<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"
        xmlns:video="http://www.google.com/schemas/sitemap-video/1.1">
  <url>
    <loc>https://www.febspot.com/video/3516309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Umar farooq</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516309/3516309_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T07:27:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Funny video #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516308/3516308_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-05T07:27:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moment 16</video:title>
      <video:description>A talking moment #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516307/3516307_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T07:27:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosplay 19</video:title>
      <video:description>Douying #Japanese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516306/3516306_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:27:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 376</video:title>
      <video:description>Funny video #Cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516305/3516305_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T07:26:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nazzam</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516304/3516304_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:26:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cosplay 18</video:title>
      <video:description>Douying #Japaness</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516303/3516303_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:26:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>spalonbyminal</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516302/3516302_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T07:26:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ramaikan sayang</video:title>
      <video:description>jangan lupa di follow ya #beautifulvideosgirlfypviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516301/3516301_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:26:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion and nature&apos;s sun</video:title>
      <video:description>fashion and nature.fashion under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516300/3516300_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:25:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Padang</video:title>
      <video:description>Bersama ayang #Jalanjalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516299/3516299_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T07:25:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 19</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516298/3516298_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T07:25:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dr syad reman shah</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516297/3516297_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T07:24:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Di peluk 5 detik</video:title>
      <video:description>Gunting batu kertas #Vidiolucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516296/3516296_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T07:24:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Some Memories Wait Quietly for the Right Moment to Return. Emotional Short Film</video:title>
      <video:description>Sometimes, we think we&apos;ve forgotten a place, a person, or a moment… until something brings it all back. 🌙🍂 She returns to her old childhood home and discovers that some memories never truly disappear. They simply wait quietly inside us for the right moment to return. ❤️ A cinematic story about home, memories, time, and the feelings we never completely let go of. #emotionalstory #nostalgicstory #oldmemories #forgottenmemories #childhoodmemories #memoriesofhome #oldhouse #emotionalshortfilm #cinematicshort #hearttouchingstory #touchingstory #nostalgicvideo #emotionalvideo #sentimentalstory #villagelife #rurallife #homecomingstory #meaningfulstory #lifememories #beautifulmemories #emotionalanimation #animatedshortfilm #AIstory #AIvideo #AIanimation #cinematicanimation #storytelling #heartwarmingstory #peacefulmoments #DreamleafShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516295/3516295_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:24:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muzamilmalik</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516294/3516294_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:23:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lol hehe</video:title>
      <video:description>Lol #Lol</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516293/3516293_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T07:23:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atasa 😂😂</video:title>
      <video:description>Oh my God #unitedstatesjermanfypviralfunnyvideolucuforyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516292/3516292_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T07:23:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mari mas</video:title>
      <video:description>Mengisi waktu luang #Wanitacantiksexy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516291/3516291_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:22:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kidsphotographybyali</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516290/3516290_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-05T07:22:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The little black dress</video:title>
      <video:description>black dress fashion under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516289/3516289_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:21:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Family gathering puncak Bogor</video:title>
      <video:description>Acara family gathering yang diadakan di puncak Bogor Indonesia #PuncakBogor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516288/3516288_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:21:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beat by Tosh pac</video:title>
      <video:description>Hip hop beat by Tosh pac</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516287/3516287_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T07:21:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny vedio 47</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516286/3516286_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:21:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jiya rajpoot</video:title>
      <video:description>fbreel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516285/3516285_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:20:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What have you eaten today?</video:title>
      <video:description>What have you eaten today? Let&apos;s learn common English words about food! Watch until the end and share your thoughts in the comments! 🍕💬 #whathaveyoueatentoday #whatdoyoueat #learnenglish #englishvocabulary #englishforbeginners #dailyenglishconversation #foodvocabulary #englishgrammar #speakingenglish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516284/3516284_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T07:20:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sobia Malik</video:title>
      <video:description>Wafa World 😘🥀</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516283/3516283_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:19:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion beautiful Africa</video:title>
      <video:description>west African fashion under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516282/3516282_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>prince interview</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516281/3516281_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T07:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Puncak Bogor 2</video:title>
      <video:description>Acara family gathering di puncak Bogor Indonesia #PuncakBogorIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516280/3516280_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:18:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sidhukaur</video:title>
      <video:description>Kamal Grewal · Ankhaan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516279/3516279_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T07:17:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hello Amsterdam ❤️I&apos;m Coming❤️❤️❤️</video:title>
      <video:description>Hello Amsterdam ❤️I&apos;m Coming❤️❤️❤️ #Hello #Amsterdam #i #coming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516278/3516278_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T07:17:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516277</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516277/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam kampung 5</video:title>
      <video:description>Datang lagi satu ekor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516277/3516277_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T07:17:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oh my Goodness 😂😂</video:title>
      <video:description>Oh my Goodness 😂😂 #parisjermantravelfypforyoufunnyvideolucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516276/3516276_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T07:16:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OKE BRO....</video:title>
      <video:description>Ahahaha</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516275/3516275_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T07:16:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion under the sun 🌞</video:title>
      <video:description>fashion under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516274/3516274_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:15:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brother monkey can also do the laundry</video:title>
      <video:description>#Monkey #funnyvideos #funnymonkey</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516273/3516273_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T07:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good afternoon....</video:title>
      <video:description>Keep smiling, stay positive, and make the most of this beautiful day. 🌿😊 #Afternoon #NiceDay #JustGoOn</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516272/3516272_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:15:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata-kata motivasi 7</video:title>
      <video:description>Masalalu tidakbisa diubah atau dihapus ,ia hanya bisa diterima untuk menjadi pijakan hidup yang lebih baik. #Katakatamotivasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516271/3516271_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:15:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bride 42</video:title>
      <video:description>The Bride</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516270/3516270_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T07:14:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muhammad ali 2</video:title>
      <video:description>Best boxer in the world #sport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516269/3516269_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T07:13:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Do We Relationship (2026) Episode 4 Eng Sub</video:title>
      <video:description>How Do We Relationship (2026) Shy Miwa has always dreamed of finding love, but living in small-town Japan made finding the right match difficult - especially since she likes girls! Even going away to college didn’t seem to increase her romantic odds until one day her outgoing classmate Saeko suggests they might as well start dating each other since it’s not like either of them have other options. At first it seems like things won’t work out as their personalities clash and misunderstandings abound. But when their casual friendship starts to become something more Miwa begins to wonder—can a pragmatic proposal lead to true love? How Do We Relationship, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #HowDoWeRelationship #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516268/3516268_720p.mp4</video:content_loc>
      <video:duration>1440</video:duration>
      <video:publication_date>2026-10-05T07:13:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yanti with her friends at a clean and clear river.</video:title>
      <video:description>YANTI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516267/3516267_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T07:12:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I see</video:title>
      <video:description>I see #See</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516266/3516266_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:12:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam kampung 4</video:title>
      <video:description>Kebiasaan kasih makan 🐔🐔</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516265/3516265_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T07:11:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sweet African music 🎵🎶</video:title>
      <video:description>under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516264/3516264_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:11:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>White Funny bunny try to mimic a cat!</video:title>
      <video:description>funny bunny 🤣 #fypviralvideosbunnycataroundtheworldusaaustralia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516263/3516263_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T07:11:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shahid 3</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516262/3516262_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:11:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OK Lets Get Divorce (2026) Episode 11 Eng Sub</video:title>
      <video:description>OK Lets Get Divorce (2026) - KOREAN DRAMA This series depicts the realistic divorce experience of a wedding dress CEO and a designer couple who decide to divorce to end their exhausting married life. Baek Mi Yeong is the CEO of J&amp;White and finds herself at the center of a turbulent divorce story. Dreaming of becoming a female tailor while watching her father run a suit shop, Mi Yeong became consumed by work after losing her parents in an unexpected accident. She later married Ji Won Ho, a wedding shop designer who had long stood by her side, and together they founded J&amp;White. Although she fought to protect the company through times of crisis, after seven years of marriage, she declared her intention to divorce Won Ho. Ji Won Ho is Mi Yeong&apos;s husband, co-CEO of J&amp;White, and a designer. He fell in love with Mi Yeong at first sight when they met at his first job, drawn to the protective instincts she stirred in him, and proposed after just six months of dating. Having enjoyed a largely stable marriage with Mi Yeong, Won Ho finds himself facing a crisis after an incident that occurred during their fourth year of marriage. OK Lets Get Divorce, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, koreandrama, dramakorean, koreanromance, romancekorean, movie, moviekorean, koreanmovie #OKLetsGetDivorce #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #koreandrama #dramakorean #koreanromance #romancekorean #movie #moviekorean #koreanmovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516261/3516261_720p.mp4</video:content_loc>
      <video:duration>3617</video:duration>
      <video:publication_date>2026-10-05T07:11:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dyrroth gameplay</video:title>
      <video:description>#mlbb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516260/3516260_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T07:11:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stay out of trouble 🤣</video:title>
      <video:description>Stay out of trouble 🤣 #foryoufypviralfunnyvideoLucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516259/3516259_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:10:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>90 REFRESHING DRINKS</video:title>
      <video:description>grab one.....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516258/3516258_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:10:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kelapa 2</video:title>
      <video:description>manfaat dari buah kelapa #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516257/3516257_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T07:10:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skanshine</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516256/3516256_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T07:09:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daun Kelorr</video:title>
      <video:description>manfaat daun kelor #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516255/3516255_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T07:09:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Friendly visit</video:title>
      <video:description>Just for fun #Namibia🇳🇦</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516254/3516254_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T07:08:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Style ride</video:title>
      <video:description>Style ride #Style</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516253/3516253_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T07:08:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ely tries to stay in the spotlight, despite all her shortcomings.</video:title>
      <video:description>Ely</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516252/3516252_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T07:08:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Herbal yg bagus untuk pernafasan</video:title>
      <video:description>Konsumsi herbal ini saat terkena gangguan pernafasan seperti asma #Herbal #obat #pernafasan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516251/3516251_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T07:08:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E08 Hindi Dubbed Korean Drama English Subtitles</video:title>
      <video:description>King The Land #Koreandrama #Hindidubbed #KoreandramaHindidubbed #Koreantvseries #KingTheland</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516250/3516250_720p.mp4</video:content_loc>
      <video:duration>4587</video:duration>
      <video:publication_date>2026-10-05T07:07:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asassin creed funny moment!</video:title>
