket 😴 Sleepy kitten falling asleep to the rain #cutekittenrain #kittenwatchingrainwindow #cozyrainydaycat #kittensleepingpeacefully #cutetabbykitten</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515199/3515199_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:58:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌳 **Cutting Huge Trees with Powerful Tools! 😲🪵**</video:title>
      <video:description>🌳 **Cutting Huge Trees with Powerful Tools! 😲🪵** Watch as massive tree trunks are cut into pieces using powerful tools and specialized equipment. This impressive job requires great effort, skill, precision, and patience! 💪🪚 See how these workers handle enormous pieces of wood and turn a difficult task into an amazing demonstration of hard work and technology. Would you try this challenging job? Let us know in the comments! 👇 👍 Like | 🔔 Subscribe | ❤️ Share #🌳CuttingHugeTreeswithPowerfulTools😲🪵</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515198/3515198_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T20:58:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animal Sounds Song 🐶🐱🐮 | Fun Learning Song for Toddlers &amp; Preschool Kids</video:title>
      <video:description>Welcome to a fun world of animal friends! 🐶🐱🐮🐰🐥 Animal Sounds for Kids is a fun and educational animal song where toddlers, preschoolers, and young children can sing, dance, and learn the sounds of their favorite animals. Can you bark like a puppy? 🐶 Woof, woof! Can you meow like a kitty? 🐱 Meow, meow! What does a cow say? 🐮 Moo, moo! And can you hear the little bird sing? 🐦 Tweet, tweet! Join our happy animal friends as we meet playful puppies, cute kittens, bouncing bunnies, colorful birds, elephants, ducks, frogs, cows, and more! This cheerful kids song helps young children learn: 🐾 Animal names 🎵 Animal sounds 👏 Rhythm and movement 🗣️ Listening and language skills 🐶 Kindness and caring for animals 🌈 Learning through music and play Clap your hands, stomp your feet, and sing along as we explore the wonderful world of animals! Perfect for toddlers, preschool children, kindergarten kids, families, classrooms, playtime, and early learning at home. Our songs are created to make learning simple, colorful, and fun. Through music, movement, repetition, and adorable animal characters, children can discover new words and sounds while enjoying a happy sing-along adventure. 🎶 Sing along with us: Woof, woof, woof! Meow, meow, meow! Tweet, tweet, tweet! Moo, moo, moo! Quack, quack, quack! Ribbit, ribbit! Which animal sound is your favorite? Keep singing, dancing, learning, and having fun with our animal friends. ❤️ Subscribe for more fun kids songs, nursery rhymes, educational songs, animal songs, toddler learning videos, and preschool adventures! #animalsoundsforkids #animalsoundssong #animalsongforkids #kidssongs #nurseryrhymes #songsforkids #toddlersongs #preschoolsongs #animalsounds #learnanimalsounds #animalsforkids #kidslearningsongs #educationalsongsforkids #toddlerlearning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515197/3515197_720p.mp4</video:content_loc>
      <video:duration>221</video:duration>
      <video:publication_date>2026-10-04T20:55:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT FOR END 😆</video:title>
      <video:description>Funny video #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515196/3515196_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T20:55:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>প্লাস্টিক</video:title>
      <video:description>প্লাস্টিক</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515195/3515195_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T20:55:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Selena Gomez And Benny Blanco Live Behind The Scenes</video:title>
      <video:description>How Selena Gomez And Benny Blanco Live Behind The Scenes #Luxury #Millionaire #Billionaire #Money #Viral #Expensive #Actors #Watches #Celebrities #Boats #Jets #Yachts #TheRichest #KingLuxury #Top10 #ExpensiveThings #MrLuxury #TopLuxury #Luxury #Millionaire #Billionaire #Money #Viral #Expensive #Actors #Watches #Celebrities #Boats #Jets #Yachts #TheRichest #KingLuxury #Top10 #ExpensiveThings #MrLuxury #TopLuxury #LuxuryKing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515194/3515194_720p.mp4</video:content_loc>
      <video:duration>1674</video:duration>
      <video:publication_date>2026-10-04T20:51:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Kung Fu Jungle Girl! 🐯 Riding a Giant Tiger | Prehistoric AI Animation Story</video:title>
      <video:description>Welcome to an epic journey into a mysterious, prehistoric world where nature is the only law! This is the story of &quot;Ira,&quot; a fearless tribal girl who wears clothes made entirely from large jungle leaves and vines. Her best friend and ultimate ride is a massive, royal Bengal tiger named Sheru. To protect their peaceful forest from dark forces, this unique duo begins to train together in the ancient art of Kung Fu and martial arts. Watch how a human girl and a wild tiger team up to unleash an unstoppable combat style! This breathtaking visual story is created using advanced AI animation tools. Don&apos;t miss the thrilling final battle! If you enjoyed this adventure, please Like, Share, and Subscribe to our channel for more epic AI stories! Let us know your thoughts in the comments below. #prehistoricgirlandtiger #leafdresstribalwoman #tigerridingactionscene #aikungfutraining #epicjunglebattle #ancientmartialartsstory #junglegirlwarrior #gianttigercompanion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515193/3515193_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T20:51:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😳 **Would You Trust This Engineering?**</video:title>
      <video:description>😳 **Would You Trust This Engineering?** Some engineering designs look absolutely incredible… until you see what could go wrong! 🤯🏗️ In this fascinating video, we take a closer look at an unbelievable engineering project that will make you question everything you thought you knew about construction, machines, and modern technology. Would you trust this design enough to stand near it? 👀 Watch until the end and decide for yourself! 🔥 👍 Like 🔔 Subscribe ❤️ Share with your friends</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515192/3515192_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T20:50:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angan Ep 2  Hindi dubbed full latest drama</video:title>
      <video:description>Angan Ep Hindi dubbed full latest drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515191/3515191_720p.mp4</video:content_loc>
      <video:duration>2281</video:duration>
      <video:publication_date>2026-10-04T20:48:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Funny video #Funnyvideo #funny #meme #comedy #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515190/3515190_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T20:48:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smart Cat 6</video:title>
      <video:description>Smart Cat #Animals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515189/3515189_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T20:47:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny videos 🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣</video:title>
      <video:description>#funnyfunnyvideosforyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515188/3515188_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T20:46:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Acts 161</video:title>
      <video:description>Acts 161</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515187/3515187_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T20:45:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515186</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515186/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Preview Battle Through The Heavens EPISODE 214</video:title>
      <video:description>Preview Donghua Battle Through The Heavens Season 5, Episode 214 #btth #xiaoyan #donghua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515186/3515186_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T20:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sapi nGamuk</video:title>
      <video:description>Sapi ngamuk #TravelHewan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515185/3515185_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T20:44:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Routines 🎉🎉 putting up beautiful room decorations</video:title>
      <video:description>Routines 🎉🎉 putting up beautiful room decorations #girls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515183/3515183_720p.mp4</video:content_loc>
      <video:duration>190</video:duration>
      <video:publication_date>2026-10-04T20:43:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dela apostolska 161</video:title>
      <video:description>Dela apostolska 161</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515182/3515182_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T20:43:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515181</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515181/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angan Ep 1  Hindi dubbed full latest drama</video:title>
      <video:description>Angan Ep 1 Hindi dubbed full latest drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515181/3515181_720p.mp4</video:content_loc>
      <video:duration>2205</video:duration>
      <video:publication_date>2026-10-04T20:43:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you all ❣️😘</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515180/3515180_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T20:39:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot; I Love The Netherlands#Utrecht#🙏🙏❤️</video:title>
      <video:description>I Love The Netherlands#Utrecht#🙏🙏❤️ #I #love #Netherlands</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515179/3515179_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-10-04T20:39:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King 👑 is Bling 👑 2</video:title>
      <video:description>Love you 🤟🏻😘🤟🏻🤟🏻🤟🏻🤟🏻😘😘😘😘😘😘😘</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515178/3515178_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T20:38:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515177</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515177/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Susbcribe 10</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515177/3515177_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T20:37:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515176</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515176/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WOW mind-blowing editing</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515176/3515176_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T20:37:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My first video 25</video:title>
      <video:description>#Just</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515175/3515175_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-10-04T20:36:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dima Maghrib Lion Logo Mugs</video:title>
      <video:description>Dima Maghrib Lion Logo Mugs order here: https://teechip.com/dima-maghrib-lion-logo?retailProductCode=24390940EEB4B2-EEEF8707F782-MSV0-TC1004-WHT #gabby williams #golden state valkyries #wnba #wnbaedit #women&apos;s basketball #basketball #art #kuroko no basket #kuroko&apos;s basketball #belly man #anime #artists on tumblr #bhm gainer #basketballpassingdrills #basketballfundamentals #basketballshootingtips #basketballfootworkdrills #basketballforbeginners #howtodunkabasketball #basketballtryoutstips #basketballdefensetips #basketballgamehighlights #basketballpracticeathome #basketballrulesexplained #nbahighlights #howtoshootabasketball #basketballdefense #basketballoffense #basketballtips #shootingdrills #youthbasketballdrills #ballhandlingdrills #basketballconditioning #basketballtrainingathome #basketballmovesforbeginners #basketballcoachtips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515174/3515174_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T20:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wow 😦😳</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑😍💗😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515173/3515173_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T20:35:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515172</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515172/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pusing karna pikiran? Ini cara menyadarinya</video:title>
      <video:description>Cara menyadari pikiran biar tenang dan jaga kesehatan mental #Motivasi #kesadaran #pikiran #kesehatanmental</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515172/3515172_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-10-04T20:35:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515171</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515171/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WOW 😳</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515171/3515171_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:34:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WOW 😲😳</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515170/3515170_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:33:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A IGREJA DOS GRITOS..</video:title>
      <video:description>Assustador</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515169/3515169_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-04T20:33:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you bro 💖😘 5</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨💖💖✨💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515168/3515168_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:33:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stylish basketball Fan T-shirt Mugs</video:title>
      <video:description>Stylish basketball Fan T-shirt Mugs order here: https://teechip.com/basketbal-dad?retailProductCode=24390940EEB4B2-6B9A9307F6C6-MSV2-TC1004-WHT #gabby williams #golden state valkyries #wnba #wnbaedit #women&apos;s basketball #basketball #art #kuroko no basket #kuroko&apos;s basketball #belly man #anime #artists on tumblr #bhm gainer #basketballtraining #basketballhighlights #basketballdribblingdrills #howtoplaybasketball #basketballworkout #basketballskills #basketballpassingdrills #basketballfundamentals #basketballshootingtips #basketballfootworkdrills #basketballforbeginners #howtodunkabasketball #basketballtryoutstips #basketballdefensetips #basketballgamehighlights #basketballpracticeathome #basketballrulesexplained #nbahighlights #howtoshootabasketball #basketballdefense #basketballoffense #basketballtips #shootingdrills #youthbasketballdrills #ballhandlingdrills #basketballconditioning #basketballtrainingathome #basketballmovesforbeginners #basketballcoachtips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515167/3515167_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T20:33:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515166</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515166/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What if titanoboa snake 🐍⛎</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨🙏🏻👼🏻🙏🏻👼🏻😊💕💕💕</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515166/3515166_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:32:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A VOZ DEBAIXO DA CAMA..</video:title>
      <video:description>Aterroriznte</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515165/3515165_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-04T20:32:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 🤟🏻😘 2</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗😍😍🥰🥰🥰🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515164/3515164_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T20:31:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A CRIANÇA QUE NÃO ESTAVA NO CEMITÉRIO.</video:title>