      <video:description>#fypgameasassasinfunfunnyviralviralvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516249/3516249_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T07:06:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Música nova 2</video:title>
      <video:description>Música nova</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516248/3516248_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T07:06:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monkey Gives Lion a New Look! 🐒🦁🎨</video:title>
      <video:description>This video is an AI cinematic simulation created purely for entertainment. A mischievous little monkey sneaks up on a sleeping lion and uses a small brush to paint its body and legs black. The lion suddenly wakes up in shock, completely confused by its unexpected new look! All characters, scenes, and events are digitally generated. No real animals were involved or harmed. #FunnyMonkey #FunnyLion #MonkeyPrank #LionPrank #LionPaint #AnimalComedy #FunnyAnimals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516247/3516247_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T07:04:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E07 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The Land. #KingTheland #koreandrama #Hindidubbed #Koreantvseries #koreandramaHindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516246/3516246_720p.mp4</video:content_loc>
      <video:duration>4452</video:duration>
      <video:publication_date>2026-10-05T07:04:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>میری ا ستانی</video:title>
      <video:description>Teachers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516245/3516245_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:04:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Serendipity (2026) Episode 21 Eng Sub</video:title>
      <video:description>Serendipity (2026) - CHINESE DRAMA Su Wan, an animal psychology major, has loved animals since childhood and can&apos;t bear to see them harmed. One day, she learns that a group of dogs has been kidnapped and trafficked. Disregarding her own safety, she follows the clues alone to the kidnappers&apos; hideout, determined to rescue the dogs. Finding herself in mortal danger after being discovered, she is suddenly saved by a stranger. Unbeknownst to Su Wan, this mysterious boy is none other than Bai Tian Yu, her childhood sweetheart from sixteen years ago. The two were inseparable as children, but various unforeseen events led to their separation. This thrilling encounter brings them back together, leading to a healing and sweet love story. Serendipity, drama, romance, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, chinesedrama, dramachinese, chineseromance, romancechinese, movie, moviechinese, chinesemovie, chineselove, lovechinese #Serendipity #drama #romance #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #chinesedrama #dramachinese #chineseromance #romancechinese #movie #moviechinese #chinesemovie #chineselove #lovechinese</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516244/3516244_720p.mp4</video:content_loc>
      <video:duration>2801</video:duration>
      <video:publication_date>2026-10-05T07:03:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>under the sun</video:title>
      <video:description>under the sun beautiful Africa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516243/3516243_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T07:03:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tilawat e Quran Majeed 153</video:title>
      <video:description>Buy any kind website binary option trade, p2p crypto exchange web, chat web , social network web , school web , freelancer web for your business or entertainment https://www.fiverr.com/s/jjm8wxw https://www.fiverr.com/s/WEWrwYl https://www.fiverr.com/s/yvD6XoG #Tilawat #Tilawatquran</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516242/3516242_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T07:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dr Asad Abbas</video:title>
      <video:description>Dr Asad Abbas · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516241/3516241_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T07:03:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516240</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516240/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>panen buah jambu</video:title>
      <video:description>panen buah jambu Darsono #fypforyoupanenbuahjambuvidiopendek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516240/3516240_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T07:02:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MY DANCE</video:title>
      <video:description>MY TRIP #TrenTari #tantanganTariViral #TrenTariSaatIni #KompliasiTariTikTok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516238/3516238_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:01:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516237</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516237/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saif Leghari</video:title>
      <video:description>عوامی ریل سروس کوئٹہ ٹو کچلاک</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516237/3516237_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T07:01:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Invoker fontaine sunstrike</video:title>
      <video:description>Fontaine sunstrike while unexpected 😯 #dota #gameplay #invoker</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516236/3516236_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-05T07:00:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E06 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The Land. #Koreandrama #Hindidubbed #Koreantvseries #hindidubbedKoreantvseries #KingTheland #koreandramaHindidubbed #englishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516235/3516235_720p.mp4</video:content_loc>
      <video:duration>4624</video:duration>
      <video:publication_date>2026-10-05T07:00:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pallavi Damakta</video:title>
      <video:description>mountainview</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516234/3516234_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T07:00:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TechElectronic Bhai</video:title>
      <video:description>Solar System Installation ☀️ | How to Connect Solar, Inverter &amp; Battery?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516233/3516233_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T07:00:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Menghidupkan mesin diesel</video:title>
      <video:description>Kena prank anjing 🤣 #fypforyouvidiolucuanjingorangmenghidupkanmesindiesel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516232/3516232_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:59:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Africa</video:title>
      <video:description>Beautiful Africa beautiful land</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516231/3516231_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freelancing with Danial</video:title>
      <video:description>Freelancing with Danial · Following ﻿Freelancing with Danial · Original audio Get Chatgpt Premium version free ‼️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516230/3516230_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T06:58:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat curiga datang</video:title>
      <video:description>Saat curiga datang menyapa #mitivasi #kesadaran #Motivasi #kesadaran #curiga #hubungan #quoteKesehatanmental #cintasejati</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516229/3516229_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T06:58:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mahek Malik</video:title>
      <video:description>Subha Subha Es Dua 🤲 ko 7 Baar Padhlo…💯✨ Mahek Malik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516228/3516228_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T06:57:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pls Love (2026) Episode 4 Eng Sub</video:title>
      <video:description>Pls Love (2026) Cold and seemingly-perfect business heiress Phakinee reunites with Parnupsorn, a woman she once shared a fleeting seaside romance with—now working as a hostess at a luxury club in Bangkok. Determined to keep her close, Phakinee hires her as a personal assistant, forcing them to confront unresolved feelings, pride, and painful misunderstandings. As secrets and class differences threaten to pull them apart, both women must decide if they are brave enough to trust and love each other without judgement. Pls Love, glseries, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #PlsLove #glseries #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516227/3516227_720p.mp4</video:content_loc>
      <video:duration>2803</video:duration>
      <video:publication_date>2026-10-05T06:57:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qoutes of day</video:title>
      <video:description>Qoutes of day #Qoutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516226/3516226_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:57:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E05 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The Land. #KingTheland #koreanseries #hindidubbed #Koreandrama #HindidubbedKoreandrama #HindidubbedKoreantvseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516225/3516225_720p.mp4</video:content_loc>
      <video:duration>4359</video:duration>
      <video:publication_date>2026-10-05T06:57:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>89 DROPLETS</video:title>
      <video:description>WARNING THERE&apos;S SOMETHING IN THE WATER</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516224/3516224_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:57:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sonii K Narwal</video:title>
      <video:description>Sonii K Narwal · Original audio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516223/3516223_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T06:56:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion and models</video:title>
      <video:description>fashion and models 🌻🌻🌹🌹</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516222/3516222_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:56:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516221</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516221/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Italian Deco</video:title>
      <video:description>In Venice, even eternity moves. In the ripple of the canals, the passing boats, the light dancing across centuries-old walls. Beauty that belongs to e</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516221/3516221_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:55:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tropa de Elite 🚔 Baile Funk Interrompido</video:title>
      <video:description>Cena marcante de Tropa de Elite — o clima de um baile funk na favela muda completamente quando a polícia chega. Tensão, ação e um retrato cru do confronto nas ruas do Rio. 🎬🔥 #TropadeElite #cenabailefunk #filmepolicialbrasileiro #BOPE #CapitãoNascimento #favelaRiodeJaneiro #cinemanacional #açãobrasileira #filmedepolícia #cenadeconfronto #cinemabrasileiro #thrillerpolicial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516220/3516220_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-10-05T06:55:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E04 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The Land. #Koreandrama #Hindidubbed #Koreantvseries #KingTheland #koreantvserieshindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516219/3516219_720p.mp4</video:content_loc>
      <video:duration>4182</video:duration>
      <video:publication_date>2026-10-05T06:54:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crispy Fried Chicken ASMR Mukbang Eating Sounds</video:title>
      <video:description>Enjoy an incredibly satisfying ASMR mukbang featuring golden crispy fried chicken and crunchy chicken nuggets. Listen to the crunchy eating sounds and watch every bite of this delicious fast-food feast. #friedchickenmukbang #asmreatingsounds #crispyfriedchicken #chickenmukbang #crunchyeatingsounds #mukbangshow #friedchickenasmr #chickennuggets #fastfoodmukbang #eatingvideo #crunchychicken #foodasmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516218/3516218_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T06:53:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>After The Cheer Queen Ruined Me, I Fell For The Girl She Feared (2026) Eng Sub</video:title>
      <video:description>After The Cheer Queen Ruined Me, I Fell For The Girl She Feared (2026) Eng Sub After The Cheer Queen Ruined Me, I Fell For The Girl She Feared, seriesgl, girlseries, girllove, girlslove, LGBT, LGBTQ, GL, girls, thailandgl, thaigl, glthai, lesbian, lesbianlove #AfterTheCheerQueenRuinedMe #IFellForTheGirlSheFeared #seriesgl #girlseries #girllove #girlslove #LGBT #LGBTQ #GL #girls #thailandgl #thaigl #glthai #lesbian #lesbianlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516217/3516217_720p.mp4</video:content_loc>
      <video:duration>2587</video:duration>
      <video:publication_date>2026-10-05T06:53:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516216</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516216/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Business Purposel for PHOENIXWEAR 3</video:title>
      <video:description>You: Hi, this is [Your Name] from PhoenixWearSports. How are you doing? I’m reaching out because we are a sportswear manufacturer and supplier based in Pakistan. We specialize in custom sportswear, uniforms, T-shirts, polos, hoodies, and jackets. I just wanted to ask—do you currently source custom sportswear or uniforms for your business or team? If YES: That’s great. What type of products do you usually order, and approximately what quantity do you need? We can manufacture according to your design, logo, fabric, and specifications. I can also send you our latest designs and product details on WhatsApp or email. What would be the best way to send you our catalog? If they say “send me information”: Absolutely. I’ll send you our catalog and company details. You can take a look whenever you have time, and if you have any requirements, just let me know. Thank you for your time. Have a great day! #World-wideUsaUkfrance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516216/3516216_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:52:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Campaign 2</video:title>
      <video:description>Campaign platform #Campaign</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516215/3516215_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T06:52:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Modeling ❤️🌹🌻🥂</video:title>
      <video:description>fashion today</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516214/3516214_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:52:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute AI Cats and Tiger Cooking and Eating Braised Fish Together</video:title>
      <video:description>Watch this adorable animated AI story of fluffy cats fishing in a clear stream and preparing a delicious braised fish meal. Joined by a hard-working tiger friend who arrives after a long day selling fruits, they all cook and enjoy a warm feast together in a cozy wooden house. #aicatcooking #cutecatfishing #aitiger #cuteanimalanimation #3dcatanimation #cookingfish #cozyvillagelife #aigeneratedvideo #cuteanimalseating #animatedcatstory #cuteaianimals #fantasycooking</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516213/3516213_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-10-05T06:52:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King The Land S01E03 Hindi Dubbed Korean Drama</video:title>
      <video:description>King The land. #Koreandrama #Hindidubbed #Koreantvseries #KingTheland #hindidubbedKoreandrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516212/3516212_720p.mp4</video:content_loc>
      <video:duration>4130</video:duration>
      <video:publication_date>2026-10-05T06:51:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hell For You (2025) Episode 11 End Eng Sub</video:title>
      <video:description>Hell For You (2025) - JAPAN DRAMA Seeking revenge after being framed for murder 14 years ago, Sachiko Tachibana changes her appearance and infiltrates a popular influencer&apos;s home as a babysitter. Hell For You, romancedrama, dramaseries, seriesdrama, boygirllove, girlboylove, loveboygirl, lovegirlboy, japanesedrama, dramajapanese, japaneseromance, romancejapanese, movie, moviejapanese, japanesemovie, love, japaneselove #HellForYou #romancedrama #dramaseries #seriesdrama #boygirllove #girlboylove #loveboygirl #lovegirlboy #japanesedrama #dramajapanese #japaneseromance #romancejapanese #movie #moviejapanese #japanesemovie #love #japaneselove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516211/3516211_720p.mp4</video:content_loc>
      <video:duration>1190</video:duration>
      <video:publication_date>2026-10-05T06:51:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aktif</video:title>
      <video:description>Aktivitas #Aktif</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516210/3516210_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:50:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amelia tries to tease the cat that is usually fierce. #2</video:title>
      <video:description>Amelia 2</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516209/3516209_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:50:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vaga para analista de crédito banco digital</video:title>
      <video:description>Vaga para analista de validação de crédito no banco efi #homeoffice #efi #bancodigital #vaga #vagadeemprego #Brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516208/3516208_720p.mp4</video:content_loc>
      <video:duration>112</video:duration>
      <video:publication_date>2026-10-05T06:49:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Little Girl Eating Asian Feast Mukbang ASMR with Seafood</video:title>
      <video:description>An adorable mukbang compilation featuring a cute little girl enjoying a wide variety of delicious Asian dishes. Watch her happily eat seafood platters with crayfish and oysters, sweet and sour pork, grilled ribs, fresh kimchi, spicy cold noodles, and large pork bones with great appetite. #cutekidmukbang #littlegirleating #asianfoodmukbang #seafoodmukbang #ribsmukbang #kimchieating #asmreating #cutemukbang #coldnoodles #spicyfood #porkribs #mukbangshow #eatingfeast #mukbangcompilation #deliciousfood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516207/3516207_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-10-05T06:47:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wajah para pendosa di padang mahsyar</video:title>
      <video:description>Inilah nasehat singkat tentang wajah para pendosa di padang mahsyar #Nasehat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516206/3516206_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T06:47:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dota 2 Invoker madness</video:title>
      <video:description>Invoker Wet dream #dota #invoker #gameplay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516205/3516205_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:46:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>First Dragon Season 1 Episode 3 In Hindi</video:title>
      <video:description>Enjoy #FirstDragon #Anime #HindiAnime #AnotherWorld #TeleportAnime #MagicAnime #SoldierAnime #TeleportSoldierAnime #SpiritsAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516204/3516204_720p.mp4</video:content_loc>
      <video:duration>992</video:duration>
      <video:publication_date>2026-10-05T06:45:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qoutes of girl</video:title>
      <video:description>Qoutes of girl #Qoutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516203/3516203_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T06:45:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>বিজনেস</video:title>
      <video:description>বিজনেস</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516202/3516202_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T06:43:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ultimate Korean Spicy Food Mukbang ASMR with Tteokbokki</video:title>
      <video:description>An energetic Korean mukbang video featuring a variety of popular Korean street foods and convenience dishes. The creator enjoys cheesy pepperoni skewers topped with mustard and mayo, spicy tteokbokki with mandu (dumplings), fiery ramen noodles topped with corn cheese, spicy rice bowls, and chicken feet. Packed with crisp ASMR eating sounds and appetizing close-ups for spicy food lovers. #koreanmukbang #spicymukbang #tteokbokkimukbang #spicynoodles #ramenmukbang #asmreating #koreanstreetfood #pepperoniskewers #cheesecornramen #spicyricebowl #mandudumpling #chickenfeetmukbang #spicyfoodchallenge #satisfyingeatingsounds #koreanfoodshow</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516201/3516201_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T06:42:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amelia tries to tease the cat that is usually fierce.</video:title>
      <video:description>AMELIA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516200/3516200_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:42:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SHAMELESS</video:title>
      <video:description>Prince Harry and Meghan Markle&apos;s #PrinceHarry #MeghanMarkles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516199/3516199_720p.mp4</video:content_loc>
      <video:duration>155</video:duration>
      <video:publication_date>2026-10-05T06:42:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semakin dipaksa lupa, kok malah makin teringat? 🧠</video:title>
      <video:description>Pernah mengalami ini? Saat mencoba melupakan seseorang atau sebuah kejadian, justru pikiran itu muncul semakin sering. Ternyata ada alasan psikologis di baliknya. Tonton sampai akhir dan lihat apakah kamu pernah mengalaminya. 👀 Menurutmu, lebih sulit melupakan seseorang atau kenangan tentangnya? #psikologi #faktapsikologi #overthinking #susahmelupakanseseorang #psikologicinta #carakerjaotak #kenapasemakinberusahamelupakansemakiningat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516198/3516198_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T06:40:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sunset 109</video:title>
      <video:description>Sunset in airport #Sunset #view #nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516197/3516197_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T06:40:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wistoria</video:title>
      <video:description>The strongest silver sword</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516196/3516196_720p.mp4</video:content_loc>
      <video:duration>206</video:duration>
      <video:publication_date>2026-10-05T06:40:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pekerja keraasss nyari cuan</video:title>
      <video:description>#Khanadajapanindiacina</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516195/3516195_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-05T06:40:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spicy Crunchy Fried Chicken Mukbang ASMR with Hot Sauce</video:title>
      <video:description>An appetizing mukbang video featuring crispy fried chicken drenched in vibrant hot chili sauce. Enjoy the satisfying crunch and rich spicy flavors in an authentic visual and auditory ASMR eating experience. #mukbang #friedchicken #crispychicken #spicychicken #hotsauce #chilisauce #eatingshow #asmreating #crunchsound #foodchallenge #spicymukbang #delicious #comfortfood #fastfood #spicyfoodchallenge</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516194/3516194_720p.mp4</video:content_loc>
      <video:duration>410</video:duration>
      <video:publication_date>2026-10-05T06:39:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DrSyeda Masooma Shah Qazmi</video:title>
      <video:description>DrSyeda Masooma Shah Qazmi · Original audio 🤭😁</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516193/3516193_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T06:38:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TALK ABOUT AN AKWARD PLOT TWIST</video:title>
      <video:description>Prince Harry and Meghan Markle&apos;s #PrinceHarry #MeghanMarkles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516192/3516192_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-10-05T06:37:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayam kampung 3</video:title>
      <video:description>Panggil ayam mau kasih makan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516191/3516191_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T06:37:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny fails 26</video:title>
      <video:description>#funnypublicreaction</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516190/3516190_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T06:36:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mydragonncyuteeee</video:title>
      <video:description>dragonalizard #dragon #dragonar #fyp #dragonalizard</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516189/3516189_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:34:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geólogo aposentado transforma propriedade em oásis sustentável</video:title>
      <video:description>Geólogo aposentado transforma propriedade em oásis sustentável</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516188/3516188_720p.mp4</video:content_loc>
      <video:duration>427</video:duration>
      <video:publication_date>2026-10-05T06:34:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi 15 4th October 2026 Full Episode 20.</video:title>
      <video:description>Khatron Ke Khiladi 15 4th October 2026 Full Episode 20.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516187/3516187_720p.mp4</video:content_loc>
      <video:duration>5332</video:duration>
      <video:publication_date>2026-10-05T06:33:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rayan Update 2 2</video:title>
      <video:description>Check Anyone’s Property Details Online Using Name | Punjab Zameen Complete Method</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516185/3516185_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-10-05T06:31:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516184</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516184/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ambil bareng²</video:title>
      <video:description>Dijalan warga lagi panen udang #udang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516184/3516184_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T06:31:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>圣淘沙公司注册流程【电报TG： t.me/xq5990】</video:title>
      <video:description>1.有没有实体现场，了解现场的具体位置，现场玩家多不多。 2.具有雄厚的资金链，出款速度是否快速。 3.是不是先发排后下注，是不是用铅笔点排，透明排靴。 4.是否能在网上通过视频验证与实体现场同步来证实。 5.全程人工操作、必须是透明模式。 6.可切换视频的任何角度以便查看是否有真实的现场大厅。 7.如果没有达到以上条件的，那就毋庸置疑肯定是假的平台， 千万不能玩。正规的平台都具备以上条件。</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516183/3516183_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:31:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quote of year</video:title>
      <video:description>Qoutes of year #Qoutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516182/3516182_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:30:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PART 1 stranded on an island🏝️</video:title>
      <video:description>Stranded alone on a mysterious island with no way home. With limited supplies and the dangers of the wild surrounding him, survival becomes his only choice. How long can he survive? And will he ever find a way off the island? Watch until the end to discover what happens. #strandedonanisland #desertedisland #islandsurvival #survivalstory #survivaladventure #strandedalone #survivalchallenge #wildernesssurvival #lostonanisland #mysteriousisland #extremesurvival #adventurestory #survivalskills #strandedsurvival #aloneinthewilderness</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516180/3516180_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:29:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 18</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516179/3516179_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T06:29:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>⚡ menggelegar</video:title>
      <video:description>⚡ menggelegar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516178/3516178_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T06:28:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bahria Homes</video:title>
      <video:description>7 Marla Corner House Double Unit House For Sale…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516175/3516175_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T06:27:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bilal writes</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516174/3516174_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:27:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pectaa Muzaffargarh</video:title>
      <video:description>Dr. Mahjabeen Principal of PECTAA Muzaffargarh visited the class, engaged the students in a question-and-answer session, assessed their academic progr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516173/3516173_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T06:27:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516172</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516172/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comment &quot;go&quot; for full guide 3</video:title>
      <video:description>Comment &quot;go&quot; for full guide #Commentgoforfullguide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516172/3516172_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T06:26:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>leaf out of princess kate&apos;s book</video:title>
      <video:description>leaf out of princess kate&apos;s book #princess #meghanmarkle #english</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516170/3516170_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T06:26:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan alam di kabupaten Magelang</video:title>
      <video:description>&quot;Keindahan alam yang menenangkan jiwa — di mana langit, bumi, dan semuanya menyatu dalam damai. 🤍 Menatap pemandangan ini, seolah semua lelah perlahan luruh, digantikan ketenangan yang tulus. Alam mengajarkan: berhenti sejenak, tarik napas, dan nikmati keindahan yang ada di depan mata.&quot; #PemandanganAlamIndahKetenanganKeindahanAlamDamai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516169/3516169_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T06:25:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ROBLOX HORROR!!</video:title>
      <video:description>A horror roblox ai #Roblox #horror #ai #funny #robloxfunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516168/3516168_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T06:25:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Simpsons 🍩 S33E7 &quot;A Serious Flanders&quot; Part 2</video:title>
      <video:description>The gripping conclusion of The Simpsons&apos; crime-thriller parody — chaos erupts in Springfield as Marge races to save Homer and Chief Wiggum deals with an unprecedented body count. Classic Simpsons meets prestige drama satire! 😂🍩 #TheSimpsonsseason33 #Simpsonsepisode7 #ASeriousFlandersPart2 #HomerSimpson #MargeSimpson #ChiefWiggum #Springfield #Simpsonscrimeparody #animatedcomedy #cartoonshorts #TVshowclips #Foxanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516167/3516167_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-10-05T06:25:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516166</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516166/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎧 lagi mendengar kan musik</video:title>
      <video:description>🎧 mendengarkan musik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516166/3516166_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:25:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ratu assist mlbb</video:title>
      <video:description>#Game #mlbb #zetian #mobilelagends #aksiseru</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516165/3516165_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T06:24:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Duet in platform</video:title>
      <video:description>Duet in platform #Duet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516164/3516164_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T06:24:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Simpsons 🍩 S33E7 &quot;A Serious Flanders&quot;</video:title>
      <video:description>A wild clip from The Simpsons Season 33, Episode 7 — Homer gets caught up in real danger after Ned&apos;s secret stash of money attracts a dangerous criminal, turning Springfield into the set of a crime thriller parody. 😂🍩 #TheSimpsonsseason33 #Simpsonsepisode7 #ASeriousFlanders #HomerSimpson #NedFlanders #Springfield #Simpsonsfunnyclips #Simpsonscrimeparody #animatedcomedy #cartoonshorts #TVshowclips #Foxanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516163/3516163_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-10-05T06:23:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful 469</video:title>
      <video:description>#Aividio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516162/3516162_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T06:23:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What If Rhinos Plowed an Indonesian Rice Field? 🦏🌾</video:title>
      <video:description>Imagine seeing this in an Indonesian village… two powerful rhinos pulling a traditional plow through a rice field. 🦏🌾 Would you believe it if you saw this in real life? 👀 #rhinoplowingricefield #Indonesianricefield #traditionalfarming #Indonesiavillage #rhinovideo #wildlife #amazinganimals #farmerIndonesia #ricefarming #traditionalagriculture #AIgeneratedvideo #realisticAIvideo #unusualanimals #naturevideo #viralreels #Indonesianature #ruralIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516160/3516160_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:22:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>addababbas</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516159/3516159_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T06:22:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>圣淘沙娱乐公司【qq 3967995990】</video:title>
      <video:description>1.有没有实体现场，了解现场的具体位置，现场玩家多不多。 2.具有雄厚的资金链，出款速度是否快速。 3.是不是先发排后下注，是不是用铅笔点排，透明排靴。 4.是否能在网上通过视频验证与实体现场同步来证实。 5.全程人工操作、必须是透明模式。 6.可切换视频的任何角度以便查看是否有真实的现场大厅。 7.如果没有达到以上条件的，那就毋庸置疑肯定是假的平台， 千万不能玩。正规的平台都具备以上条件。</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516158/3516158_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:22:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ishq eahlybaitt</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516157/3516157_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T06:21:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516156</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516156/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Govt Graduate College Farooq Colony Sargodha 3</video:title>
      <video:description>آج قلم صرف الفاظ نہیں، محنت کا حساب لکھ رہا ہے۔ ✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516156/3516156_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:21:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>karwibatain</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516154/3516154_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T06:20:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kompilasi Adek Baru Kenangan Bersama Kakak - Animasi Doracimin - Doracimin</video:title>
      <video:description>#kartun #doracimin #animasilucuindo Selamat datang di dunia Animasi Doracimin dengan Genre Fantasi dan Komedi, Animasi Doracimin dibuat dengan menggunakan Aplikasi Flipaclip, Semoga salah satu dari kalian terhibur. Dukung Animator Doracimin Agar Lebih semangat https://sociabuzz.com/doracimin_ SOCIAL MEDIA : IG topup : doracimin_topup IG : doracimin_ Tiktok Utama : doracimin Tiktok Second : doracimin_official Snack Video : Doracimin Bstation : Doracimin Facebook : Doracimin Jangan lupa like komen dan subscribe ya ges #animasi #kartun #doracimin #animasidoracimin #animasilucuindo animasi, kartun, doracimin, animasi doracimin, vernalta, tekotok, animasi podtoon, animasi nopal, dasi gantung, dhot design, animasi lucu, kartun lucu, lucu, ngakak, video lucu, video ngakak, animasi kocak bikin ngakak.animasi sekolah,animasi lucu sekolahan,animasi lokal,animasi lucu indonesia,animasi seru sekolahan, animasi keren sekolahan, #animasikartundoraciminanimasidoraciminanimasilucuindo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516153/3516153_720p.mp4</video:content_loc>
      <video:duration>1028</video:duration>
      <video:publication_date>2026-10-05T06:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>one sidded claims</video:title>
      <video:description>When Meghan Markle recently spoke out about her experiences #MeghanMarkle #English</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516152/3516152_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-10-05T06:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Simpsons 🍩 S33E14 Funniest Moments</video:title>