      <video:description>inesplicável</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515163/3515163_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T20:31:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A day in the life</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨💖💖✨💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515162/3515162_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T20:31:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515161</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515161/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OS TRÊS FAROLEIROS QUE DESAPARECERAM.</video:title>
      <video:description>Assustador</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515161/3515161_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-10-04T20:31:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you girl&apos;s 💓😘</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑💖💖✨💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515160/3515160_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T20:30:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot Episode 8 Kdrama in Hindi</video:title>
      <video:description>The Ordinary Jackpot Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515159/3515159_720p.mp4</video:content_loc>
      <video:duration>2770</video:duration>
      <video:publication_date>2026-10-04T20:30:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A FOTOGRAFIA NO TÚMULO.</video:title>
      <video:description>Arquivos malditos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515158/3515158_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-04T20:30:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Learn the tornado pen 🖋️</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨🙏🏻👼🏻🙏🏻👼🏻😊💕💕</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515157/3515157_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T20:30:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515155</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515155/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot Episode 7 Kdrama in Hindi</video:title>
      <video:description>The Ordinary Jackpot Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515155/3515155_720p.mp4</video:content_loc>
      <video:duration>2769</video:duration>
      <video:publication_date>2026-10-04T20:28:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ed Sheeran’s Funniest Stage Moment 😂⚽ | Balancing a Ball on Stage</video:title>
      <video:description>A fun and unexpected stage moment featuring Ed Sheeran showing off his playful side with a football. A memorable and entertaining moment for fans! 🎵⚽😂 #EdSheeran #EdSheeranfunny #EdSheeranlive #EdSheeranconcert #EdSheeranstage #EdSheeranperformance #EdSheeranfootball #EdSheeranfunnymoment #EdSheeranfans #singerperformance #liveconcert #funnyconcertmoment #footballtrick #celebritymoment #musicentertainment️⃣HashtagsEdSheeranEdSheeranLiveEdSheeranConcertEdSheeranFansFunnyMomentConcertLivePerformanceFootballMusicViral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515154/3515154_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-10-04T20:27:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m with the tiger</video:title>
      <video:description>AI content video #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515153/3515153_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T20:26:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot Episode 6 Kdrama in Hindi</video:title>
      <video:description>The Ordinary Jackpot Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515152/3515152_720p.mp4</video:content_loc>
      <video:duration>2676</video:duration>
      <video:publication_date>2026-10-04T20:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m not asking to shake hands—please just get me the hammer.</video:title>
      <video:description>At the beginning of the story, a white cat loses some of its fur and asks an orange cat for help, but the orange cat doesn&apos;t understand. #funnycatcomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515151/3515151_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T20:26:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desi Beautiful Model - Sensational Hot Reel Video</video:title>
      <video:description>Desi Beautiful Model - Sensational Hot Reel Video #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #Sensational #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515150/3515150_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-04T20:25:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BRUNO MELLO E MALUKINHO</video:title>
      <video:description>#Forró #PISEIRO #música</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515149/3515149_720p.mp4</video:content_loc>
      <video:duration>146</video:duration>
      <video:publication_date>2026-10-04T20:25:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>لو الحب لسه موجود… بس الاهتمام اختفى، هتكمّل ولا تمشي؟ 💔.mp4</video:title>
      <video:description>Uploading لو الحب لسه موجود… بس الاهتمام اختفى، هتكمّل ولا تمشي؟ 💔.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515148/3515148_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T20:25:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot Episode 5 Kdrama in Hindi</video:title>
      <video:description>The Ordinary Jackpot Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515146/3515146_720p.mp4</video:content_loc>
      <video:duration>2800</video:duration>
      <video:publication_date>2026-10-04T20:24:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New model 2</video:title>
      <video:description>New model sort video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515145/3515145_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T20:23:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>زبان کا لگا ہوا زخم</video:title>
      <video:description>زبان کا لگا ہوا زخم</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515144/3515144_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T20:23:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 16</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515143/3515143_720p.mp4</video:content_loc>
      <video:duration>4070</video:duration>
      <video:publication_date>2026-10-04T20:21:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 15</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515142/3515142_720p.mp4</video:content_loc>
      <video:duration>4262</video:duration>
      <video:publication_date>2026-10-04T20:21:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 14</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515141/3515141_720p.mp4</video:content_loc>
      <video:duration>4115</video:duration>
      <video:publication_date>2026-10-04T20:21:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 13</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515140/3515140_720p.mp4</video:content_loc>
      <video:duration>4010</video:duration>
      <video:publication_date>2026-10-04T20:21:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 12</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515139/3515139_720p.mp4</video:content_loc>
      <video:duration>4077</video:duration>
      <video:publication_date>2026-10-04T20:21:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 11</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515138/3515138_720p.mp4</video:content_loc>
      <video:duration>3967</video:duration>
      <video:publication_date>2026-10-04T20:21:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 10</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515137/3515137_720p.mp4</video:content_loc>
      <video:duration>3724</video:duration>
      <video:publication_date>2026-10-04T20:21:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 9</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515136/3515136_720p.mp4</video:content_loc>
      <video:duration>4344</video:duration>
      <video:publication_date>2026-10-04T20:21:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 8</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515135/3515135_720p.mp4</video:content_loc>
      <video:duration>3781</video:duration>
      <video:publication_date>2026-10-04T20:21:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 7</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515134/3515134_720p.mp4</video:content_loc>
      <video:duration>4109</video:duration>
      <video:publication_date>2026-10-04T20:21:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 6</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515133/3515133_720p.mp4</video:content_loc>
      <video:duration>4009</video:duration>
      <video:publication_date>2026-10-04T20:20:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 5</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515132/3515132_720p.mp4</video:content_loc>
      <video:duration>3711</video:duration>
      <video:publication_date>2026-10-04T20:20:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 4</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515131/3515131_720p.mp4</video:content_loc>
      <video:duration>3703</video:duration>
      <video:publication_date>2026-10-04T20:20:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aunque tengas miedo, confía en Dios</video:title>
      <video:description>Tema: La fe en los momentos difíciles. #emaLafeenlosmomentosdifícilesPersonajesJesús #PedroylosdiscípulosDuración45–60segundos🎬Escena1LatormentainesperadaNarradorUnanoche #JesúsysusdiscípulosnavegabanporelmarcuandounafuertetormentacomenzóasacudirlabarcaLasolasentrabanyelvientoparecíahundirlosPedrogritando¡Señor #despierta¡Vamosamorir¿NovesqueestamosenpeligroJesúslevantándoseconserenidad¿Porquétienentantomiedo¿Todavíanotienenfe🎬Escena2ElpoderdelafeNarradorJesússelevantóyordenóalvientoyalmarquesecalmaranDeinmediato #latormentadesaparecióyunagrantranquilidadcubriólasaguasPedrosorprendido¿Quiéneseste #quehastaelvientoyelmarleobedecenJesúsNotemasConfíaenmí #inclusocuandonocomprendasloqueestásucediendo🙏ReflexiónfinalNarradorAveces #nuestravidatambiénpareceunatormentaTenemosproblemasfamiliares #dificultadeseconómicas #tristezaymomentosenlosquesentimosqueyanopodemosmásPerorecuerdaDiosnosiemprecalmalatormentainmediatamentetambiénpuededartelafuerzaparaatravesarlaCuandosientasmiedo #oraCuandoestéscansado #confíaYcuandonoencuentresunasalida #nopierdaslafe📖“¿Porquétenéismiedo #hombresdepocafe”—Mateo826MensajefinalSihoyestásatravesandounatormenta #escribe“Señor #confíoenti”🙏❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515130/3515130_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-10-04T20:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 3</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515129/3515129_720p.mp4</video:content_loc>
      <video:duration>4111</video:duration>
      <video:publication_date>2026-10-04T20:20:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 2</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515128/3515128_720p.mp4</video:content_loc>
      <video:duration>3827</video:duration>
      <video:publication_date>2026-10-04T20:20:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 1</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515127/3515127_720p.mp4</video:content_loc>
      <video:duration>4163</video:duration>
      <video:publication_date>2026-10-04T20:20:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E446 28th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E446 28th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515126/3515126_720p.mp4</video:content_loc>
      <video:duration>1340</video:duration>
      <video:publication_date>2026-10-04T20:20:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny Black Cat Raises Its Paws Like a Tiny Boxer 😂🐈‍⬛</video:title>
      <video:description>This adorable black cat suddenly raises its paws and looks ready for a little fight! 😂🐾 Such a funny and cute moment that will make any cat lover smile. #blackcat #funnycat #cutecat #catvideo #funnyanimal #adorablecat #catlover #cuteanimals #catmeme #funnypets #blackkitten #catreaction #playfulcat #viralcatvideo #funnykitten #petvideo️⃣HashtagsBlackCatFunnyCatCuteCatCatVideoCatLoverFunnyAnimalsCatMemeCuteAnimalsKittenViralCat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515125/3515125_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-10-04T20:20:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours Episode 6 Kdrama in Hindi</video:title>
      <video:description>A Love Other Than Yours Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515124/3515124_720p.mp4</video:content_loc>
      <video:duration>3861</video:duration>
      <video:publication_date>2026-10-04T20:19:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot Desi Shivani Arora - Desire video</video:title>
      <video:description>Hot Desi Shivani Arora - Desire video #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Shivani #Arora #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515123/3515123_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T20:18:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saúde da mulher</video:title>
      <video:description>Dicas interessantes para a saúde da mulher #Saúdesaúdesaudavel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515122/3515122_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T20:16:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy day 15</video:title>
      <video:description>My trip my everything #Mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515121/3515121_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T20:16:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SINAIS QUE DEUS ESTÁ TE PREPARANDO.....  #motivacional #mensagem</video:title>
      <video:description>Talvez você esteja vivendo o momento mais confuso da sua vida… Nada saiu como você planejou. Portas se fecharam. Pessoas se afastaram. E você começou a se perguntar em silêncio: “Deus… o Senhor ainda está comigo?” Mas e se tudo isso não for rejeição? E se for preparação? #oração #família #Deus #Fé #Jesus #inspiração #superação #bíblia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515120/3515120_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T20:15:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours Episode 5 Kdrama in Hindi</video:title>
      <video:description>A Love Other Than Yours Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515119/3515119_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T20:15:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E445 27th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E445 27th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515118/3515118_720p.mp4</video:content_loc>
      <video:duration>1345</video:duration>
      <video:publication_date>2026-10-04T20:14:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E444 26th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E444 26th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515117/3515117_720p.mp4</video:content_loc>
      <video:duration>1315</video:duration>
      <video:publication_date>2026-10-04T20:14:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E443 25th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E443 25th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515116/3515116_720p.mp4</video:content_loc>
      <video:duration>1325</video:duration>
      <video:publication_date>2026-10-04T20:14:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CR7 end era</video:title>
      <video:description>Cristiano Ronaldo leave the Portugal national team #cristianoronaldo #realmadrid #fyp #manchesterunited #portugal #CR7 #CristianoRonaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515115/3515115_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-04T20:13:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masih banyak yang lebih capek dari kita, jangan lupa bersyukur guys 🥀😭</video:title>
      <video:description>Masih banyak yang lebih capek dari kita, jangan lupa bersyukur guys 🥀😭 #Forrall</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515114/3515114_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T20:11:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New student becomes number one 2 part1</video:title>
      <video:description>This is just for entertainment, please forgive me if there are similarities in names or anything else.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515113/3515113_720p.mp4</video:content_loc>