      <video:description>A hilarious clip from The Simpsons Season 33, Episode 14 — Homer gets caught up in an internet scandal after footage of him makes him an overnight pariah in Springfield. Classic chaos and laughs! 😂🍩 #TheSimpsonsseason33 #Simpsonsepisode14 #HomerSimpson #Springfield #Simpsonsfunnyclips #Simpsonsviralmoment #animatedcomedy #cartoonshorts #Simpsonsseason33episode14 #TVshowclips #Simpsonshighlights #Foxanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516151/3516151_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-10-05T06:19:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic Soul</video:title>
      <video:description>Beautiful view of NH44 Jammu and Kashmir road ❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516150/3516150_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasih sayang kaka ditengah kemiskinan</video:title>
      <video:description>Di tengah keterbatasan, kasih sayang seorang kakak tetap menjadi tempat ternyaman bagi adiknya. ❤️ Mereka mungkin tak punya banyak, tapi mereka punya satu sama lain. Kecil di usia, besar di hati. 🥺❤️ #KasihSayangKakakKisahHidupSiblingLoveKeluargaMengharukan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516149/3516149_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T06:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afrika funny 3</video:title>
      <video:description>Funny video #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516148/3516148_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T06:19:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516147</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516147/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dream building</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516147/3516147_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:18:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Picnik ke pelabuhan ratu Sukabumi</video:title>
      <video:description>Tempat yang rekomendasi untuk melepas lelah... #Perjalanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516146/3516146_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T06:18:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Afrika funny #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516145/3516145_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T06:18:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ling Feels Unstoppable With Angela 💀</video:title>
      <video:description>#Mobilelegends #MLBB #MashaMLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516144/3516144_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:18:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Afrika funny #Vidiofunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516143/3516143_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T06:17:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fun n fun</video:title>
      <video:description>Ada ada aja ni kegiatannya #India</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516142/3516142_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T06:17:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nanti kalo yang aku udah ke kumpul aku beli kebahagiaan ku sendiri</video:title>
      <video:description>Semangat ngumpulin duet nya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516141/3516141_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T06:17:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love Blue 💙</video:title>
      <video:description>Love Blue 💙</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516140/3516140_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T06:16:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT FOR END 8</video:title>
      <video:description>FUNNY VIDEO #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516139/3516139_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T06:16:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Meghan Markle recently spoke out about her experiences 2</video:title>
      <video:description>When Meghan Markle recently spoke out about her experiences #MeghanMarkle #English #Harry</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516138/3516138_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-10-05T06:15:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>    The Love Behind The Legend — Inspired by Michael Jackson ❤️</video:title>
      <video:description>Behind every fame, there’s a heart that simply longs to be truly loved. 💫 True love isn&apos;t about millions — it&apos;s about being understood by the one who matters most. The most beautiful love stories live quietly in the heart 💌✨ #love #truelove #michaeljackson #quotes #heart #romance #inspiration</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516137/3516137_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:15:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KEMBALINYA RAJA NAGA</video:title>
      <video:description>KEMBALINYA RAJA NAGA #KEMBALINYARAJANAGA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516136/3516136_720p.mp4</video:content_loc>
      <video:duration>1159</video:duration>
      <video:publication_date>2026-10-05T06:14:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>گوادر اجتماع دعا مولانا خورشید صاحب</video:title>
      <video:description>گوادر اجتماع دعا مولانا خورشید صاحب #ReligiousPeaceLove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516135/3516135_720p.mp4</video:content_loc>
      <video:duration>350</video:duration>
      <video:publication_date>2026-10-05T06:14:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comment &quot;go&quot; for full guide 2</video:title>
      <video:description>Comment &quot;go&quot; for full guide #Commentgoforfullguide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516134/3516134_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T06:14:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mood qutosu</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516133/3516133_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T06:13:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comment &quot;go&quot; for full guide</video:title>
      <video:description>Comment &quot;go&quot; for full guide #Commentgoforfullguide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516132/3516132_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:13:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cheap combo</video:title>
      <video:description>cheap combo ice cup #vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516131/3516131_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-10-05T06:13:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muhammad 16</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516130/3516130_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T06:12:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 This Roblox Grandpa Can&apos;t Stop Laughing!</video:title>
      <video:description>This hilarious Roblox grandpa suddenly bursts into uncontrollable laughter! 😂 His laugh just keeps getting louder and funnier. Watch until the end! #Robloxgrandpa #funnyRoblox #Robloxfunnymoments #laughinggrandpa #Robloxcomedy #hilariousRoblox #funnygaming #Robloxanimation #RobloxShorts #funnyShorts #viralRoblox #comedyvideo #gamingShorts #funnycharacter #Robloxmeme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516129/3516129_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:12:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bigg Bigg Boss season 20 episode 28. Day 27.Salman Demands Honest Answers.720p</video:title>
      <video:description>Bigg Boss season 20 episode 28. Day 27.Salman Demands Honest Answers.720p.Salman ne kahaa ki ye season Bhoot boring ja raha hai. #Jiohotstar #Febspot.com . Please subscribe kar lo dosto toh aur bhi videos aane wali hai ❤️ Subscribe #IndiaandAmerica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516128/3516128_720p.mp4</video:content_loc>
      <video:duration>4296</video:duration>
      <video:publication_date>2026-10-05T06:10:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pakistani drivers 2</video:title>
      <video:description>Pakistani drivers #DangerousroadPakistanidrivers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516127/3516127_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T06:10:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prem Keetanu (2026)</video:title>
      <video:description>👍Don&apos;t Forget Like and Follow! #PremKeetanu2026 #PremKeetanuFullMovie #HindiMovie2026 #NewMovie2026 #yomovie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516126/3516126_720p.mp4</video:content_loc>
      <video:duration>7773</video:duration>
      <video:publication_date>2026-10-05T06:10:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Want10$</video:title>
      <video:description>Want $10K/month from dropshipping? Focus on 3 things: Validating products before spending too much Ads that actually convert, not just views Scaling strategy (knowing when to push budget) Dropshipping is math + consistency. Get those 3 pieces #Want10kmonth</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516125/3516125_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T06:09:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aku melihatmu</video:title>
      <video:description>Aku melihatmu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516124/3516124_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T06:09:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sing n song</video:title>
      <video:description>This song so sweet #Song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516123/3516123_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T06:09:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hakeem ismail 2</video:title>
      <video:description>کیا آپ بھی Pus Cells کے مسئلے سے پریشان ہیں؟</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516122/3516122_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T06:08:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monster of sea</video:title>
      <video:description>Mereka Menarik Tali Itu… Tapi Apa yang Muncul dari Laut?! 😱🌊 Awalnya mereka mengira hanya menangkap sesuatu yang besar… Tapi yang muncul dari dalam laut ternyata jauh lebih mengerikan! 😳🐉 Tonton sampai akhir! #monsterlaut #monsterlautraksasa #seamonster #giantseamonster #monsterdarilaut #makhluklautmisterius #misterilaut #nelayan #fishingadventure #giantcreature #oceanmystery #seacreature #underwatermonster #scaryocean #AIvideo #AIstory #cinematicAI #viralvideo #videopendek #FYP #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516121/3516121_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:08:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>মাশাল্লাহ 2</video:title>
      <video:description>মাশাল্লাহ</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516120/3516120_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:07:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kompilasi Dunia Ghaib - Animasi Doracimin - Doracimin</video:title>
      <video:description>#kartun #doracimin #animasihorror Episode 246 : Menceritakan kompilasi Dunia Ghaib Selamat datang di dunia Animasi Doracimin dengan Genre Fantasi dan Komedi, Animasi Doracimin dibuat dengan menggunakan Aplikasi Flipaclip, Semoga salah satu dari kalian terhibur. Dukung Animator Doracimin Agar Lebih semangat https://sociabuzz.com/doracimin_ SOCIAL MEDIA : IG topup : doracimin_topup IG : doracimin_ Tiktok Utama : doracimin Tiktok Second : doracimin_official Snack Video : Doracimin Bstation : Doracimin Facebook : Doracimin Jangan lupa like komen dan subscribe ya ges #animasi #kartun #doracimin #animasidoracimin #animasilucuindo #animasihorror #animasihorrorlucu animasi, kartun, doracimin, animasi doracimin, vernalta, tekotok, animasi podtoon, animasi nopal, dasi gantung, dhot design, animasi lucu, kartun lucu, lucu, ngakak, video lucu, video ngakak, animasi kocak bikin ngakak.animasi sekolah,animasi lucu sekolahan,animasi lokal,animasi lucu indonesia,animasi seru sekolahan, animasi keren sekolahan, animasi horror, #animasi #kartun #doracimin #animasidoracimin #animasilucuindo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516119/3516119_720p.mp4</video:content_loc>
      <video:duration>1020</video:duration>
      <video:publication_date>2026-10-05T06:07:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 16</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516118/3516118_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T06:06:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fidarabia 18</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516117/3516117_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T06:06:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teskilat - Episode 187 (English Subtitles)</video:title>
      <video:description>National Intelligence Organization members are always ready to serve to destroy the enemies of Turkey. This is, Teskilat (The Order, The Intel). #teskilatepisode187 #teskilatepisode187englishsubtitles #teskilatepisode187withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516116/3516116_720p.mp4</video:content_loc>
      <video:duration>8508</video:duration>
      <video:publication_date>2026-10-05T06:06:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 15</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516115/3516115_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T06:06:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#bikin laper bule 27</video:title>
      <video:description>masakan khas Indonesia #hiburan #kuliner #wisata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516114/3516114_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T06:06:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ketika Tangan Dan Kaki Berkata</video:title>
      <video:description>Ketika Tangan Dan Kaki Berkata by Fadli &amp; Kadri Sebuah lagu yang ditulis oleh Taufik Ismail buat Chrisye dibawakan kembali oleh Fadli dan Kadri #Chrisye #TaufikIsmail #Fadli #Kadri #Lagureligi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516113/3516113_720p.mp4</video:content_loc>
      <video:duration>261</video:duration>
      <video:publication_date>2026-10-05T06:06:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 14</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516112/3516112_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T06:05:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 13</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516111/3516111_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T06:05:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 12</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516110/3516110_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T06:05:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m ladybird</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516109/3516109_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T06:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 11</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516108/3516108_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T06:05:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 10</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516107/3516107_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:04:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 9</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516106/3516106_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T06:04:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 8</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516105/3516105_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T06:04:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kompilasi di Bulan Ramadhan Part 3 - Animasi Doracimin - Doracimin</video:title>
      <video:description>#kartun #doracimin #animasilucuindo Episode 212 : Tentang Kompilasi Ramadhan Part 3 Selamat datang di dunia Animasi Doracimin dengan Genre Fantasi dan Komedi, Animasi Doracimin dibuat dengan menggunakan Aplikasi Flipaclip, Semoga salah satu dari kalian terhibur. Dukung Animator Doracimin Agar Lebih semangat https://sociabuzz.com/doracimin_ SOCIAL MEDIA : IG topup : doracimin_topup IG : doracimin_ Tiktok Utama : doracimin Tiktok Second : doracimin_official Snack Video : Doracimin Bstation : Doracimin Facebook : Doracimin Jangan lupa like komen dan subscribe ya ges #animasi #kartun #doracimin #animasidoracimin #animasilucuindo animasi, kartun, doracimin, animasi doracimin, vernalta, tekotok, animasi podtoon, animasi nopal, dasi gantung, dhot design, animasi lucu, kartun lucu, lucu, ngakak, video lucu, video ngakak, animasi kocak bikin ngakak.animasi sekolah,animasi lucu sekolahan,animasi lokal,animasi lucu indonesia,animasi seru sekolahan, animasi keren sekolahan, #animasi #kartun #doracimin #animasidoracimin #animasilucuindo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516104/3516104_720p.mp4</video:content_loc>
      <video:duration>849</video:duration>
      <video:publication_date>2026-10-05T06:04:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 7</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516103/3516103_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:03:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mianus</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516102/3516102_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T06:03:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Air minum</video:title>
      <video:description>Jangan lupa,harus perbanyak minum karena cuaca sedang tidak baik baik saja #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516101/3516101_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T06:03:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 6</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516100/3516100_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T06:03:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 5</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516099/3516099_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T06:02:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>real madrid vs bayern muenchen 2</video:title>
      <video:description>#realmadrid #bayernmuenchen #football #usa #uk #canada #australia #newzealand #germany #spain #france #japan #china #korea</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516098/3516098_720p.mp4</video:content_loc>
      <video:duration>152</video:duration>
      <video:publication_date>2026-10-05T06:02:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐱 Amazing Cat Facts You Probably Didn’t Know!</video:title>
      <video:description>Cats are adorable, but they also have many fascinating habits and behaviors. 🐱❤️ Do you have a cat at home? Watch closely and see if your cat does the same things! 😻 #cat #cutecat #funnycat #catfacts #adorablecat #kitten #cutekitten #catlover #catlovers #pet #pets #domesticcat #funnyanimals #cuteanimals #animalfacts #catbehavior #catvideo #catphotography #lovelycat #adorablekitten #animallover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516097/3516097_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T06:00:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The chicken&apos;s fate was truly unfortunate.</video:title>