      <video:duration>249</video:duration>
      <video:publication_date>2026-10-04T20:10:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coba tulis pesan buat ibu,  Tapi janji jangan nangis yah 🥹</video:title>
      <video:description>Coba tulis pesan buat ibu, Tapi janji jangan nangis yah 🥹 #mymomm</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515112/3515112_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T20:10:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Routines 🎉🎉 Fresh out of the shower, I immediately got all dolled up 💄💋👑 to look stunning</video:title>
      <video:description>Routines 🎉🎉 Fresh out of the shower, I immediately got all dolled up 💄💋👑 to look stunning #girls #girlsroutineslookcute</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515111/3515111_720p.mp4</video:content_loc>
      <video:duration>246</video:duration>
      <video:publication_date>2026-10-04T20:09:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mengenalnya tanpa sengaja, Melupakannya hampir gila 🥀🥹</video:title>
      <video:description>Mengenalnya tanpa sengaja, Melupakannya hampir gila 🥀🥹 #fyppppp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515110/3515110_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T20:09:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny animals 189</video:title>
      <video:description>You can see the live ofsmart dog when his start to do his usually activities at home it funny and educative #Gag</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515109/3515109_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T20:08:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Satu pesan buat ayah🥲</video:title>
      <video:description>Satu pesan buat ayah yang sedang bekerja atau di mana pun #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515108/3515108_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-04T20:08:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hemmm 2</video:title>
      <video:description>Galau dikit nihh #Fypsad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515107/3515107_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T20:06:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy day 14</video:title>
      <video:description>My happy day #Mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515106/3515106_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T20:04:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atmospheric Sci Fi Ambient Fantasy Music</video:title>
      <video:description>Experience serene and otherworldly soundscape designed for deep study, relaxation, and immersion in atmospheric soundscapes. From ambient and space music to soothing melodies ideal for meditation, each track offers a journey through sci-fi-inspired realms reminiscent of Cyberpunk 2077 and Bladerunner. Whether you seek peaceful background music to enhance focus or dark, futuristic compositions for escape, this selection, crafted by a dedicated composer, invites you to explore the depths of imagination and tranquility. #spacemusiccosmosmusicambientmusicbackgroundmusicrelaxingmusicscifisoundscapemeditationmeditationmusicpeacefulmusiccyberpunk2077cyberpunkbladerunnersoothingsoothingmusicsoftmusicstudymusicstudyfocusmusicfocusstudymotivationsciencefictionmusiccomposerdarkmusicfuturisticmusicescapeambientspace</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515105/3515105_720p.mp4</video:content_loc>
      <video:duration>7149</video:duration>
      <video:publication_date>2026-10-04T20:03:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orang terdekatmu</video:title>
      <video:description>Kebanyakan #Paris #canada #kindomunited</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515104/3515104_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T20:03:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nerve Health &amp; Nerve Function Support Supplement – 60 Capsules</video:title>
      <video:description>NerveSoothe Advanced Nerve Support – 60 Capsules is a dietary supplement formulated to support nerve health and normal nerve function. Its advanced nerve support formula is designed for individuals looking to maintain overall nerve wellness as part of a balanced lifestyle. Key Features: Supports healthy nerve function. Promotes overall nerve wellness. Advanced nerve support formula. Convenient 60-capsule bottle. Easy to incorporate into your daily wellness routine. Disclaimer: This product is a dietary supplement and is not intended to diagnose, treat, cure, or prevent any disease. Follow the product label for usage instructions. https://secure.getnervesoothe.com/index-bp-ds#aff=Mrguyz #nervesoothe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515103/3515103_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T20:03:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O AVIÃO QUE SUMIU DO MAPA</video:title>
      <video:description>assustador</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515102/3515102_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T20:02:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A IGREJA ONDE NINGUÉM QUERIA FICAR.</video:title>
      <video:description>terror</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515101/3515101_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T20:01:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kungfu cat 6</video:title>
      <video:description>Kungfu cat #cat #funny #kungfu #cutecat #funnycat #animal #ai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515100/3515100_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T20:00:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy Day 2</video:title>
      <video:description>Happy day #Mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515099/3515099_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T19:59:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 374</video:title>
      <video:description>Komedy cat funny #funnycatkomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515098/3515098_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T19:59:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Village Life 15</video:title>
      <video:description>Experience a scenic animated story depicting the charm, hard work, and warmth of village life on a rainy day. From working in the muddy rice fields under a sudden monsoon storm to preparing a fresh, comforting meal over a traditional clay stove, this video highlights the beautiful simplicity of rural living #VillageLife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515097/3515097_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-10-04T19:57:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TYRANNOSAURUS REX — THE TRUE KING</video:title>
      <video:description>Length: 12.4m · Weight: 9 tons Bite force: 57,000N — strongest of any land animal ever! #TyrannosaurusDinosaurPaleontology</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515096/3515096_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T19:56:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>moeda 40</video:title>
      <video:description>Moeda antiga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515095/3515095_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T19:54:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I went a rickshaw tour</video:title>
      <video:description>Today i went in main.dhaka for an.emergency work and after a lot of time i went there by rickshaw and.that eas an.amazing journey #Dhaka #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515094/3515094_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:54:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio call cantik</video:title>
      <video:description>Vidio call neng cantik yang bikin ngiler #Vidiocallhot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515093/3515093_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-10-04T19:54:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Road of Avalonian Expedition - Official Cinematic Trailer</video:title>
      <video:description>​Follow the epic tale of a brave warrior battling giant golems, exploring mysterious caves, navigating dark dungeons, and discovering tranquil fantasy landscapes. From dark, fiery grounds to peaceful lotus ponds and vibrant forests, witness an unforgettable journey filled with magic, peril, and hope. ​🔹 Game/Project: Road of Avalonian Expedition 🔹 Genre: Fantasy / Action / Exploration / Cinematic Showcase ​If you enjoyed this cinematic story, don&apos;t forget to Like, Comment, and Subscribe for more updates and epic fantasy adventures! 🎮🔥 ​#RoadOfAvalonianExpedition #AvalonianExpedition #FantasyGame #CinematicTrailer #RobloxShowcase #IndieGame #EpicFantasy #GameTrailer #Fantasyworldshowcase #Robloxaestheticenvironment #3Dactionadventuretrailer #Magicalworldwalkthrough #Fantasygameenvironmentdesign #RobloxRPGshowcase #Cinematicgamestory #VirtualfantasyadventureRoadofAvalonianExpedition #RoadofAvalonianExpeditiontrailer #AvalonianExpedition #Fantasygamecinematic #Robloxfantasytrailer #Robloxcinematicshowcase #Epicwarriorfantasygame #Golembattlegame #FantasyRPGtrailer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515092/3515092_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:54:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relatos reais</video:title>
      <video:description>assustador não assista sozinho.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515091/3515091_720p.mp4</video:content_loc>
      <video:duration>834</video:duration>
      <video:publication_date>2026-10-04T19:52:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freefire 34</video:title>
      <video:description>Freefire gameplay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515090/3515090_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:52:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy dance of nicky</video:title>
      <video:description>https://www.febspot.com/ref/1217291/</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515089/3515089_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:51:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kisah kita</video:title>
      <video:description>#Cinta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515088/3515088_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T19:51:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mar Del Plata Beach A Happy Day</video:title>
      <video:description>Mar Del Plata Beach A Happy Day #Mar #Del #PlataBeach #AHappy #Day</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515087/3515087_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T19:51:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Four Hands, Two Sonatas (2026) Ep 12 Finale - Eng Sub</video:title>
      <video:description>{2026} Four Hands, Two Sonatas _ EP. 12</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515086/3515086_720p.mp4</video:content_loc>
      <video:duration>3708</video:duration>
      <video:publication_date>2026-10-04T19:50:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Never imitate how women talk if you don&apos;t want to experience something like this 🤣</video:title>
      <video:description>funny video #Comedy #funnyvideo #meme #Slapstick #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515085/3515085_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T19:47:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You’ll Regret Losing Me 💔 | Sad Revenge Song | Emotional Pop/R&amp;B sad song</video:title>
      <video:description>“You’ll Regret Losing Me” is a powerful sad emotional Pop/R&amp;B song about heartbreak, betrayal, losing someone you loved, and finding the strength to rise again. You thought I would break when you walked away. You thought I would spend my life waiting for you. But sometimes the deepest heartbreak becomes the reason we become stronger. 💔 You broke my heart. 🔥 I found my strength. 🖤 And one day, you’ll regret losing me. If you’ve ever been betrayed, abandoned, or made to feel like you weren’t enough, this song is for you. 🎧 Listen with headphones and feel every emotion. ❤️ Like • 💬 Comment • 🔔 Subscribe to **Songiter Bane** for more sad emotional Pop, R&amp;B, heartbreak, revenge and powerful love songs. #YoullRegretLosingMe #sadrevengesong #emotionalrevengesong #heartbreaksong #sademotionalsong #emotionalpopsong #emotionalRB #sadRBsong #breakupsong #betrayalsong #revengebreakupsong #movingonsong #youbrokemesong #powerfulheartbreaksong #lostlovesong #brokenheartsong #sadlovesong #emotionalmalevocal #deepemotionalmusic #painfullovesong #songsaboutbetrayal #songsaboutmovingon #songsaboutbeinghurt #powerfulemotionalsong #cinematicheartbreaksong #modernPopRB #newemotionalsong2026 #motivationalheartbreaksong #relationshipbreakupsong #SongiterBane</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515084/3515084_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-10-04T19:47:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You’ll Regret Losing Me 💔 | Sad Revenge Song | Emotional Pop/R&amp;B</video:title>
      <video:description>“You’ll Regret Losing Me” is a powerful sad emotional Pop/R&amp;B song about heartbreak, betrayal, losing someone you loved, and finding the strength to rise again. You thought I would break when you walked away. You thought I would spend my life waiting for you. But sometimes the deepest heartbreak becomes the reason we become stronger. 💔 You broke my heart. 🔥 I found my strength. 🖤 And one day, you’ll regret losing me. If you’ve ever been betrayed, abandoned, or made to feel like you weren’t enough, this song is for you. 🎧 Listen with headphones and feel every emotion. ❤️ Like • 💬 Comment • 🔔 Subscribe to **Songiter Bane** for more sad emotional Pop, R&amp;B, heartbreak, revenge and powerful love songs. #YoullRegretLosingMe #sadrevengesong #emotionalrevengesong #heartbreaksong #sademotionalsong #emotionalpopsong #emotionalRB #sadRBsong #breakupsong #betrayalsong #revengebreakupsong #movingonsong #youbrokemesong #powerfulheartbreaksong #lostlovesong #brokenheartsong #sadlovesong #emotionalmalevocal #deepemotionalmusic #painfullovesong #songsaboutbetrayal #songsaboutmovingon #songsaboutbeinghurt #powerfulemotionalsong #cinematicheartbreaksong #modernPopRB #newemotionalsong2026 #motivationalheartbreaksong #relationshipbreakupsong #SongiterBane</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515083/3515083_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-04T19:47:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515082</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515082/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senja indah</video:title>
      <video:description>Senja indah cuma kurang #Sadvibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515082/3515082_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T19:46:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinematic video 6</video:title>
      <video:description>Cinematic video #Cinematicvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515081/3515081_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:46:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hujan 16</video:title>
      <video:description>Menunggu castemer datang #Cukurrambut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515080/3515080_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:46:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#sadvibes</video:title>
      <video:description>😭😭😭😭 #Sadvibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515079/3515079_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:45:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hero Dives Into The Sea To Free A Turtle</video:title>
      <video:description>While sailing through the Baa Atoll in the Maldives, a boat captain spotted a turtle struggling in the ocean. A passenger quickly grabbed his mask and fins and jumped into the water to help. The exhausted turtle was badly tangled in a fishing net, so he brought it back to the boat where the crew carefully cut the net away. After being freed, the turtle was returned to the ocean and successfully swam away. A beautiful rescue and an important reminder of the danger discarded fishing gear can pose to marine wildlife. #turtle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515078/3515078_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-04T19:45:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kenapa Rezeki Terasa Selalu Kurang?.</video:title>
      <video:description>#shorts #shortsislami #surahattalaq #hikmahkehidupan #pengingatdiri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515077/3515077_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T19:45:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mengajari anak sholat</video:title>
      <video:description>Biasakam mengajari anakmu untuk sholat #Sholat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515076/3515076_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T19:44:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perbaikan jalan raya</video:title>
      <video:description>Perbaikan raya di cor ulang #Proyekjalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515075/3515075_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T19:43:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sunset 108</video:title>
      <video:description>Sunset view</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515074/3515074_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T19:43:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gunung Gayatri - Official Roblox Nature &amp; Exploration Showcase</video:title>
      <video:description>Discover lush tropical forests, peaceful river streams, hidden waterfalls, and beautiful mountain views alongside cute yellow-outfitted adventurers. Take a relaxing walk through nature and experience the calming aesthetic atmosphere! ​🔹 Game/Location: Gunung Gayatri (Roblox) 🔹 Theme: Exploration / Nature Showcase / Aesthetic Adventure ​If you enjoyed this cinematic Roblox journey, please Like, Comment, and Subscribe for more showcase videos! 🎮✨ ​#GunungGayatri #RobloxShowcase #RobloxNature #RobloxAesthetic #RobloxAdventure #VirtualExploration #RobloxIndonesia #Robloxcuteavatars #Robloxtropicalforestmap #AestheticRobloxgame #Robloxscenicview #Robloxworldshowcase #Robloxvirtualnature #Robloxrealisticenvironment #RobloxriverwaterfallmapGunungGayatri #GunungGayatriRoblox #Robloxnatureshowcase #Robloxaestheticenvironment #Robloxhikingtrail #Robloxexplorationvideo #Robloxcinematicshowcase #Robloxlandscapeshowcase #Robloxmountainadventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515073/3515073_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:42:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diving into the waterfall 🥰 #travel #hagiangloop #waterfall</video:title>
      <video:description>Diving into the waterfall 🥰 #travel #hagiangloop #waterfall #Diving #into #thewaterfall #travel #hagiangloop #waterfall</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515072/3515072_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T19:42:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sad ending 😩</video:title>
      <video:description>He had tried repeatedly to start the machine but could not, and finally the machine had to end up in the fireplace. 🤭 #Comedy #funnyvideo #meme #funny #Slapstick</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515071/3515071_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T19:41:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 Powerful K-Pop Group Choreography | Insane Dance Performance</video:title>
      <video:description>A high-energy K-pop dance performance featuring powerful moves, synchronized choreography, and dynamic stage moments. From dance practice to live performance, the energy is incredible! 🔥🎶 #kpop #k-pop #kpopdance #kpopchoreography #kpopgroup #groupdance #danceperformance #dancepractice #synchronizeddance #koreanpop #koreandance #idolperformance #livestage #stageperformance #powerfulchoreography #energeticdance #dancevideo #kpopfans #viraldance #trendingkpop️⃣HashtagsKpopKPopDanceKpopChoreographyDancePracticeGroupDanceDancePerformanceKpopGroupKoreanPopStagePerformanceKpopFans</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515070/3515070_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:40:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Air terjun 14</video:title>
      <video:description>Udah lama gak sini, Minggu depan kayaknya gasin dong kesini👍😍 #Airterjun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515069/3515069_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:40:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>First Dragon Season 1 Episode 1 In Hindi</video:title>
      <video:description>Enjoy #FirstDragon #Anime #HindiAnime #SpiritsAnime #AnotherWorldAnime #TeleportAnime #MagicAnime #SoldierAnime #TeleportSoldierAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515068/3515068_720p.mp4</video:content_loc>
      <video:duration>953</video:duration>
      <video:publication_date>2026-10-04T19:38:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asmr styrofoam plastic glass</video:title>
      <video:description>Asmr glass plastic styrofoam #Asmr #asmrglass #plasticasmr #glassplasticasmr #asmrshorts #asmrrelaxing #asmrsatisfying #asmrsleep #asmr2026 #asmrcrinkles #styrofoamplastic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515067/3515067_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T19:37:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mesin</video:title>
      <video:description>pabric</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515066/3515066_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T19:37:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Expedition Ketenangan - Official Fantasy Environment Showcase</video:title>
      <video:description>Embark on a peaceful journey into the magical world of Expedition Ketenangan! 🌿✨ ​Discover serene forests, glowing flora, mystical waterfalls, and tranquility hidden deep within enchanted lands. Relax as you explore vibrant nature scenes designed to bring true peace and calm to your mind. ​🔹 Title: Expedition Ketenangan 🔹 Genre: Fantasy / Relaxation / Nature Exploration ​If you enjoyed this serene fantasy showcase, please Like, Comment, and Subscribe for more magical world explorations! 🍃✨ ​#ExpeditionKetenangan #FantasyWorld #RelaxingEnvironment #GameEnvironment #CinematicTrailer #NatureExploration #Tranquility #ExpeditionKetenangan #ExpeditionKetenanganvideogame #Relaxingfantasyenvironment #Tranquilnaturewalkthrough #Mysticalforestshowcase #Peacefulgamescenery #Cinematicfantasylandscape #Serenegameenvironment #Magicforestexploration</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515065/3515065_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:37:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belum top speed</video:title>
      <video:description>Inova 2kd #Inovatoyota</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515064/3515064_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T19:37:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 Crocodile Challenge Gone WILD! 🐊😱 She Finished the ENTIRE Course! 💪🔥</video:title>
      <video:description>🔥 Crocodile Challenge Gone WILD! 🐊😱 She Finished the ENTIRE Course! 💪🔥 #Viral #Trending #Trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515063/3515063_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:35:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 11th</video:title>
      <video:description>Lovely act #Nextcomingup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515062/3515062_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-10-04T19:35:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>homes</video:title>
      <video:description>house</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515061/3515061_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:35:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wibawa</video:title>
      <video:description>Sangat mengesankan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515060/3515060_720p.mp4</video:content_loc>
      <video:duration>255</video:duration>
      <video:publication_date>2026-10-04T19:35:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cool Lovely act</video:title>
      <video:description>😭😭😭😭 #😒😘</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515059/3515059_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T19:34:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>driver 4</video:title>
      <video:description>tyota</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515058/3515058_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:34:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 10th</video:title>
      <video:description>Nice #Lovelyact</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515057/3515057_720p.mp4</video:content_loc>
      <video:duration>130</video:duration>
      <video:publication_date>2026-10-04T19:33:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terikat janji full</video:title>
      <video:description>Berisi film #Film</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515056/3515056_720p.mp4</video:content_loc>
      <video:duration>3010</video:duration>
      <video:publication_date>2026-10-04T19:33:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 9th</video:title>
      <video:description>Nice #Lovelyact</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515055/3515055_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-10-04T19:32:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Till The End Of The Moon EP 14 Hindi DubbedNew Chinese Drama</video:title>
      <video:description>यह चैनल उन लोगों के लिए है जो चाहते हैं ड्रामा, इमोशन और सस्पेंस एक साथ। यहाँ आपको मिलेंगी बेहतरीन हिंदी शॉर्ट फिल्में और डब्ड चाइनीज़ ड्रामे, जो दिल को छू जाएँ और दिमाग को हिला दें! हर एपिसोड में मिलेगा रोमांच, जज़्बात और ज़िंदगी का एक नया रंग। उच्च गुणवत्ता वाले विजुअल्स, जबरदस्त एक्टिंग और ऐसी कहानियाँ जो आपको अंत तक बाँधकर रखें! 💥 रोज़ नए एपिसोड 🎬 सच्चे जज़्बात, पूरा मनोरंजन ❤️ रोमांस, इमोशन और फैंटेसी से भरपूर कहानी 🔔 सब्सक्राइब करें और घंटी दबाएँ – ताकि आपका अगला पसंदीदा एपिसोड मिस न हो! Till the End of the Moon Till the End of the Moon एक शानदार चीनी फैंटेसी, रोमांटिक और ऐतिहासिक ड्रामा है, जिसमें प्यार, बलिदान, जादू, किस्मत और अच्छाई-बुराई के बीच एक रोमांचक जंग देखने को मिलती है। कहानी एक ऐसी दुनिया की है जहाँ एक शक्तिशाली दानव देवता पूरी दुनिया को तबाह करने की कगार पर होता है। भविष्य को बचाने के लिए एक बहादुर युवती अतीत में वापस जाती है, ताकि उस इंसान की जिंदगी बदल सके जो आगे चलकर विनाश का कारण बनने वाला है। लेकिन जैसे-जैसे वह उसके करीब आती है, दोनों के बीच नफरत, गलतफहमियों और संघर्ष के बावजूद एक अनोखा रिश्ता बनने लगता है। प्यार और किस्मत की यह कहानी उन्हें ऐसे फैसलों के सामने खड़ा कर देती है, जहाँ एक तरफ पूरी दुनिया का भविष्य है और दूसरी तरफ उनका दिल। #KDrama #KDramaEdit #KoreanDrama #KDramaLover #KoreanSeries #KDramaAddict #ViralKDrama #KDramaClips #KDramaRomance #RomanticKDrama #KDramaCuteMoments #KDramaSadScene #KDramaAction #KDramaFunny #FacebookReels #TrendingReels #ViralVideo #FBReels #WatchNow #MustWatch #KDramaLoversKDramaLover #KDramaScene #KDramaStory #KoreanDramaClips #BestKDramaScenes #KDramaMoments #KDramaReels #KDramaHighlights #DramaClips #EmotionalScene #KDramaStatus #SadKDrama #PlotTwist #KDramaShorts #HindiDubbedKDrama #HindiDubbed #UrduDubbed #KDramaInHindi #DramaHouse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515054/3515054_720p.mp4</video:content_loc>
      <video:duration>3344</video:duration>
      <video:publication_date>2026-10-04T19:32:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jelig</video:title>
      <video:description>oilkit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515053/3515053_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T19:32:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Decorative tea cups and kettle set</video:title>
      <video:description>Decorative tea cups and pot set #cupandkettleset #useful #subscribe #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515052/3515052_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:32:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wali - Yank</video:title>
      <video:description>fingerstyle cover #fingerstyle #alifbata #wali #yank</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515051/3515051_720p.mp4</video:content_loc>
      <video:duration>161</video:duration>
      <video:publication_date>2026-10-04T19:32:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen</video:title>
      <video:description>Nice one #Lovely</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515050/3515050_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-10-04T19:32:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>noodle</video:title>
      <video:description>foody</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515049/3515049_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:31:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quranic verse 2</video:title>
      <video:description>Quranic verse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515048/3515048_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T19:30:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 7th</video:title>
      <video:description>Nice #Sweet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515047/3515047_720p.mp4</video:content_loc>
      <video:duration>115</video:duration>
      <video:publication_date>2026-10-04T19:30:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>foody</video:title>
      <video:description>eatss</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515046/3515046_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:30:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 KIM JINWOO | Powerful Stage Performance</video:title>
      <video:description>An energetic K-pop dance performance featuring synchronized choreography, powerful movements, and an amazing stage atmosphere. The crowd and colorful LED visuals make this performance even more exciting! 🔥🎶 #kpop #k-popdance #kpopperformance #danceperformance #groupchoreography #kpopchoreography #synchronizeddance #stageperformance #koreandance #idolperformance #liveperformance #dancestage #kpopconcert #amazingchoreography #powerfuldance #dancecover #kpopfans #koreanpop #entertainment #viraldance️⃣HashtagsKpopKPopDanceDancePerformanceKpopChoreographyGroupDanceStagePerformanceKpopConcertDanceKoreanPopViralDance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515045/3515045_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T19:29:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Men will always give in to women, even if they are right.😭</video:title>
      <video:description>The man punished his woman for the first time, but the woman did not want to be punished and even though the man finally punished her, the man then apologized and persuaded her not to be angry for too long. #Funnyvideo #comedy #humor #Slapstick #meme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515044/3515044_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:29:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bride 40</video:title>
      <video:description>The Bride</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515043/3515043_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:29:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>라떼는 말이야 (ratte-neun mariya)</video:title>
      <video:description>I&apos;m a musician from Indonesia who loves turning lyrics into music. This is my latest experimental K-Pop project — hope you guys love it! #Newsongs #KPopeksperimental #musicdigital #originalsongs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515042/3515042_720p.mp4</video:content_loc>
      <video:duration>183</video:duration>
      <video:publication_date>2026-10-04T19:29:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TôO NA VELOCIDADE MAXIMA NO GT RIVALS!</video:title>
      <video:description>RANK B é muito bom com dooge #GTRIVALS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515041/3515041_720p.mp4</video:content_loc>
      <video:duration>138</video:duration>
      <video:publication_date>2026-10-04T19:28:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prayer for well-being in this world and the Hereafter.</video:title>
      <video:description>Prayer for well-being in this world and the Hereafter.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515040/3515040_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T19:28:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lovex3 (2026) Ep 8 - Eng Sub</video:title>
      <video:description>Lovex3 Episode 8</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515039/3515039_720p.mp4</video:content_loc>