      <video:description>the chicken is in the wrong place #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516096/3516096_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T06:00:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exploring the Peaceful Beauty of Mount Tranggulasih in Roblox!</video:title>
      <video:description>Take a peaceful breath and enjoy a cozy, aesthetic journey through Mount Tranggulasih in Roblox! Join me as I explore flower fields, ride bicycles, picnic under the trees, and enjoy the breathtaking sunset views with animals around. ​🌸 Location: Mount Tranggulasih (Roblox) 🎵 Music: Soft / Relaxing Lo-Fi Vibe ​If you enjoyed this video, please Like, Comment, and Subscribe for more aesthetic Roblox adventures! ✨🌾 #Roblox #MountTranggulasih #RobloxAesthetic #RobloxNature #CozyRobloxGameplay #RobloxVibe #RobloxPicnic #AestheticRobloxAvatar #RobloxMountTranggulasih #RelaxingRoblox</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516095/3516095_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T05:59:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freandly</video:title>
      <video:description>Pertemanan yg dulu pernah ada #Teman #freand #seorangteman #masawaktu #dimanasekarang #dimana #mereka</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516094/3516094_720p.mp4</video:content_loc>
      <video:duration>178</video:duration>
      <video:publication_date>2026-10-05T05:58:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meme afrika</video:title>
      <video:description>Funny video #Vidiofunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516093/3516093_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T05:57:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kompilasi Adek Baru Season 2 Full - Animasi Doracimin - Doracimin</video:title>
      <video:description>#kartun #doracimin #animasilucuindo Terimakasih Sudah Menonton Selamat datang di dunia Animasi Doracimin dengan Genre Fantasi dan Komedi, Animasi Doracimin dibuat dengan menggunakan Aplikasi Flipaclip, Semoga salah satu dari kalian terhibur. Dukung Animator Doracimin Agar Lebih semangat https://sociabuzz.com/doracimin_ SOCIAL MEDIA : IG : doracimin_ Tiktok Utama : doracimin Tiktok Second : doracimin_official Snack Video : Doracimin Bstation : Doracimin Facebook : Doracimin Jangan lupa like komen dan subscribe ya ges #animasi #kartun #doracimin #animasidoracimin #animasilucuindo animasi, kartun, doracimin, animasi doracimin, vernalta, tekotok, animasi podtoon, animasi nopal, dasi gantung, dhot design, animasi lucu, kartun lucu, lucu, ngakak, video lucu, video ngakak, animasi kocak bikin ngakak. #animasi #kartun #doracimin #animasidoracimin #animasilucuindo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516092/3516092_720p.mp4</video:content_loc>
      <video:duration>735</video:duration>
      <video:publication_date>2026-10-05T05:57:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gonul Dagi - Episode 225 (English Subtitles)</video:title>
      <video:description>An Anatolian Tale in the &quot;The Mountain of Hearts&quot; is the story of pale yellow soils, legends that have been voiced for years, and unforgettable loves, Gonul Dagi is the story of Anatolian children, who had big dreams in their little world, is the story of 3 cousins who pursue their dreams in the steppe and try to achieve the impossible despite all obstacles. This is, Gonul Dagi (The Mountain of Hearts) #gonuldagiepisode225 #gonuldagiepisode225englishsubtitles #gonuldagiepisode225withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516091/3516091_720p.mp4</video:content_loc>
      <video:duration>9225</video:duration>
      <video:publication_date>2026-10-05T05:57:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours episode 6  hindi dubbed</video:title>
      <video:description>K drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516090/3516090_720p.mp4</video:content_loc>
      <video:duration>3861</video:duration>
      <video:publication_date>2026-10-05T05:57:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan alam 22</video:title>
      <video:description>Pemandangan alam #Alam #pemandangan #video #trend #sunset</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516089/3516089_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:56:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>400m men s3</video:title>
      <video:description>Ifam oordegem #Belgische</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516088/3516088_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T05:56:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afrika funny 2</video:title>
      <video:description>Funny video #Videofunnyafrika</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516087/3516087_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T05:56:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Morning Shower</video:title>
      <video:description>Girl take a bath #Sexy #shower #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516086/3516086_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:56:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rush.Hour.3.2007</video:title>
      <video:description>بعد تعرض السفير (هان) لمحاولة اغتيال، يعود (لي) و(كارتر) إلى العمل معًا، ويتوجها إلى باريس لحماية امرأة فرنسية لديها معلومات عن قادة العصابات الثلاثية، فيقوم (لي) بعقد لقاء سري مع مسؤول بهيئة الأمم المتحدة، كما يقع في صراع شخصي مع أحد رجال العصابات الصينية، ويجد نفسه في سباق عبر معالم مدينة باريس. #الكلماتالمفتاحيةRushHour3 #ساعةالذروة3 #RushHour32007 #فيلمRushHour3 #فيلمساعةالذروة #JackieChan #جاكيشان #ChrisTucker #كريستاكر #Lee #Carter #InspectorLee #JamesCarter #أفلامأكشن #أفلامكوميديا #أفلامجاكيشان #أفلامكريستاكر #أفلامأكشنوكوميديا #أفلامشرطة #أفلاممطاردات #أفلامقتال #أفلامصينية #أفلامهوليوود #Paris #باريس #RushHour #ساعةالذروة3مترجم #RushHour3مترجم #RushHour3كامل #شرحفيلمRushHour3 #قصةفيلمRushHour3 #ملخصفيلمRushHour3 #تحليلفيلمRushHour3 #JackieChanmovies #ChrisTuckermovies #ActionComedyMovies #RushHour3Movie #RushHour3FullMovie #RushHour3Arabic #RushHour3Review</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516085/3516085_720p.mp4</video:content_loc>
      <video:duration>5447</video:duration>
      <video:publication_date>2026-10-05T05:56:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afrika funny</video:title>
      <video:description>Funny video #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516084/3516084_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T05:55:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POV: You&apos;re Sitting Alone In Front of The Fire at Night - So Relaxing 🔥</video:title>
      <video:description>Experience the warmth and peace of a real campfire at night. The sound of crackling wood is perfect for relaxing, sleeping, meditation, stress relief, and cozy winter nights. No music, just pure natural fire sounds. Let this fire burn in your background while you study, sleep, or relax. 🔥 If you enjoy this, watch the FULL 1 HOUR version on my channel! 💬 Where are you watching from? Comment below. 👍 Don&apos;t forget to LIKE and SUBSCRIBE for more relaxing fireplace videos. #fypcampfirefireplacecracklingfirerelaxingasmrbonfirecozyfireplacevibessleepaidmeditationapiunggunaesthetichealingsatisfying</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516083/3516083_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T05:54:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Christin pike</video:title>
      <video:description>Christin pike the eksekusi #Amerika</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516081/3516081_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T05:53:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drama, Headlines, and High Stakes</video:title>
      <video:description>Drama, Headlines, and High Stakes #PrinceHarry #MeghanMarkle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516080/3516080_720p.mp4</video:content_loc>
      <video:duration>127</video:duration>
      <video:publication_date>2026-10-05T05:52:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waw Amazing Nature</video:title>
      <video:description>#Nature #foryou #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516079/3516079_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:52:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kambing 5</video:title>
      <video:description>Kambing ternak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516078/3516078_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T05:51:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ungkapan isi hati 4</video:title>
      <video:description>Broken home #Indo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516077/3516077_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T05:50:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Work with heat</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516076/3516076_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T05:50:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 4</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516075/3516075_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:50:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 3</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516074/3516074_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:50:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Started a Business at 7 Years Old! What an Inspiring Story!”</video:title>
      <video:description>What if you started your first business at just 7 years old? 🐔💰 This is the inspiring story of how a simple chicken business became the beginning of a young entrepreneur’s journey. It’s not about how much money you have—it’s about having the courage to start, learn, and keep growing. 🚀 Would you start a business at 7? Let me know in the comments! 👇 #startedbusinessat7 #businessat7yearsold #youngentrepreneur #childentrepreneur #youngbusinessowner #chickenbusiness #chickenfarmingbusiness #startingabusinessyoung #businesssuccessstory #entrepreneurstory #youngentrepreneurstory #businessmotivation #entrepreneurship #smallbusiness #businessforbeginners #successstory #entrepreneurialmindset #businessinspiration #kidsbusiness #startingabusiness</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516073/3516073_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T05:50:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio Cat funny</video:title>
      <video:description>Cat funny #Catfunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516072/3516072_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-05T05:50:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tobey Maguire V&apos;s tom Holland 💀🥶</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍😍😍😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516071/3516071_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:49:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANOTHER CRABS THEASURE: desafio passado agora pra onde ir..</video:title>
      <video:description>ANOTHER CRABS THEASURE: desafio passado agora pra onde ir.., procurar o caminho certo #ANOTHERCRABSTHEASURE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516070/3516070_720p.mp4</video:content_loc>
      <video:duration>234</video:duration>
      <video:publication_date>2026-10-05T05:49:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. 2</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516069/3516069_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T05:49:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE.</video:title>
      <video:description>DON’T SKIP THIS VIDEO IF YOU DON’T WANT TO REGRET IT FOR THE REST OF YOUR LIFE. #DON’TSKIPTHISVIDEOIFYOUDON’TWANTTOREGRETITFORTHERESTOFYOURLIFE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516068/3516068_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T05:49:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat funny 65</video:title>
      <video:description>Funny video #Catfunnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516067/3516067_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-05T05:49:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Part seventy</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516066/3516066_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T05:48:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the most beautiful place in florida</video:title>
      <video:description>#beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516065/3516065_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:48:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hijre mohobbat yaara</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516064/3516064_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T05:48:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANOTHER CRABS THEASURE: desafio difícil dessa lagosta</video:title>
      <video:description>ANOTHER CRABS THEASURE: desafio difícil dessa lagosta, mordendo.. #ANOTHERCRABSTHEASURE</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516063/3516063_720p.mp4</video:content_loc>
      <video:duration>125</video:duration>
      <video:publication_date>2026-10-05T05:48:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cirkin - Episode 11 (English Subtitles)</video:title>
      <video:description>Meryem, who clings to life guided only by her good intentions, as she reunites with her one true love, Kadir—now a man shaped by power, wealth, and ambition. This is, Cirkin (Ugly). #cirkinepisode11 #cirkinepisode11englishsubtitles #cirkinepisode11withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516062/3516062_720p.mp4</video:content_loc>
      <video:duration>8822</video:duration>
      <video:publication_date>2026-10-05T05:47:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joining the Brazilian style dance trend</video:title>
      <video:description>#Trendingdance #challengeViraldancetrends #Currentdancetrend #TikTokdancecompilation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516061/3516061_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:47:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perfect moment 😁</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑😍💗😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516060/3516060_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T05:47:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exploring the Majestic Nature of Mt. Aksara in Roblox!</video:title>
      <video:description>Join me on a peaceful and relaxing journey through the stunning, hyper-realistic nature of Mt. Aksara in Roblox! From lush forests and serene waterfalls to wildlife encounters like deer and elephants, explore this breathtaking map and enjoy the tranquil vibe. ​Don&apos;t forget to Like, Comment, and Subscribe for more Roblox exploration videos! 🌲✨ #​Roblox #RobloxNature #MtAksaraRoblox #RobloxRealisticGraphics #RobloxExploration #RelaxingRobloxGameplay #RobloxWildlife #RobloxWaterfall #RobloxForest #RobloxAesthetic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516059/3516059_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:46:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vina Tries Out a New App</video:title>
      <video:description>Vina Tries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516058/3516058_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:46:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Should the King show Harry and Meghan &quot;more compassion&quot; in order to prevent the Duke of Windsor from</video:title>
      <video:description>Should the King show Harry and Meghan &quot;more compassion&quot; in order to prevent the Duke of Windsor from making the same mistake? #MeghanMarkle #Harry #English</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516057/3516057_720p.mp4</video:content_loc>
      <video:duration>143</video:duration>
      <video:publication_date>2026-10-05T05:44:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dance 755</video:title>
      <video:description>Beautyfull dancer #Dancerviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516056/3516056_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T05:43:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Varsha Thakur</video:title>
      <video:description>Dr Krishan Lal Sehgal · Uba Bame Rezta 🫶🏻🤗🙏</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516055/3516055_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:43:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Biker 2</video:title>
      <video:description>Learning to ride a motorcycle at 34 years old. It’s never too late to learn something new. ❤️🏍️ #Biker</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516054/3516054_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T05:43:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🧡 love</video:title>
      <video:description>🧡</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516053/3516053_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T05:42:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pepsi Ads</video:title>
      <video:description>the best only drink is pepsi #digitalmarketer #telemarketing #directmarketing #brandawareness #digitalmarketer #telemarketing #directmarketing #brandawareness #advertising #PEPSI #pepsiinternational</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516052/3516052_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:42:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anime adult episode 1 Yowayowa Sensei Uncensored - Hindi</video:title>
      <video:description>#Animeadultwebseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516051/3516051_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-10-05T05:42:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Explore with Mobeen</video:title>
      <video:description>Naqvi Burj — Akbari Fort, Gujrat 🏰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516050/3516050_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:41:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rumah sakit</video:title>
      <video:description>Ketika anak sakit semuanya berubah #Rumahsakit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516049/3516049_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:40:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soul Land (Douluo Dalu) Season 2 Episode 15 English Subbed</video:title>
      <video:description>Soul Land (Douluo Dalu) Season 2 Episode 15 English Subbed #Tangsan #XiaoWu #DaiMuBai #Shrek #Douluo #Dalu #SoulLand #Donghua #Chinese #Anime #XiaoYan #Lindong #MuChen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516048/3516048_720p.mp4</video:content_loc>
      <video:duration>1119</video:duration>
      <video:publication_date>2026-10-05T05:40:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemecah ombak</video:title>
      <video:description>Ombaknya besar di pantai jadi di bikin pemecah biar aman #ombak #pantai #laut #pasirputih #pejalanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516047/3516047_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:39:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Marketing, explained at one party. 😄</video:title>