      <video:duration>3311</video:duration>
      <video:publication_date>2026-10-04T19:28:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fortk</video:title>
      <video:description>karton</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515038/3515038_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T19:27:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doa2 buat diri kita sendiri</video:title>
      <video:description>Semoga djabahh 🤲😇</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515037/3515037_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-10-04T19:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Most Beautiful Names of Allah</video:title>
      <video:description>The Most Beautiful Names of Allah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515036/3515036_720p.mp4</video:content_loc>
      <video:duration>196</video:duration>
      <video:publication_date>2026-10-04T19:26:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>carss 3</video:title>
      <video:description>cargo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515035/3515035_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:25:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bebas 3</video:title>
      <video:description>Populerrr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515034/3515034_720p.mp4</video:content_loc>
      <video:duration>233</video:duration>
      <video:publication_date>2026-10-04T19:24:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>my friends 2</video:title>
      <video:description>famiys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515033/3515033_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T19:23:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>house</video:title>
      <video:description>home</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515032/3515032_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T19:22:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dive into You (2026) Ep 4 - Eng Sub</video:title>
      <video:description>EP. 4 DIVE INTO YOU (2026) _ ENG SUB _ Romance_Comed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515031/3515031_720p.mp4</video:content_loc>
      <video:duration>3697</video:duration>
      <video:publication_date>2026-10-04T19:22:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>santai boys</video:title>
      <video:description>driver</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515030/3515030_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T19:21:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qui luta</video:title>
      <video:description>Um ótimo filme 👍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515029/3515029_720p.mp4</video:content_loc>
      <video:duration>209</video:duration>
      <video:publication_date>2026-10-04T19:20:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kekasih 2</video:title>
      <video:description>Sangat menarik penonton</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515028/3515028_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T19:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>drama cinta</video:title>
      <video:description>reformasi everprosper episod.13</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515027/3515027_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-10-04T19:20:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam ali 453</video:title>
      <video:description>Imam ali 453</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515026/3515026_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T19:19:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR INK</video:title>
      <video:description>Best asmr ink #Asmr #ink #asmrrelaxing #asmrshorts #asmrsatisfying #inksoundinkasmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515025/3515025_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:19:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>See thea old videos</video:title>
      <video:description>...</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515024/3515024_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:19:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam reza 02</video:title>
      <video:description>Imam reza 02</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515023/3515023_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-04T19:19:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam ali 087</video:title>
      <video:description>Imam ali 087</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515022/3515022_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T19:18:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meluk kucing</video:title>
      <video:description>Sowett</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515021/3515021_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other than Yours (2026) Ep 6 in Hindi</video:title>
      <video:description>A.Love.Other.Than.Yours.S01E06</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515020/3515020_720p.mp4</video:content_loc>
      <video:duration>3860</video:duration>
      <video:publication_date>2026-10-04T19:17:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Let&apos;s eat 2</video:title>
      <video:description>Enjoy eating sandwich #breadsupportpositivemind</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515019/3515019_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:17:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alam yg indah 5</video:title>
      <video:description>Indahnya ciptaannya #Travel #alam #indah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515018/3515018_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T19:17:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam family 056</video:title>
      <video:description>Imam family 056</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515017/3515017_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T19:17:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam ali 034</video:title>
      <video:description>Imam ali 034</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515016/3515016_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-04T19:16:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515015</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515015/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantis 9</video:title>
      <video:description>Soswett</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515015/3515015_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T19:16:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onça pintada ataca sucuri verde</video:title>
      <video:description>Onça pedra sucuri verde no meio do Pantanal #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515014/3515014_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T19:16:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flying bagpack 02</video:title>
      <video:description>Flying bagpack 02</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515013/3515013_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-10-04T19:16:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>shakira#trendiing #for #shakira</video:title>
      <video:description>shakira#trendiing #for #shakira #shakiratrendiingforshakira</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515012/3515012_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T19:15:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lord Krishna 06</video:title>
      <video:description>Lord Krishna 06</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515011/3515011_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T19:14:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Slip 😂😂</video:title>
      <video:description>#Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515010/3515010_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T19:14:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cooking 97</video:title>
      <video:description>Food n cook</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515009/3515009_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-04T19:14:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar terbang part 2</video:title>
      <video:description>Berusaha belajar terbang lagi kembali tapi dengan hal yang sama yang terjadi #belajarterbangkejadianunikfypviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515008/3515008_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T19:13:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lord Krishna 05</video:title>
      <video:description>Lord Krishna 05</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515007/3515007_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T19:13:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Takdir tak pernah ku pilih</video:title>
      <video:description>Takdir tak pernah ku pilih #Takdirtakpernahkupilih</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515006/3515006_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T19:13:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masarakat maju</video:title>
      <video:description>Mendukung masarakat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515005/3515005_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T19:13:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smartwatch s11</video:title>
      <video:description>Smartwatch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515004/3515004_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T19:12:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Something Huge Was Hiding Inside This Underwater Wreck… 🐟🌊</video:title>
      <video:description>A diver explores a mysterious underwater wreck when a massive reef fish suddenly appears from the darkness. Stay until the final reveal. #underwater #ocean #reeffish #scubadiving #marinelife #shipwreck #wildlife #oceanexploration #underwateradventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515003/3515003_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:12:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senyum bhgia</video:title>
      <video:description>Tentram</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515002/3515002_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>reels viral • Waiting For Her... ❤️ | Ultra-Realistic Cinematic AI Video</video:title>
      <video:description>&quot;Something special is about to happen today... because she is finally arriving!&quot; ❤️ Experience a beautiful cinematic love story created using advanced AI technology. A boy waits patiently by his motorcycle on a quiet, tree-lined road during the golden hour, anticipating the arrival of his love. Watch how the magic unfolds in this ultra-realistic story. Don&apos;t forget to like, comment, and subscribe for Part 2! 🔔 #AIlovestorypart1 #RomanticAIvideo #CinematicAIshortfilm #AIvideogeneration #UltrarealisticAIvideo #RomanticmotorcyclerideAI #WaitingforherAIstory #Goldenhourcinematicvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515001/3515001_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T19:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Little Hand, A Big Fight 🤍</video:title>
      <video:description>Those tiny hands are going through a tough time. 💔 Stay strong, little one. May you recover soon and smile again. 🙏🤍 #People #blog #Family</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515000/3515000_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:11:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mayor tedi 2</video:title>
      <video:description>Sangat dpuji banyak orang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514999/3514999_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-04T19:11:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>online earning this app 2026 62</video:title>
      <video:description>If you&apos;re looking for online earning this platform is for you</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514998/3514998_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T19:11:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New Kokborok Viral Video l Traditional Viral Video</video:title>
      <video:description>Visit My Site Properly 👇👇👇 https://youtube.com/shorts/OzZCDxm42u4?si=3s0VQaaMnXmoFDCT #viralshortMusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514997/3514997_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:10:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melodilagu 3</video:title>
      <video:description>Melodilagu #uwuo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514996/3514996_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:10:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What would you do if you were in that man&apos;s position? 🤭</video:title>
      <video:description>What would you do if you were in that man&apos;s position?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514995/3514995_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T19:10:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mayor tedi</video:title>
      <video:description>Gagah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514994/3514994_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T19:10:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nyore</video:title>
      <video:description>Matahari terbenam #Senjamatahari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514993/3514993_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:09:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Latihan 2</video:title>
      <video:description>Tni</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514992/3514992_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-04T19:09:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Apapun itu</video:title>
      <video:description>Lekas membaik #Paris #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514991/3514991_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:08:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Gravity Tears a Star Apart</video:title>
      <video:description>In extreme binary systems, powerful gravity can pull material away from a nearby white dwarf or other compact star. As the objects spiral closer together, their interaction can produce incredible bursts of energy and gravitational waves. #GravityWhiteDwarfNeutronStarBinaryStarsStarCollisionGravitationalWavesSpaceFactsAstronomyUniverseSpaceScienceCosmicMysteryDeepSpaceAstrophysicsScienceFactsAmazingUniverseSpaceExplorationSpaceShortsYouTubeShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514990/3514990_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T19:08:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gak kalah jauh sama canada</video:title>
      <video:description>Kejadian #Paris #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514989/3514989_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:07:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Hungry Wolf and the Clever Bird</video:title>
      <video:description>An exciting adventure between a ferocious wolf and a species of wild chicken. #worldwide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514988/3514988_720p.mp4</video:content_loc>
      <video:duration>730</video:duration>
      <video:publication_date>2026-10-04T19:07:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Агент Джонни Инглиш. Перезагрузка</video:title>
      <video:description>Агент Джонни Инглиш. Перезагрузка #АгентДжонниИнглишПерезагрузка</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514987/3514987_720p.mp4</video:content_loc>
      <video:duration>6081</video:duration>
      <video:publication_date>2026-10-04T19:06:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Poto breng</video:title>
      <video:description>Akrap 2 kerabat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514986/3514986_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T19:06:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melodilagu NIKE Ardilla</video:title>
      <video:description>Hiburan melodi gitar #uwuo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514985/3514985_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:06:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>online earning this app 2026 61</video:title>
      <video:description>If you&apos;re looking for online earning this platform is for you</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514984/3514984_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:06:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514983</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514983/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CROSSWIND🌬️ Emirates Boeing 777-300ER landing at Brussels Airport</video:title>
      <video:description>CROSSWIND🌬️ Emirates Boeing 777-300ER landing at Brussels Airport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514983/3514983_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T19:06:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata 41</video:title>
      <video:description>#Perjalanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514982/3514982_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T19:05:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pelantikan</video:title>
      <video:description>Mayor tedi jdi wakil prabowo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514981/3514981_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:04:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other than Yours (2026) Ep 6 - Eng Sub</video:title>
      <video:description>🇰🇷EP. 6 A LOVE OTHER THAN YOURS (2026) _ ENG SUB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514980/3514980_720p.mp4</video:content_loc>
      <video:duration>3860</video:duration>
      <video:publication_date>2026-10-04T19:04:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>online earning this app 2026 60</video:title>
      <video:description>If you&apos;re looking for online earning this platform is for you</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514979/3514979_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T19:04:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>International presentation</video:title>
      <video:description>The young lady were touched the Hart of people #Global</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514978/3514978_720p.mp4</video:content_loc>
      <video:duration>392</video:duration>
      <video:publication_date>2026-10-04T19:03:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pidato prabowo</video:title>
      <video:description>Pidato buat masa depan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514977/3514977_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:03:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bernyanyi 9</video:title>
      <video:description>Bernyanyi embo opo iku #Nyanyi #bernyani #lagu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514976/3514976_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:03:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 58</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514975/3514975_720p.mp4</video:content_loc>
      <video:duration>1210</video:duration>
      <video:publication_date>2026-10-04T19:02:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Miyu Ootori</video:title>
      <video:description>Ootori Miyu #vlog #song #Ootorimiyu #jav</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514974/3514974_720p.mp4</video:content_loc>
      <video:duration>262</video:duration>
      <video:publication_date>2026-10-04T19:02:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Don&apos;t skip, let&apos;s count down</video:title>
      <video:description>Cute Kid’s Hilarious Reaction!#Funny #Comedy #Viral #Trending #FunnyVideo #搞笑 #搞笑视频 #爆笑 #热门 #开心一刻 #LOL #Hilarious #爆款 #FunnyMoments #沙雕 #Short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514973/3514973_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:02:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beat deluxe</video:title>
      <video:description>keren apa kurang keren #motorcycle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514972/3514972_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:01:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of duty 25</video:title>
      <video:description>#callofduty #callofdutymw4 #newcallofduty #callofduty2026 #callofdutynews #callofduty2027 #nextcallofduty #everycallofduty #callofdutysbmm #ragecallofduty #rantcallofduty #callofdutyeomm #toxiccallofduty #callofdutynext #callofdutywarzone #callofdutyfuture #callofdutyreboot #callofdutychanges #callofdutymobile #hackingcallofduty #callofdutygameplay #futureofcallofduty #cheatingcallofduty #callofdutycampaign #activisioncallofduty #callofdutysettings</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514971/3514971_720p.mp4</video:content_loc>
      <video:duration>1252</video:duration>
      <video:publication_date>2026-10-04T19:01:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Latihan tni</video:title>
      <video:description>Kompak bersama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514970/3514970_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T19:01:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>asasuu</video:title>
      <video:description>temen lanknat #France</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514969/3514969_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T19:00:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Let&apos;s Go to the Zoo! 🦁🐘🐒 | Animal Sounds Song for Kids | Fun Nursery Rhymes</video:title>
      <video:description>Come along on a fun musical adventure to the zoo! 🌈 Meet friendly lions, elephants, monkeys, tigers, penguins and giraffes while singing, dancing, jumping, clapping and learning animal sounds together! 🐒🐯🐧🦒 🎵 Roar like a lion! 🐘 Stomp like an elephant! 🐒 Jump like a monkey! 🐧 Waddle like a penguin! 🦒 Stretch like a giraffe! This fun and catchy animal song is made for toddlers, preschoolers and young children who love animals, music and dancing. Perfect for: ✨ Kids sing along ✨ Animal sounds ✨ Preschool learning ✨ Toddler activities ✨ Nursery rhymes ✨ Kids dance time ✨ Fun family entertainment 🎶 Sing • Dance • Clap • Jump • Learn! 🎶 Subscribe for more original kids songs, nursery rhymes, animal songs and fun educational music! #Kidssongs #Animalsongs #NurseryRhymes #Animalsounds #Kidsmusic #Songsforkids #ToddlerSongs #PreschoolSongs #Zooanimals #nursery</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514968/3514968_720p.mp4</video:content_loc>
      <video:duration>173</video:duration>
      <video:publication_date>2026-10-04T19:00:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514967</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514967/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagu country</video:title>
      <video:description>Lagu country viral #Lagucountry #wadeforster</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514967/3514967_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:00:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bhgiakan masarakat</video:title>
      <video:description>KDM bagja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514966/3514966_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T19:00:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hahaha 57</video:title>
      <video:description>semangat #France</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514965/3514965_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T18:59:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hausa song</video:title>
      <video:description>The young baby were mining song #Global</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514964/3514964_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-10-04T18:59:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib 4</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514963/3514963_720p.mp4</video:content_loc>
      <video:duration>491</video:duration>
      <video:publication_date>2026-10-04T18:59:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orang paling di takuti timoty</video:title>
      <video:description>#edukasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514962/3514962_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T18:59:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tugas Penjagaan Alat berat</video:title>
      <video:description>#Sukabumi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514961/3514961_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T18:59:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meet a sexy female ghost 😆</video:title>
      <video:description>At first, I was brave, but in the end I was scared and ran away 😂😉😆 #Funnyvideo #comedy #funny #entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514960/3514960_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T18:57:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 52</video:title>
      <video:description>Vidio lucu #UnitedStatesturkeyindia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514959/3514959_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T18:57:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours ep 6 Hindi dubbed K-drama</video:title>
      <video:description>A love other than yours episode 6 Hindi dubbed K-drama #Romance #melodrama #childhoodfriends #friendstolovers #K-drama #Hindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514958/3514958_720p.mp4</video:content_loc>
      <video:duration>3861</video:duration>
      <video:publication_date>2026-10-04T18:57:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan lalu lintas</video:title>
      <video:description>#Asian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514957/3514957_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T18:56:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Religi 5</video:title>
      <video:description>Tour</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514956/3514956_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T18:56:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toxic A Fairy Tale for Grown-ups (2026) Hindi Full Movie</video:title>
      <video:description>Toxic A Fairy Tale for Grown-ups (2026) Hindi Full Movie #ToxicAFairyTaleforGrown-ups2026HindiFullMovienewmovieviralvideoToxicAFairypart2ToxicAFairymovie2</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514955/3514955_720p.mp4</video:content_loc>
      <video:duration>10987</video:duration>
      <video:publication_date>2026-10-04T18:54:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The comebeck 😂🤣</video:title>
      <video:description>#life</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514954/3514954_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T18:54:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib 3</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514952/3514952_720p.mp4</video:content_loc>
      <video:duration>350</video:duration>
      <video:publication_date>2026-10-04T18:53:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat in mushola</video:title>
      <video:description>The cat joins the sholawat #FYP #Cat #Funny #ShortVideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514951/3514951_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T18:52:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bermain 17</video:title>
      <video:description>Bermain #Permainan #bermain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514950/3514950_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T18:52:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night 18</video:title>
      <video:description>Riding ninght #motorsepeda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514949/3514949_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T18:52:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Let me sleep... I&apos;m still in my peel</video:title>
      <video:description>Let me sleep... I&apos;m still in my peel #Ai #animation #viral #trending #funnyfruit #trendingvideo #Asmr #village #villagelife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514948/3514948_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T18:52:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>বান্ধবী কেমন আছো</video:title>
      <video:description>বান্ধবী আমাকে কেমন লাগে</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514947/3514947_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:51:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você lembra desse desenho Nostalgia Pura</video:title>
      <video:description>Quem aí passava as manhãs colado na TV assistindo a esses clássicos? Vamos relembrar os desenhos animados mais icônicos dos anos 80 e 90 que marcaram a nossa infância. Deixe nos comentários qual era o seu favorito e qual faltou nessa lista!#desenhosantigos #anos90 #anos80 #nostalgia #desenhoanimado #infancia #shorts #Anos80 #Anos90 #Antigo #Objetos #objetosantigos #Colecionador #Infancia #retro #Antigamente #Nostalgia #colecionar #Diversão #Saudade #infancia90 #infancia80 #velhostempos #CoisasDosAnos90 #GeraçãoX #Millennials #CulturaPop #ColeçõesShortsBrasil #desenho #desenhoantigo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514946/3514946_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-04T18:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chhota Bheem &amp; Mighty Little Bheem Adventure in Ladduverse | Full Video | King Shahapur Tv Kids</video:title>
      <video:description>Chhota Bheem &amp; Mighty Little Bheem Adventure in Ladduverse | Full Video | King Shahapur Tv Kids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514945/3514945_720p.mp4</video:content_loc>
      <video:duration>1946</video:duration>
      <video:publication_date>2026-10-04T18:50:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio lucu 79</video:title>
      <video:description>Rawon gank</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514944/3514944_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T18:50:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sejarah kisah Tiongkok kuno</video:title>
      <video:description>Kisah sejarah kerajaan Tiongkok kuno #sejarahtiongkokfyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514943/3514943_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T18:50:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Little girl happy</video:title>
      <video:description>Little girl play and feel so happy with the music #Indonesia #littlegirl #happy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514942/3514942_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T18:50:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Newst</video:title>
      <video:description>Newst</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514941/3514941_720p.mp4</video:content_loc>
      <video:duration>264</video:duration>
      <video:publication_date>2026-10-04T18:49:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>File It picked the wrong window to look through. 🌧️👀A rainy night. A little roadside store. The cha</video:title>
      <video:description>#FileItpickedthewrongwindowtolookthrough🌧️👀ArainynightAlittleroadsidestoreThechamp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514940/3514940_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T18:49:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>newst</video:title>
      <video:description>News</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514939/3514939_720p.mp4</video:content_loc>
      <video:duration>161</video:duration>
      <video:publication_date>2026-10-04T18:48:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 57</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514938/3514938_720p.mp4</video:content_loc>
      <video:duration>1206</video:duration>
      <video:publication_date>2026-10-04T18:48:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby food feeding bottle with spoon</video:title>
      <video:description>Baby food feeding bottle with spoon #foodfeedingbottle #useful #subscribe #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514937/3514937_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T18:48:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fun vidio 2</video:title>
      <video:description>Kesusu ngeh puron</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514936/3514936_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:47:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Le best</video:title>
      <video:description>Voilà le old et le new #Old #new #ice #fun #cool</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514935/3514935_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-04T18:47:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 51</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514934/3514934_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T18:46:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relaxed Woman Enjoying Sunny Morning At Home With Coffee</video:title>