      <video:description>Marketing, explained at one party. 😄 You introduce yourself — that’s advertising. Your friend hypes you up — that’s word-of-mouth. Someone’s already heard great things about you — that’s branding. And just as you’re about to talk to someone interesting, a rival jumps in first — that’s competition. Funny, but true: good marketing is just knowing who you&apos;re talking to, why they should pick you, and how they&apos;ll react. Save this for later and share it with someone who likes business made simple. [Digital marketing, Captions, customer feedback, brand awareness, digital marketer, advertising, telemarketing, direct marketing, professor, explanation video, typography, motioin graphics, Anime, Animation, 3d animation, Brand promotion, Social media marketing, Korea, USA, America, China, Indonesia, Necklace, red outfit, black outfit, green outfit, captions, viral] #digitalmarketer #telemarketing #directmarketing #brandawareness #Digitalmarketing #Captions #customerfeedback #brandawareness #digitalmarketer #advertising #telemarketing #directmarketing #professor #explanationvideo #typography #motioingraphics #Anime #Animation #3danimation #Brandpromotion #Socialmediamarketing #Korea #USA #America #China #Indonesia #Necklace #redoutfit #blackoutfit #greenoutfit #vira</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516046/3516046_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T05:38:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gonul Dagi - Episode 224 (English Subtitles)</video:title>
      <video:description>An Anatolian Tale in the &quot;The Mountain of Hearts&quot; is the story of pale yellow soils, legends that have been voiced for years, and unforgettable loves, Gonul Dagi is the story of Anatolian children, who had big dreams in their little world, is the story of 3 cousins who pursue their dreams in the steppe and try to achieve the impossible despite all obstacles. This is, Gonul Dagi (The Mountain of Hearts). #gonuldagiepisode224 #gonuldagiepisode224englishsubtitles #gonuldagiepisode224withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516045/3516045_720p.mp4</video:content_loc>
      <video:duration>8883</video:duration>
      <video:publication_date>2026-10-05T05:38:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rush.Hour.1.1998</video:title>
      <video:description>بعد وقت قصير من وصول (هان) إلى أمريكا لتولي منصبه الدبلوماسي الجديد في لوس أنجلوس، تختطف ابنته (سو يونغ)، بينما كانت في طريقها إلى أول يوم لها في المدرسة. القنصل هان يدعو المفتش لي (جاكي شان) للمساعدة في هذه القضية. مكتب التحقيقات الفيدرالي يقرر إبعاد لي عن القضية وتوكل مهمة مراقبته لـ جيمس كارتر (كريس تاكر) الذي يقرر حل القضية بنفسه، عندما اكتشف بأنه قد أعطيت له مهمة وضيعة وبعد عدة مناوشات يتحد مع لي لإنقاذ الفتاة. #RushHour #RushHour1998 #RushHourmovie #JackieChan #ChrisTucker #JamesCarter #DetectiveLee #BrettRatner #actioncomedy #martialarts #buddycop #HongKongpolice #LosAngeles #JackieChanmovies #ChrisTuckermovies #RushHour2 #RushHour3 #أفلامجاكيشان #أفلامأكشن #أفلامكوميدية #أفلامشرطة #ساعةالذروة #فيلمRushHour #جاكيشان #كريستاكر</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516044/3516044_720p.mp4</video:content_loc>
      <video:duration>5868</video:duration>
      <video:publication_date>2026-10-05T05:38:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beaconhouse Main Campus (Jhang Sadar, Pun</video:title>
      <video:description>A beautiful day at Beaconhouse! 🌤️✨ Where learning meets nature.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516043/3516043_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T05:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tskills Dev</video:title>
      <video:description>💻 Learn to Add Watermark in MS Word! 💧 D…</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516042/3516042_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T05:37:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sakamoto days momment 2</video:title>
      <video:description>#anime #japan #china #korea #usa #uk #newzealand #canada #australia #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516041/3516041_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-10-05T05:37:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Timnas indonesia 5</video:title>
      <video:description>Timnas. Indonesia masukfinal #Timnasindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516040/3516040_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:36:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Honda Prime</video:title>
      <video:description>Agar Apke pas bhi hai 2nd Hand motorcycle to ubi Visit Karen Honda prime🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516039/3516039_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 293</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516038/3516038_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:36:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Memulai investasi</video:title>
      <video:description>Memulai investasi #Investasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516037/3516037_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-10-05T05:34:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>B News</video:title>
      <video:description>ایک چھوٹا سا ایس ایم ایس اپ کا پورا دن بچا سکتا ہے</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516036/3516036_720p.mp4</video:content_loc>
      <video:duration>373</video:duration>
      <video:publication_date>2026-10-05T05:34:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dek anggi cantik, mari berjoget bersama</video:title>
      <video:description>✨ Sekadar hiburan tentang kecantikan 🌸 Menikmati sisi indah, anggun, dan menarik dari setiap perempuan. 💕 Bukan untuk membandingkan, hanya untuk menikmati keindahan dan berbagi vibes positif. 🌷✨ #menariberjogethiburanvideokecantikan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516035/3516035_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:34:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 375</video:title>
      <video:description>Funny video #Funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516034/3516034_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T05:33:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>this is blurrr</video:title>
      <video:description>blurrrrrr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516033/3516033_720p.mp4</video:content_loc>
      <video:duration>263</video:duration>
      <video:publication_date>2026-10-05T05:33:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat funny 64</video:title>
      <video:description>Funny cat #Cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516032/3516032_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T05:33:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Por que seu gato mia?</video:title>
      <video:description>🐱 Por que seu gato mia? Você já parou para pensar no que seu gato quer dizer quando mia? Cada miado pode ter um significado diferente: fome, carinho, atenção, medo, desconforto ou simplesmente vontade de brincar. Observe o comportamento e o tom do miado para entender melhor o seu companheiro. Descubra os principais motivos pelos quais seu gato mia e aprenda a interpretar melhor essa forma especial de comunicação. ❤️🐾 #Gato</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516031/3516031_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T05:33:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat funny 63</video:title>
      <video:description>Funny video #Cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516030/3516030_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-10-05T05:32:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeo: Bebê de 1 ano escapa de creche e caminha até o trabalho da mãe</video:title>
      <video:description>Vídeo: Bebê de 1 ano escapa de creche e caminha até o trabalho da mãe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516029/3516029_720p.mp4</video:content_loc>
      <video:duration>389</video:duration>
      <video:publication_date>2026-10-05T05:32:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tusar halder</video:title>
      <video:description>New new design ideas for</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516028/3516028_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:32:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sambil nunggu orderan,joget dulu coyy</video:title>
      <video:description>All the driver online happy only for waiting order come in #driver #happy #dancing #singing #theculture</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516027/3516027_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T05:32:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coffee roasted</video:title>
      <video:description>Original roasted coffee beans, Ready to be ground, And marketted. #Coffee #roasted #original</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516026/3516026_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T05:31:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#CriminalStoryJapan#</video:title>
      <video:description>Ngeriiiiiyyyy #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516025/3516025_720p.mp4</video:content_loc>
      <video:duration>1542</video:duration>
      <video:publication_date>2026-10-05T05:30:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daha On Yedi - Episode 19 (English Subtitles)</video:title>
      <video:description>Raised in an orphanage, 17-year-old Aras embarks on a life-changing journey from Istanbul to Bodrum in search of his sister, confronting the secrets of his family and the truth about his past. This is, Daha On Yedi, Daha 17 (Just 17). #dahaonyediepisode19 #dahaonyediepisode19englishsubtitles #dahaonyediepisode19withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516024/3516024_720p.mp4</video:content_loc>
      <video:duration>8640</video:duration>
      <video:publication_date>2026-10-05T05:30:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>강아지 두마리</video:title>
      <video:description>강아지 두마리</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516023/3516023_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:29:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kadang Kita Lupa, Ada yang Berjuang Demi Kita ❤️</video:title>
      <video:description>Di balik setiap perjuangan, ada orang yang berharap kita bisa hidup lebih baik. Jangan sia-siakan pengorbanan mereka. ❤️ #Motivasi #keluarga #katabijak #renungan #inspirasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516022/3516022_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T05:29:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Priyanka Bidhuri</video:title>
      <video:description>I have completed 53 stars, just need 47</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516021/3516021_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:29:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Your Diet Lasts Only 5 Minutes! 🍕🤣</video:title>
      <video:description>When Your Diet Lasts Only 5 Minutes! 🍕🤣 I started the day with one simple goal: “Today, I’m going to eat healthy!” 🥗 Then I saw the food… and my diet immediately resigned. 😂😭 Watch till the end for the ultimate diet fail! 🤣 🔥 Follow for daily comedy, funny acts &amp; crazy moments! #ComedyFunnyVideoDietComedyDietFailFunnyReelsComedyReelsShortsYouTubeShortsInstagramReelsFacebookReelsViralComedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516020/3516020_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:29:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Switzerland Daily</video:title>
      <video:description>witzerland 🇨🇭🚁</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516019/3516019_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T05:29:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>88 holloween2</video:title>
      <video:description>Special edition</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516018/3516018_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:28:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It Gyan 2.0</video:title>
      <video:description>🔥Windows problems Try this Recovery Repair Toolkit!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516017/3516017_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T05:28:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Celva is showing off her new phone.</video:title>
      <video:description>Celva is showing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516016/3516016_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:28:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516015</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516015/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>87 holloween 1</video:title>
      <video:description>Special edition</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516015/3516015_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T05:28:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jika lupa membaca do&apos;a sebelum makan</video:title>
      <video:description>Jangan lupa berdoa sebelum makan #Doamakanygterlupa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516014/3516014_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T05:27:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Snowy Morning That Feels Like a Dream ❄️✨</video:title>
      <video:description>A peaceful winter morning covered in fresh snow. Sometimes, nature creates the most beautiful views. 🤍❄️ #SnowWinterWinterWonderlandSnowfallCozyVibesNaturePeacefulBeautifulViewDreamyAestheticWinterVibesRelaxingViralFYPForYoufebspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516013/3516013_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T05:27:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ollhas Seychelles</video:title>
      <video:description>Ilhas Seychelles 🌴🌊 As Ilhas Seychelles são um verdadeiro paraíso no Oceano Índico, famosas por suas praias de areia branca, águas cristalinas, grandes pedras de granito e natureza exuberante. O arquipélago encanta visitantes com paisagens tropicais, rica vida marinha e momentos de tranquilidade em meio à natureza. Um destino perfeito para quem busca praias paradisíacas, aventura, romance e uma experiência inesquecível. 🏝️✨ #Viajem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516012/3516012_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T05:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goingball</video:title>
      <video:description>Have a nice day 💣 #Us #febspot #viral #news #earn</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516011/3516011_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:25:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mlbb win</video:title>
      <video:description>mlbb win</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516010/3516010_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T05:25:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>House on stilts</video:title>
      <video:description>House on stilt house standing at the foot of the mountain #Travel #tourisme #nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516009/3516009_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T05:25:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hey hello</video:title>
      <video:description>🫣🫣🫣 #Heyhello</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516008/3516008_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:25:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Statue a person</video:title>
      <video:description>A beautiful statue of a person stands in a public place. It looks realistic and shows the details of the human figure #Statue #art</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516007/3516007_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:25:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🫣🫣🫣 3</video:title>
      <video:description>🫣🫣🫣 #🫣🫣🫣</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516006/3516006_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T05:25:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Permainan skuisi</video:title>
      <video:description>Main skuisi di pantai #ombak #pantai #sunset #indah #pasir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516005/3516005_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:24:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiiii 2</video:title>
      <video:description>🤭🤭🤭 #Hii</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516004/3516004_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:24:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clay Art #7</video:title>
      <video:description>This video shows the process of creating artwork from clay. The clay is carefully shaped and crafted into unique, detailed, and interesting forms and characters. #ClayArt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516003/3516003_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T05:23:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jiya rajpoot officialpage68</video:title>
      <video:description>Udit Narayan, Ranjana Joglekar · Piya, Piya O Piya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516002/3516002_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:23:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The moment Ronaldo defeated Bayern in 2017</video:title>
      <video:description>The moment Ronaldo defeated Bayern in 2017@.fullycrx7</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516001/3516001_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-10-05T05:23:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3516000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3516000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Areeba Hoor</video:title>
      <video:description>Airport feeling</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3516000/3516000_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:22:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This woman is listening to what Mr. Prabowo says.</video:title>
      <video:description>This woman is listening #woman #listening #mrpresiden</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515999/3515999_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T05:22:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Elysian Estate and Developers</video:title>
      <video:description>📲 0328 4222888 1 Kanal Brand-New Ultra Modern Fully Furnished Designer House | DHA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515998/3515998_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T05:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAAT HIDUP MENGALAMI KESULITAN  TERSESAT TIDAK TAU HARUS KEMANA,  TIDAK TAU HARUS BERBUAT APA   BACA</video:title>
      <video:description>SAAT HIDUP MENGALAMI KESULITAN TERSESAT TIDAK TAU HARUS KEMANA, TIDAK TAU HARUS BERBUAT APA BACA AYAT INI ALLAH AKAN MEMBERI JALAN KELUAR ALLAH AKAN TUNJUKKAN ARAH TUJUAN HIDUP. INSYAALLAH ​﷽ ​﴿ ٱلسَّلَامُ عَلَيْكُمْ وَرَحْمَةُ ٱللَّهِ وَبَرَكَٰتُهُ ﴾ إِنِّى وَجَّهْتُ وَجْهِىَ لِلَّذِى فَطَرَ ٱلسَّمَـٰوَٰتِ وَٱلْأَرْضَ حَنِيفًا ۖ وَمَآ أَنَا۠ مِنَ ٱلْمُشْرِكِينَ ٧٩ Aku hadapkan wajahku kepada (Allah) yang menciptakan langit dan bumi dengan penuh kepasrahan (mengikuti) agama yang benar, dan aku bukanlah termasuk orang-orang musyrik. #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #HijratulIslam #MoeslemofAmerica #QuranForEveryOne #MurrotalQuran #TafsirQuran #DoaHarian #KajianIslam #BelajarIslam #MuslimQuotes #MotivasiHijrah #IslamRahmatanLilAlamin #AlQuran #Sunnah #Istiqamah #NasihatIslami #CeramahPendek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515997/3515997_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T05:21:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cameron Walker</video:title>
      <video:description>The King has been welcomed with a Guard of Honour at Balmoral Castle ahead of his summer holiday. His Majesty met the Royal Regiment of Scotland’s She</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515996/3515996_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:21:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>he Most Satisfying Miniature Moped Build You Will Ever Watch!</video:title>
      <video:description>Watch this incredibly satisfying assembly of a 1/12 scale classic vintage moped. From unboxing the meticulously organized parts to the final polish, every step of building this miniature retro scooter is packed with relaxing visual details and precise craftsmanship. Experience the highly satisfying process as the miniature engine, suspension, wheels, and body panels come together to create a stunningly realistic mini motorbike that even features a working headlight. Perfect for model kit enthusiasts, craft lovers, and anyone who enjoys relaxing, meticulous ASMR builds. #miniaturebuilding #ASMR #satisfyingvideo #modelkit #vintagemoped #classicscooter #112scale #miniaturemotorbike #retromotorcyclebuild #relaxingassembly #diorama #hobbycraft #miniengine #precisecraftsmanship #satisfyingsounds #scalemodeling #miniatureart #vintagebike #ASMRbuilding #crafthobby</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515995/3515995_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:20:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILM HOROR TERBARU - BISIKAN IBLIS (2026) _ Full Movie</video:title>
      <video:description>FILM HOROR TERBARU - BISIKAN IBLIS (2026) _ Full Movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515994/3515994_720p.mp4</video:content_loc>
      <video:duration>5049</video:duration>
      <video:publication_date>2026-10-05T05:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>COMO SOBREVIVIR EN EL BOSQUE - THE FOREST</video:title>
      <video:description>COMO SOBREVIVIR EN EL BOSQUE - THE FOREST #theforest #terror #games #juegosdemiedo #gameplay #fernanfloo #youtubers #youtube #febspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515993/3515993_720p.mp4</video:content_loc>
      <video:duration>193</video:duration>
      <video:publication_date>2026-10-05T05:20:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A child learning to walk.</video:title>
      <video:description>A child learning to walk. #Achild #learning #to #walk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515992/3515992_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T05:19:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REZEKI MU AKAN TETAP MENGALIR  SAAT KAMU TIDUR DAN SAAT KAMU  BANGUN.   BACA AYAT INI MALAM DAN PAGI</video:title>
      <video:description>REZEKI MU AKAN TETAP MENGALIR SAAT KAMU TIDUR DAN SAAT KAMU BANGUN. BACA AYAT INI MALAM DAN PAGI ​﷽ ​﴿ ٱلسَّلَامُ عَلَيْكُمْ وَرَحْمَةُ ٱللَّهِ وَبَرَكَٰتُهُ ﴾ وَهُوَ ٱلَّذِى يَتَوَفَّىٰكُم بِٱلَّيْلِ وَيَعْلَمُ مَا جَرَحْتُم بِٱلنَّهَارِ ثُمَّ يَبْعَثُكُمْ فِيهِ لِيُقْضَىٰٓ أَجَلٌ مُّسَمًّى ۖ ثُمَّ إِلَيْهِ مَرْجِعُكُمْ ثُمَّ يُنَبِّئُكُم بِمَا كُنتُمْ تَعْمَلُونَ ٦٠ Dan Dialah yang menidurkan kamu pada malam hari dan Dia mengetahui apa yang kamu kerjakan pada siang hari. Kemudian Dia membangunkan kamu pada siang hari untuk disempurnakan umurmu yang telah ditetapkan. Kemudian kepada-Nya tempat kamu kembali, lalu Dia memberitahukan kepadamu apa yang telah kamu kerjakan. #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #HijratulIslam #MoeslemofAmerica #QuranForEveryOne #MurrotalQuran #TafsirQuran #DoaHarian #KajianIslam #BelajarIslam #MuslimQuotes #MotivasiHijrah #IslamRahmatanLilAlamin #AlQuran #Sunnah #Istiqamah #NasihatIslami #CeramahPendek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515991/3515991_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T05:19:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I just realized that church music can be this cool 🎵</video:title>
      <video:description>Church music concerts can be this cool 🎵 #ravejesusmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515990/3515990_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jj boring 🙏🏻:)</video:title>
      <video:description>Boring #Sleepboringnow</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515989/3515989_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:19:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beaconhouse School System Khyber Campus</video:title>
      <video:description>This was amazing when the energy was boosting all the time in each section</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515988/3515988_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:18:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dangdut 83</video:title>
      <video:description>dangdut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515987/3515987_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T05:18:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🪽 The Dark Angel has arrived. 💀 Death is only the beginning.</video:title>
      <video:description>🔥 ARGUS UNLEASHED! ⚔️ The Dark Angel is back on the battlefield! 😈 Watch Argus dominate the fight with insane damage, clutch moments, and an unstoppable ultimate. 💀🔥 ⚔️ Fearless fights 🔥 Massive damage 💀 Immortal moments 👑 Pure Argus domination Watch till the end and feel the power of the Dark Angel! 🪽🔥 #Gaming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515986/3515986_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T05:18:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anything Royal or Military</video:title>
      <video:description>The Prince of Wales and the Princess Royal will attend King Harald of Norways Funeral in Oslo next Wednesday</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515985/3515985_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:18:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>wleee</video:title>
      <video:description>kucinggg</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515984/3515984_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515983</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515983/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pulennn 2</video:title>
      <video:description>enakk nihhh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515983/3515983_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:17:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>86 tiktok template</video:title>
      <video:description>more templates to choose</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515982/3515982_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T05:17:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Idido</video:title>
      <video:description>Iriririri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515981/3515981_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:16:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Meghan Markle recently spoke out about her experiences</video:title>
      <video:description>When Meghan Markle recently spoke out about her experiences #MeghanMarkle #english</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515980/3515980_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-10-05T05:15:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Osodi</video:title>
      <video:description>Idoriro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515979/3515979_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:15:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why are Indonesians known for being laid-back?</video:title>
      <video:description>The perception of Indonesians as being &quot;laid-back&quot; stems from a fascinating blend of cultural philosophy, social structure, and climate. Rather than a lack of motivation, this demeanor is rooted in deep-seated values centered on harmony, community, and present-moment awareness. #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515978/3515978_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:15:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O que vai acontecer com Christa Pike? Mulher sobrevive a execução e gera debate sobre pena de morte</video:title>
      <video:description>O que vai acontecer com Christa Pike? Mulher sobrevive a execução e gera debate sobre pena de morte</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515977/3515977_720p.mp4</video:content_loc>
      <video:duration>477</video:duration>
      <video:publication_date>2026-10-05T05:15:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ultimate Furry Nanny: Cat Guards Sleeping Baby 🐱👶</video:title>
      <video:description>Watch this adorable moment as our protective feline refuses to leave the baby&apos;s side. From naptime monitoring to gentle supervision, this cat takes the role of &quot;big sibling&quot; very seriously. True love knows no bounds! #cat #baby #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515976/3515976_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T05:14:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>since the orchid</video:title>
      <video:description>orchid</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515975/3515975_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:14:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senja 25</video:title>
      <video:description>Senja aesthetic #Pantai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515974/3515974_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:13:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>unboxing paket anggrek Dendrobium dewasa dan knop mekar cantik</video:title>
      <video:description>anggrek unboxing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515973/3515973_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T05:13:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>85 it&apos;s me</video:title>
      <video:description>This is me.....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515972/3515972_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T05:11:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you girl&apos;s 💕😘</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515971/3515971_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:11:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GRAND MAX BALAP</video:title>
      <video:description>Joss jiss #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515970/3515970_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:11:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>moment ronaldo</video:title>
      <video:description>Cristiano Ronaldo is a famous professional football player from Portugal who is widely regarded as one of the greatest athletes of all time #football #HeightWeight #Body #Hehasanathletic #muscular #masculinebody</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515969/3515969_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Behind the beauty of the mountains lies a tragic story.</video:title>
      <video:description>Behind the beauty of the mountains lies a tragic story. #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515968/3515968_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T05:11:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515967</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515967/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>From Tiny Seed to Golden Corn 🌱🌽 | Amazing Corn Growth Time Lapse</video:title>
      <video:description>Watch a tiny corn seed transform into a tall, healthy corn plant and produce fresh corn! 🌱🌽 This satisfying time-lapse shows the incredible journey from seed to harvest. #corntimelapse #cornseedgrowth #growingcornfromseed #cornplantgrowth #corngrowing #seedtocorn #corngrowthtimelapse #growingvegetables #gardening #planttimelapse #naturetimelapse #cornharvest #satisfyingplantgrowth #agriculture #farmlife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515967/3515967_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:10:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you all 💘😘</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍😍😍😍😍😍😍😍😍🥰🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515966/3515966_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T05:10:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A cat is sleeping on the chair.</video:title>
      <video:description>On a hot afternoon, this cat is happily sleeping on the chair. Instead of being used for guests to sit on, the chair has been claimed by the cat for its afternoon nap.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515965/3515965_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T05:10:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Option 3: Viral Butterfly Face Filter Short 🦋 Mood Right Now!</video:title>
      <video:description>Is video me check karein bohot hi pyara aur trending butterfly face filter look! Agar aap ko ye short video achi lage toh video ko like karein, comment karke apna feedback dein aur channel ko zaroor follow karein taake mazeed aisi videos aap tak puhanch sakein. #​butterflyfilter #trendingfilterlook #cutefiltervideo #viralshort #febspotviral #funnyfiltershort #shortsvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515964/3515964_720p.mp4</video:content_loc>
      <video:duration>288</video:duration>
      <video:publication_date>2026-10-05T05:09:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The silence of the night does not mean silence forever.</video:title>
      <video:description>The silence of the night does not mean silence forever. #Sinematografi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515963/3515963_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T05:08:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Help subscribe to 1000 😁</video:title>
      <video:description>can help to 1000 subs 🤔😁😎 #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515962/3515962_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T05:08:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Husky puppies Falls in love kitten cat</video:title>
      <video:description>Falls in love #Husky #dog #viral #Rumble #Perfect #Febspot #kitten #kingl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515960/3515960_720p.mp4</video:content_loc>
      <video:duration>130</video:duration>
      <video:publication_date>2026-10-05T05:08:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryWithMegan#3</video:title>
      <video:description>Mantabbbb ❤️❤️ #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515959/3515959_720p.mp4</video:content_loc>
      <video:duration>1252</video:duration>
      <video:publication_date>2026-10-05T05:08:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nyoride</video:title>
      <video:description>Matahari terbenam, mesin dinyalakan. Terapi sederhana di penghujung hari. #RideR15v3</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515958/3515958_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T05:08:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EA SPORTS FC Mobile Gameplay on Android | Realistic Football Game ⚽🔥</video:title>
      <video:description>Watch exciting EA SPORTS FC Mobile gameplay on Android! ⚽🔥 In this video, I play a football match on mobile and showcase the gameplay, graphics, controls, and exciting goal-scoring moments. If you enjoy football games, FC Mobile, EA SPORTS FC Mobile, and Android gaming, this gameplay is for you! 👍 Like the video and follow for more mobile football gameplay. EA SPORTS FC Mobile, FC Mobile gameplay, EA FC Mobile, FC Mobile Android, football game Android, mobile football game, football gameplay, soccer game Android, Android gaming, mobile gaming, EA Sports football, FC Mobile match, FC Mobile gameplay Android, realistic football game, football games mobile #EASPORTSFCMobile #FCMobilegameplay #EAFCMobile #FCMobileAndroid #footballgameAndroid #mobilefootballgame #footballgameplay #soccergameAndroid #Androidgaming #mobilegaming #EASportsfootball #FCMobilematch #FCMobilegameplayAndroid #realisticfootballgame #footballgamesmobile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515957/3515957_720p.mp4</video:content_loc>
      <video:duration>481</video:duration>
      <video:publication_date>2026-10-05T05:08:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grimjow phantera mode game bleach</video:title>
      <video:description>#Game #gamebleach #grimjow #vidio #fyp #animebleach #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515956/3515956_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T05:07:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exam pass</video:title>
      <video:description>Exam pass #EducationPassboygairl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515955/3515955_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:07:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Refreshing Moment: Washing Hair in a Traditional Bamboo Bathroom</video:title>
      <video:description>A serene and natural scene capturing a woman gently washing her hair, lathering it with shampoo while water softly flows down her body. She stands in a charming open-air bathroom crafted from woven bamboo and wood, creating a warm, rustic atmosphere that feels close to nature. Dressed in a vibrant floral-patterned dress, she massages her scalp with both hands, surrounded by gentle streams of water and soft foam. Natural light filters through the space, enhancing the fresh, calm, and peaceful vibe of this simple yet beautiful daily routine. #Whasinghair #bathroom</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515954/3515954_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T05:07:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Easy to play</video:title>
      <video:description>😃😃😃</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515953/3515953_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T05:07:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cheng karate 🥋 kids 😁</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515952/3515952_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:07:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The beauty of Kora Beach, Maluku</video:title>
      <video:description>#TravelBaliJepangParis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515951/3515951_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:07:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>84 strictly for lovers only, romance!!!!!</video:title>