      <video:description>Elegant brunette woman in a rose-colored silky robe enjoys her first coffee while standing beside an open apartment window. Bright morning sunlight fills the room as she smiles and admires the cityscape outside. The peaceful lifestyle moment combines luxury, comfort, relaxation, and simple morning pleasures. Ideal for stock footage related to coffee, self-care, morning routines, beautiful homes, urban lifestyle, wellness, and positive daily habits. #brunettewoman #morningcoffee #silkyrobe #roserobe #cityview #apartmentwindow #sunnymorning #coffeecup #morningroutine #urbanlifestyle #womansmiling #elegantwoman #longhair #homerelaxation #cozymorning #selfcare #coffeetime #cityscape #naturalsunlight #peacefulmorning #stylishwoman #luxurylifestyle #relaxingathome #morningsunlight #modernapartment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514933/3514933_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T18:46:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>crianças sinceras</video:title>
      <video:description>#mundo #criancas #risada #brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514932/3514932_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-04T18:46:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib 2</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514931/3514931_720p.mp4</video:content_loc>
      <video:duration>376</video:duration>
      <video:publication_date>2026-10-04T18:44:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Laila hailaulah</video:title>
      <video:description>Tiada Tuhan yang berhak disembah selain Allah. Semoga hati kita selalu teguh dalam iman dan selalu mengingat-Nya. 🤲 #TurkiChinarusiaingrisBelanda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514930/3514930_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-04T18:44:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>malas</video:title>
      <video:description>mantappp!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514929/3514929_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T18:43:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Portugal Vs Argentina World Cup 2027</video:title>
      <video:description>ronaldo #ronaldo #football #messi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514928/3514928_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T18:43:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic video surat kausar 3</video:title>
      <video:description>Quran majeed Islamic video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514927/3514927_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:43:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours ep 5 Hindi dubbed 2</video:title>
      <video:description>A love other than yours episode 5 Hindi dubbed K-drama 2026 (ongoing drama) A love other than yours episode 5 Hindi dubbed K-drama 2026 (ongoing drama) #AloveotherthanyoursHindidubbed #Hindidubbed #childhoodfriends #friendstolovers #K-drama #Koreandramahindidubbed #drama #romance #melodrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514926/3514926_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T18:43:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rubbish demand</video:title>
      <video:description>Value of a goods should be standard before asking for a high price #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514925/3514925_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T18:42:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story 146</video:title>
      <video:description>Keputusan terberat ku adalah memutuskan masa depan ku esok harus bagaimana #Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514924/3514924_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T18:42:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic video surat kausar 2</video:title>
      <video:description>Quran majeed Islamic video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514923/3514923_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:42:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kalimah Tauhid</video:title>
      <video:description>لَا إِلٰهَ إِلَّا اللَّهُ Tiada Tuhan yang berhak disembah selain Allah. Semoga hati kita selalu teguh dalam iman dan selalu mengingat-Nya. 🤲 #AmericaindinpakistanBrunaiSiangapuraArabsaudiPrancis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514922/3514922_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T18:39:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😯😳 Easy Prompt App ✈️ | Realistic Airplane Runway Acceleration</video:title>
      <video:description>A stunning ultra-realistic passenger airplane accelerates down a modern airport runway before takeoff. Powerful engines, realistic heat distortion, blinking lights, natural sunlight, and cinematic camera movement create an exciting aviation experience. ✈️🔥 #airplaneacceleration #airplanerunway #passengeraircraft #commercialairplane #airportrunway #aviationvideo #airplaneengine #takeoff #pretakeoff #realisticaircraft #cinematicairplane #internationalairport #photorealistic #ultrarealistic #aviationcinematic #EasyPromptApp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514921/3514921_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:39:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Airport juanda</video:title>
      <video:description>Bandara juanda #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514920/3514920_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T18:38:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ikan chana auranti</video:title>
      <video:description>semangat progres ikan dari kecil #hobi #ikan #progre</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514919/3514919_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:38:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 50</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514918/3514918_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T18:38:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514917/3514917_720p.mp4</video:content_loc>
      <video:duration>295</video:duration>
      <video:publication_date>2026-10-04T18:37:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny videohttps://tinyurl.com/2s4hjmt9</video:title>
      <video:description>https://tinyurl.com/2s4hjmt9 #httpstinyurlcom2s4hjmt9</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514916/3514916_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T18:35:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just talking music</video:title>
      <video:description>Islamic music refers to musical works that are created in line with Islamic teachings and ethics. It usually contains beautiful lyrics that praise Allah, tell stories of the prophets, encourage doing good deeds, and remind people of kindness, patience, and gratitude. Many Islamic songs use soft melodies and focus more on meaningful words rather than loud instruments. It is loved by many people around the world because it inspires goodness and brings calmness to the soul. #Trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514915/3514915_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-04T18:35:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start up episode 6 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514914/3514914_720p.mp4</video:content_loc>
      <video:duration>4904</video:duration>
      <video:publication_date>2026-10-04T18:33:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar terbang</video:title>
      <video:description>Hiburan belajar terbang memakai sapu #belajarterbanghiburanlucufyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514913/3514913_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T18:31:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 16 hindi</video:title>
      <video:description>W – Two Worlds Ep 16 hindi #W–TwoWorldsEp16hindiviralvideokdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514912/3514912_720p.mp4</video:content_loc>
      <video:duration>3490</video:duration>
      <video:publication_date>2026-10-04T18:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib episode 2</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514911/3514911_720p.mp4</video:content_loc>
      <video:duration>317</video:duration>
      <video:publication_date>2026-10-04T18:28:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sex porn teen</video:title>
      <video:description>Excitement and suspense #Global #foradults18</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514910/3514910_720p.mp4</video:content_loc>
      <video:duration>704</video:duration>
      <video:publication_date>2026-10-04T18:28:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 49</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514909/3514909_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T18:28:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wowwww 6</video:title>
      <video:description>Watch till end.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514908/3514908_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T18:27:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bayi gemess</video:title>
      <video:description>Baby #Babylucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514907/3514907_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-10-04T18:27:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANOTHER CRABS THEASURE: olha só 1 desafio e posso usar latinhas para defender</video:title>
      <video:description>ANOTHER CRABS THEASURE: olha só 1 desafio e posso usar latinhas para defender, lega demais #Ninja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514906/3514906_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-10-04T18:26:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pqrt13</video:title>
      <video:description>Pak boy #Katakata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514905/3514905_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-10-04T18:26:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#lovestory 2</video:title>
      <video:description>#All</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514904/3514904_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T18:26:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 15 hindi</video:title>
      <video:description>W – Two Worlds Ep 15 hindi #W–TwoWorldsEp15hindiviralvideoW–TwoWorldsEp15hindi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514903/3514903_720p.mp4</video:content_loc>
      <video:duration>3507</video:duration>
      <video:publication_date>2026-10-04T18:25:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gamas network</video:title>
      <video:description>Gamas gamas #network</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514902/3514902_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T18:24:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mom my love</video:title>
      <video:description>I love mom #Love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514901/3514901_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T18:24:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fakta Unik tentang Kalender yang Jarang Diketahui!</video:title>
      <video:description>Sedikit fakta mengenai kalender yang mungkin kita belum tahu. #fakta #kelender #faktaunik #faktamenarik #masehi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514900/3514900_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-04T18:24:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Part12</video:title>
      <video:description>Sanset #Sorehari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514899/3514899_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T18:24:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Haus!</video:title>
      <video:description>Haus! #Drink</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514898/3514898_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T18:23:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 14 hindi</video:title>
      <video:description>W – Two Worlds Ep 14 hindi #W–TwoWorldsEp14hindiviralvideoW–TwoWorldsEp14hindi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514897/3514897_720p.mp4</video:content_loc>
      <video:duration>3469</video:duration>
      <video:publication_date>2026-10-04T18:21:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic video surat kausar</video:title>
      <video:description>Quran majeed Islamic video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514896/3514896_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:21:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>জীবনে যত কঠিন সময় আসুক না কেন,#calloftamim</video:title>
      <video:description>জীবনে যত কঠিন সময় আসুক না কেন,#calloftamim</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514895/3514895_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T18:21:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan Skip! Kucing Ini Punya Tingkah yang Bikin Gemas! 2</video:title>
      <video:description>Kamu pasti senyum lihat tingkahnya! 😻 Tapi… coba tebak apa yang terjadi berikutnya? You can&apos;t watch this without smiling! 😻 But… can you guess what happens next? 👀 #KucingLucu #KucingGemoy #LucuBanget #KucingIndonesia #funnyCat #CuteCat #CatVideo #CatLovers #FunnyPets #ViralCats #FYPTrending #可爱 #猫咪 #萌宠 #猫咪视频 #搞笑 #宠物日常 #热门</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514894/3514894_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T18:21:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 48</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514893/3514893_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T18:21:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night vibe 2</video:title>
      <video:description>Night view #Nightvibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514892/3514892_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T18:20:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Агент Джонни Инглиш 3.0 (2018)</video:title>
      <video:description>Агент Джонни Инглиш 3.0 (2018) #АгентДжонниИнглиш302018</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514891/3514891_720p.mp4</video:content_loc>
      <video:duration>5313</video:duration>
      <video:publication_date>2026-10-04T18:18:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coughing When the Weather Changes Here’s Why?</video:title>
      <video:description>#WeatherChangeCough #DryCoughRemedy #HealthTips Video Description Do you start coughing as soon as the season shifts or the temperature drops? You&apos;re not alone! In this video, we break down why weather changes trigger persistent coughing, throat irritation, and chest congestion—and what you can do about it. #weatherchangecough #whydoicoughwhenweatherchanges #seasonalcoughcauses #coughingincoldweather #seasonalallergiescough #coldairthroatirritation #drycoughremedy #suddentemperaturechangecough #coughwhenseasonschange #weathershiftsorethroat #whyseasonalcoughhappens #dryaircoughrelief #wintercoughcauses #bronchitisweatherchange #autumncoughremedies #homeremediesforweathercough #soothethroatchangeofweather #allergicbronchitissymptoms #coldweatherbreathingirritation #seasonalchestcongestion #howtostopweathercough #throatticklecoldair #naturalcoughrelief #weathersensitivitycough #protectlungscoldweather #nightcoughtemperaturedrop #seasonalasthmaflareup #airhumiditycough #throatinflammationweather #coughtreatmenttips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514890/3514890_720p.mp4</video:content_loc>
      <video:duration>474</video:duration>
      <video:publication_date>2026-10-04T18:18:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 13hindi</video:title>
      <video:description>W – Two Worlds Ep 13hindi #W–TwoWorldsEp13hindiviralvideoW–TwoWorldsEp13</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514889/3514889_720p.mp4</video:content_loc>
      <video:duration>3523</video:duration>
      <video:publication_date>2026-10-04T18:18:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zombie lagi takut</video:title>
      <video:description>Ada wabah zombie sedang berkumpul lagi ketakutan tapi malah berubah #Zombie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514888/3514888_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T18:18:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tentou enganar o patrão</video:title>
      <video:description>Tentou enganar o patrão</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514887/3514887_720p.mp4</video:content_loc>
      <video:duration>163</video:duration>
      <video:publication_date>2026-10-04T18:18:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devolvió la joya y recibió una recompensa que cambió su vida</video:title>
      <video:description>#Devolviólajoyayrecibióunarecompensaquecambiósuvida💍❤️Cap2Alejandrorecuperóelanil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514886/3514886_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-10-04T18:17:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semoga fyp ya</video:title>
      <video:description>#Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514885/3514885_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T18:17:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata mutiara 33</video:title>
      <video:description>Menjadi piatu pulang tanpa pelukan Menjadi Yatin piatu pulang tanpa siapa siapa #Katakatamutiara</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514884/3514884_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T18:16:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como vai patrão</video:title>
      <video:description>Como vai patrão</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514883/3514883_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-10-04T18:15:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chocolatdessert that makes a sensatlon every time! One trick makes the difference</video:title>
      <video:description>Ingredients melted dark chocolate: 400 g-4 0z) sponge tingers: 4 pe eggs: 2 pe corn starch: 50 g (1.8 oz) sugar: 50 g (1.8 oz) lemon: 1 pc milk: 1 |(34 pt) condensed milk: 100 g (3.5 oz) white chocolate: 2 pc sugar: 150 g (5.3 oz) lemon: 1 pc milk: 1 |(34 pt) condensed milk: 100 g (3.5 oz) white chocolate: 2 pc sugar: 150 g (5.3 oz) #‎‎dessert #cook #cookrate #Ingredients #biscuits #Nutella #milk #whippingcream #powderedsugar #cocoa #darkchocolate #milkchocolate‎</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514882/3514882_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-10-04T18:15:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rela ibu di pesta kuliah kaya dari kerang ajaib</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514881/3514881_720p.mp4</video:content_loc>
      <video:duration>428</video:duration>
      <video:publication_date>2026-10-04T18:15:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sport 79</video:title>
      <video:description>Walking</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514880/3514880_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T18:14:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rimpiendo la calle</video:title>
      <video:description>Nuevo tema</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514879/3514879_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-10-04T18:14:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deep Relaxation Facial &amp; Face Therapy for Sleep</video:title>
      <video:description>relax, unwind, and melt into deep sleep with this ultra-relaxing ASMR facial and face therapy session. Designed specifically to trigger intense tingles and melt away anxiety, this video combines soothing personal attention with crisp, satisfying skincare sounds. Put on your headphones 🎧, close your eyes, and let the gentle triggers guide you into a peaceful night&apos;s rest. #facial #relax #ASMR #Facetherapy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514878/3514878_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-10-04T18:13:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kribo parkir</video:title>
      <video:description>Apa yang sedang anda pikirkan #Semuaorang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514877/3514877_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T18:13:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VAI DESCENDO - Slowed</video:title>
      <video:description>#abdodata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514876/3514876_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T18:13:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FULL HOUSE=풀하우스 EP 14</video:title>
      <video:description>DORAMA 16 EP: EP 14 #doramas #dorama #drama #doramanetflix #doramasnetflix #melhoresdoramas #truebeautydorama #resumendedoramas #doramasdubladosem #ondeassistirdoramas #belezaverdadeiradorama #doramadubladonetflix #cdrama #kdrama #shortdrama #koreandrama #dramacoreano #newdrama #melhoresdoramasdanetflix #shortsdrama #shortdramas #belezaverdadeiradoramanetflix #chinesedrama #asiandrama #dramaresumen #ohmydramas #minidrama #freeshortdrama #revengedrama #dramaseries #dramareview #bestdramas #chinesedramas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514875/3514875_720p.mp4</video:content_loc>
      <video:duration>3735</video:duration>
      <video:publication_date>2026-10-04T18:13:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 12 hindi</video:title>
      <video:description>W – Two Worlds Ep 12 hindi #W–TwoWorldsEp12hindiviralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514874/3514874_720p.mp4</video:content_loc>
      <video:duration>3577</video:duration>
      <video:publication_date>2026-10-04T18:12:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funniest Farm Animals 10</video:title>
      <video:description>hese hootin&apos; &amp; hollerin&apos; animals thought they&apos;d find a nice pasture to graze on the farm...little did they know, they&apos;d only find fresh FAILS! 😹🐮 #cuteanimal #anabul #funnything #happy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514873/3514873_720p.mp4</video:content_loc>
      <video:duration>1213</video:duration>
      <video:publication_date>2026-10-04T18:12:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 47</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514872/3514872_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T18:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing marah</video:title>
      <video:description>#Kucing #kucinglucu #kucingmarah #kucinggemoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514871/3514871_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T18:11:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mills Enzo FG white/gold</video:title>
      <video:description>MILLS ENZO FG FOOTBALL SHOES UPPER: MILLS EXOSKIN is a microfiber shoe upper technology that is lightweight, strong, and can hug / provide maximum protection to the foot, designed for players with high mobility. STABILITY: MILLS REINF INTERCROSS is a technology on the outsole of MILLS football shoes like a foundation / cross construction located in the middle part. This technology prevents the shoe from twisting or prevents the player&apos;s foot from injury and provides additional strength and protection from the heel to the middle of the shoe. SOLE-PLATE RESPONSIVE: MILLS LETHAL SPIN is a stud technology that allows maneuvers at the pivot point more easily and quickly, providing full control in performing sharp maneuvers, changing direction quickly, and stability on the field. #football #sepakbola #soccer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514870/3514870_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T18:11:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funniest Pets of 2026 😂 BEST Animal Videos</video:title>
      <video:description>The funniest animals of 2025 are ready to make you laugh, so hit play and enjoy! #cuteanimal #funniest #dog #fun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514869/3514869_720p.mp4</video:content_loc>
      <video:duration>1822</video:duration>
      <video:publication_date>2026-10-04T18:11:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>modeling 5</video:title>
      <video:description>genz and fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514868/3514868_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:11:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wisata 7</video:title>
      <video:description>Keliling Borobudur dengan BMW jadul #Travel #Borobudur #BMW #Healing #Refresing #Pedesaan #udarasegar #bergembira #ceria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514867/3514867_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T18:09:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Kehidupan Desa: Tenang, Sederhana, dan Bahagia”</video:title>
      <video:description>Kehidupan desa.damai dan bahagia #Kehidupanpedesaan #suasanadesa #sunrise</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514866/3514866_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T18:06:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yamal 10</video:title>
      <video:description>Lamine Yamal nasceu em Esplugues de Llobregat, Barcelona, de pai marroquino e mãe equato-guineense. Cresceu em Granollers e Mataró. Quando tinha sete anos, sua família mudou-se para Barcelona onde jogou pela base do Club de Fútbol La Torreta, e no mesmo ano foi notado pelos olheiros do Barcelona ao marcar um hat-trick numa partida organizada pelos blaugranase logo se juntou a La Masia #LamineYamalBarcelona</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514865/3514865_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-04T18:05:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAMURAI</video:title>
      <video:description>Built a samurai from copper wire #Artwork #art #samurai #japan #USA #fyp #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514864/3514864_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T18:04:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan Skip! Kucing Ini Punya Tingkah yang Bikin Gemas!</video:title>
      <video:description>Kamu pasti senyum lihat tingkahnya! 😻 Tapi… coba tebak apa yang terjadi berikutnya? 👀 You can&apos;t watch this without smiling! 😻 But… can you guess what happens next? 👀 #KucingLucu #KucingGemoy #LucuBanget #KucingIndonesia #FunnyCat #CuteCat #CatVideo #CatLovers #FunnyPets #ViralCats #FYP #Trending #可爱 #猫咪 #萌宠 #猫咪视频 #搞笑 #宠物日常 #热门</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514863/3514863_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-04T18:04:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 45</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514862/3514862_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T18:02:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 11 hindi</video:title>
      <video:description>W – Two Worlds Ep 11 hindi #W–TwoWorldsEp11hindiviralvideoW–TwoWorldsEp11</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514861/3514861_720p.mp4</video:content_loc>
      <video:duration>3586</video:duration>
      <video:publication_date>2026-10-04T18:02:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wahai Tuhanku Aku bukanlah Ahli surga</video:title>
      <video:description>Aku bukanlah ahli surga, hanya seorang hamba yang penuh kekurangan. Semoga setiap langkah, doa, dan taubatku menjadi jalan menuju ridha Allah. 🤲 #AmericaindiaPakistansingapuraBrunai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514860/3514860_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T18:00:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why is Mr. Krabs willing to do anything for money? 💰</video:title>
      <video:description>Why is Mr. Krabs willing to do anything for money? 💰 #SpongeBob #SpongeBobSquarePants #Cartoon #movie #Funny #trending #usa #america #animation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514859/3514859_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T17:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start Up episode 5 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514858/3514858_720p.mp4</video:content_loc>
      <video:duration>4950</video:duration>
      <video:publication_date>2026-10-04T17:59:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 10 hindi</video:title>
      <video:description>W – Two Worlds Ep 10 hindi #W–TwoWorldsEp10hindiviralvidioW–TwoWorldsEp10</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514857/3514857_720p.mp4</video:content_loc>
      <video:duration>3655</video:duration>
      <video:publication_date>2026-10-04T17:57:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mobile legend 25</video:title>
      <video:description>momen julian savage #mobilelegend #mlbb #julian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514856/3514856_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T17:56:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Survey berbayar 2</video:title>
      <video:description>Lumayan lulus survenya #SurveyCuanRecehan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514855/3514855_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T17:56:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A beautiful woman intends to clean the roof tiles when it is raining heavily but instead slips down </video:title>
      <video:description>A beautiful woman was actually laying roof tiles during heavy rain and slipped and fell, but luckily she was saved by her female friend. #Rooftiles #house #stairs #repairs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514854/3514854_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:55:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;He took ONE pineapple.... and destroyed the whole warehouse! 🍋🍍💥&quot;</video:title>
      <video:description>The ultimate fruit avalanche domino effect. 🍋🌊🍍 # #FruitAvalanche #DominoEffect #3DAnimation #UnexpectedMoments #ChaosIn3D</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514853/3514853_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:54:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you more Celine</video:title>
      <video:description>Pretty girl #Love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514852/3514852_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T17:53:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI animation video of banana fruit</video:title>
      <video:description>No more drama of bruised fruit in the fridge. Simple yet life-changing. #general</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514851/3514851_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-10-04T17:53:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 46</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514850/3514850_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T17:53:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orang ini lagi meminta memohon</video:title>
      <video:description>orang lagi meminta mohon kepada tuhanya agar hidup lebih baik lagi karna banyak yang mengalami penyesalan pada masa hidupnya #Gayahidup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514849/3514849_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:53:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start Up episode 4 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514848/3514848_720p.mp4</video:content_loc>
      <video:duration>4846</video:duration>
      <video:publication_date>2026-10-04T17:53:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💔💔💔 4</video:title>
      <video:description>Gasspollll #France</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514847/3514847_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T17:51:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>novelas de frutas 2</video:title>
      <video:description>Reencontro dos desconhecidos Parte 7 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514846/3514846_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-10-04T17:51:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivacional 86</video:title>
      <video:description>Nunca desista #Fé</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514845/3514845_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-04T17:51:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good evening friends, who likes flowers?</video:title>
      <video:description>Good evening friends, who likes flowers? #Flowers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514844/3514844_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T17:51:05+02:00</video:publication_date>
    </video:video>
  </url>
</urlset>