      <video:description>#TILLDEATH</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515950/3515950_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T05:07:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryWithMegan#2</video:title>
      <video:description>Shiip❤️❤️ #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515949/3515949_720p.mp4</video:content_loc>
      <video:duration>1697</video:duration>
      <video:publication_date>2026-10-05T05:07:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Earn money 27</video:title>
      <video:description>Have a nice day #Earn #follow</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515948/3515948_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T05:06:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI requires water to operate optimally.</video:title>
      <video:description>AI requires water to operate optimally. #AI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515947/3515947_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T05:06:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I miss you 🥺</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗😍😍😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515946/3515946_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:06:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 🤟🏻😘 bro 😘</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515945/3515945_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T05:05:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryWithMegan# 2</video:title>
      <video:description>Tops❤️❤️❤️ #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515944/3515944_720p.mp4</video:content_loc>
      <video:duration>1356</video:duration>
      <video:publication_date>2026-10-05T05:05:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Broken angel 💔</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515943/3515943_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T05:05:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesia Pride</video:title>
      <video:description>Beauty Landscape n Achievment Program in Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515942/3515942_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T05:04:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>$10 Food Comparison: Bangladesh vs Italy</video:title>
      <video:description>What can you buy with $10 in Bangladesh compared to Italy? From biryani, rice, fuchka and snacks to pizza, pasta, coffee and supermarket items—this video compares food prices and portions in both countries. Prices may vary depending on the city, restaurant and location. Which country offers more food for $10? Comment your opinion! #BangladeshvsItaly #10foodcomparison #foodpricescomparison #Bangladeshfoodprices #Italyfoodprices #cheapfoodinBangladesh #cheapfoodinItaly #biryani #fuchka #pizza #pasta #foodcomparisonvideo #travelcomparison #costofliving #streetfoodcomparison #internationalfoodprices #Bangladeshfood #Italianfood #budgetfoodchallenge #foodvlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515941/3515941_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T05:04:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>21966283482</video:title>
      <video:description>Kkkkkkk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515940/3515940_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T05:04:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Me dnesns</video:title>
      <video:description>Nddn</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515939/3515939_720p.mp4</video:content_loc>
      <video:duration>175</video:duration>
      <video:publication_date>2026-10-05T05:04:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A man with his pastimes</video:title>
      <video:description>A man with his pastimes #MLBB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515938/3515938_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T05:04:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crispy Caramel Fried Chicken with Cheese Sauce</video:title>
      <video:description>Crispy, golden-brown fried chicken coated in a sweet and savory caramel glaze, served with a rich, creamy cheese sauce. #Crispy #golden-brown #friedchicken #sweet #savory #caramel #glaze #rich #creamy #cheese #sauce</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515937/3515937_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T05:04:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>কপি  চা আড্ডা</video:title>
      <video:description>কপিচা আড্ডা</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515936/3515936_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T05:03:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alien Tries Earth Candy For The First Time!</video:title>
      <video:description>This cute little alien got lost on Earth and found the ultimate superpower: CANDY! Watch what happens when he experiences a sugar rush for the first time. 🚀 #alien #boy #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515935/3515935_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T05:03:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryWithMegan#</video:title>
      <video:description>❤️❤️❤️👍👍💯💯💯 #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515934/3515934_720p.mp4</video:content_loc>
      <video:duration>1375</video:duration>
      <video:publication_date>2026-10-05T05:03:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belum makeup aja udah cantik #marshajkt48 #jkt48</video:title>
      <video:description>Belum makeup aja udah cantik #marshajkt48 #jkt48</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515933/3515933_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T05:03:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Citambur Waterfall, South Cianjur</video:title>
      <video:description>Curug citambur cianjur selatan #Travel #tourism #indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515932/3515932_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T05:02:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Open mic oyet</video:title>
      <video:description>Onyet open mic aing datang make sandal, Balik make tawakal #Stanupcomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515931/3515931_720p.mp4</video:content_loc>
      <video:duration>115</video:duration>
      <video:publication_date>2026-10-05T05:02:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DongYi EP (8)</video:title>
      <video:description>سریال افسانه دونگی دوبله فارسی بدون سانسور قسمت هشتم #سریال</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515930/3515930_720p.mp4</video:content_loc>
      <video:duration>3781</video:duration>
      <video:publication_date>2026-10-05T05:01:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>crocodile grabs womans towel😰</video:title>
      <video:description>#foryou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515929/3515929_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T05:01:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Only you know my mind</video:title>
      <video:description>May God hold you so tightly that He heals what you don’t talk about with anyone, because there are pains that words can’t reach, wounds so deep that only God knows them in the silence of your heart, where not even your loved ones can go. He is there; you don’t need to explain anything to Him, He already knows it all and still loves you without limit. His embrace is not physical, but it wraps your soul in peace, comfort, and hope. Sometimes we think we have to look strong on the outside. #Motivation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515928/3515928_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T04:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WHOOSH HIGH SPEED TRAIN IN INDONESIA</video:title>
      <video:description>Modern Transportation in Indonesia #Travel #Train #City #Jakarta #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515927/3515927_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T04:58:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita da vovó Marta rocha Tradicional</video:title>
      <video:description>🍰 Bolo Marta Rocha Tradicional – Receitas da Vovó Uma receita clássica e irresistível! O tradicional Bolo Marta Rocha reúne camadas macias, creme, ovos, ameixas, merengue e crocantes em uma combinação deliciosa que conquista toda a família. ❤️ 👵 Receitas da Vovó: sabor, carinho e tradição em cada receita! 👉 Confira a receita completa no blog: marcelommq.blogspot.com #Bolo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515926/3515926_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:58:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Omur Usta - Episode 2 (English Subtitles)</video:title>
      <video:description>a story of family ties, betrayal, love, class conflict, and second chances, follows a woman who, despite the wounds life has left her with, finds the strength to hold on, reclaim her life, and rediscover the light within herself. This is, Omur Usta (Master Omur). #omurustaepisode2 #omurustaepisode2englishsubtitles #omurustaepisode2withenglishsubtitles</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515925/3515925_720p.mp4</video:content_loc>
      <video:duration>7812</video:duration>
      <video:publication_date>2026-10-05T04:58:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Takdir Terbaikmu Nanti.</video:title>
      <video:description>#shortislami #selfreminder #hikmahkehidupan #tawakal #albaqarah216</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515924/3515924_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-05T04:56:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DongYi EP (7)</video:title>
      <video:description>سریال افسانه دونگی دوبله فارسی بدون سانسور قسمت هفتم #سریال</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515923/3515923_720p.mp4</video:content_loc>
      <video:duration>3750</video:duration>
      <video:publication_date>2026-10-05T04:56:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>مسلمان سائنسدان کا بتائیں جنہوں نے پہلی بار اڑنے کا تجربہ کیا</video:title>
      <video:description>اس مسلمان سائنسدان کا بتائیں جنہوں نے پہلی بار اڑنے کا تجربہ کیا؟ #reelsviralシ #shorts #foryou #solangibhai786</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515922/3515922_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T04:56:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jejdj</video:title>
      <video:description>Jrkrrk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515921/3515921_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T04:56:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sedih 7</video:title>
      <video:description>Kalau nonton india pasti nangis, walaupun sudah ditonton berulang ulang kali #Nonton</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515920/3515920_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T04:56:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ieidk</video:title>
      <video:description>Ejjdjd</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515919/3515919_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T04:55:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>soft orange sponge cake</video:title>
      <video:description>This soft orange sponge cake features a wonderfully light, cotton-like texture that melts in your mouth. Infused with fresh orange juice and fragrant citrus zest, it delivers a delightful balance of sweet and tangy flavors. The aroma of fresh citrus fills the air as you slice into the golden crumb, making it a comforting and refreshing treat to enjoy with tea or coffee #soft #orange #sponge #cake #aroma #coffe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515918/3515918_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T04:55:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>In front of the airport</video:title>
      <video:description>In front of the airport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515917/3515917_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T04:55:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bahtera nabi nuh di temukan</video:title>
      <video:description>apakah benar ini kapal nabi nuh ? 🤔 coba di komen ges #kapalnabinuh #viral #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515916/3515916_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T04:54:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você viu Essa: Robôs humanoides auxiliam em tarefas domésticas nos EUA</video:title>
      <video:description>Você viu Essa: Robôs humanoides auxiliam em tarefas domésticas nos EUA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515915/3515915_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-05T04:54:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Calm Lake Water Reflection &amp; Lush Green Hills Aerial View</video:title>
      <video:description>Enjoy peaceful aerial views of calm lake waters reflecting the sunlight, surrounded by lush green mountains and a cozy lakeside dock. Perfect for relaxation and nature vibes! #SereneLake #LakeReflection #MountainView #DroneFootage #PeacefulNature #AerialView #LakesideDock #NatureRelaxation #ScenicLandscape #CalmWater #CinematicDrone #TravelInspiration #GreenHills</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515914/3515914_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T04:54:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JAKARTA LIGHT CITY</video:title>
      <video:description>Modern Metropolitan Jakarta Indonesia #Travel #City #Citylight #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515913/3515913_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T04:52:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bermain Mobil MBG</video:title>
      <video:description>Mainan fisik berupa truk atau mobil box pengantar MBG yang melaju dengan sistem friction (tarik-dorong/putar roda) tanpa baterai #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515912/3515912_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T04:52:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Village house with waterfull view</video:title>
      <video:description>nature, village house, tourism #Travel #indonesia #cianjur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515911/3515911_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:51:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT FOR THE END (Off-target)</video:title>
      <video:description>Off-target #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515910/3515910_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T04:51:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bom dia 33</video:title>
      <video:description>☀️ BOM DIA! 🌻 E se hoje fosse o dia de começar algo novo? ✨ Deixe para trás o que pesa no coração e abra espaço para coisas boas. Que seu dia seja cheio de paz, alegria, saúde e muitas bênçãos! 🙏❤️ 🌟 Gancho: Não deixe passar o dia sem acreditar que algo maravilhoso pode acontecer! Tenha um excelente dia! 🌷 #Bomdia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515909/3515909_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:50:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Secret Behind Giraffes&apos; Long Necks</video:title>
      <video:description>The Secret Behind Giraffes&apos; Long Necks Have you ever wondered why giraffes have such incredibly long necks? It is not just to look taller—their long necks help them reach leaves high up in trees that other animals cannot reach! Watch this video to learn about giraffe evolution, how they pump blood all the way up to their huge brains, and the amazing adaptations of nature. Don&apos;t forget to like and subscribe! #GiraffeWildlifeAnimalFactsNatureWildAnimalsEvolutionAnimalAnatomyWildlifeDocumentary</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515908/3515908_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T04:50:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DongYi EP (6)</video:title>
      <video:description>سریال افسانه دونگی دوبله فارسی بدون سانسور قسمت ششم #سریال</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515907/3515907_720p.mp4</video:content_loc>
      <video:duration>3739</video:duration>
      <video:publication_date>2026-10-05T04:49:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nilailah aku sesuka hatimu</video:title>
      <video:description>sad #sad #story #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515906/3515906_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:49:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video ini menjelaskan bahwa orang licik tampak ramah</video:title>
      <video:description>Tepat sekali — orang licik yang tampak ramah justru yang paling sulit dikenali, karena kebaikan mereka hanyalah topeng. 🔎 Ciri Khas: Ramah tapi Licik - 🤠 Sangat manis bicara, memuji berlebihan, seolah-olah paling peduli padahal tidak tulus - 🎯 Selalu ada tujuannya — ramah hanya saat butuh sesuatu; hilang/berubah setelah dapat keuntungan - 🧩 Pura-pura bersimpati, diam-diam mencari celah atau informasi untuk keuntungannya sendiri - ⚖️ Tampak memihak padamu, tapi di belakang bisa mengubah cerita agar dirinya yang aman - 🧵 Halus menyusun rencana, seolah kesalahan terjadi &quot;kebetulan&quot;, padahal dia yang mengatur - 🤝 Menawarkan bantuan dengan cepat, tapi nanti &quot;menagih jasa&quot; dengan beban yang tidak adil ⚡ Bedanya Ramah Tulus vs Licik Tabel Ramah Tulus Ramah tapi Licik Konsisten di depan &amp; belakang Berubah saat kamu tidak melihat Memberi tanpa mengharap imbalan Setiap kebaikan ada &quot;harganya&quot; Jujur walau menegur Memuji lalu menusuk dari belakang Menerima apa adanya Menyesuaikan diri sesuai kebutuhan 🛡️ Cara Melindungi Diri 1. Jangan terburu-buru percaya — lihat tindakan jangka panjang, bukan kata-kata manis yang sekejap 2. Jaga rahasia — jangan buka semua kehidupan pribadi pada orang yang baru dikenal atau terlalu manis tiba-tiba 3. Perhatikan motifnya — tanya dalam hati: &quot;Kenapa dia begitu baik padaku tiba-tiba?&quot; 4. Amati perlakuan ke orang lain — cara dia berbicara soal orang lain, begitulah dia berbicara soal kamu 5. Tetap sopan tapi jaga jarak — tidak perlu bermusuhan, cukup tidak terlalu dekat &amp; tidak mudah terikat janji manis 6. Jangan balas dengan cara sama — tetap jujur, itu perlindungan terbaik bagi dirimu sendiri #Orangliciktampakramah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515905/3515905_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:48:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#21 🚑 NOCAUTE EXTREMO EM SEGUNDOS! ELE SAIU DIRETO PRA MACA! _ EA Sports</video:title>
      <video:description>🎮 12.000 JOGOS EM UM MINI FLIPERAMA DE 10 POLEGADAS! LINK DOU PRODUTO: https://s.shopee.com.br/6VO5xg9JbB Essa luta acabou antes mesmo de começar! 😱 Um golpe certeiro e o adversário foi direto pro chão, sem chances de recuperação! Foi um dos nocautes mais rápidos que já vi! Será que você consegue superar esse tempo? ⏳🔥 📢 Deixa o like, comenta o que achou desse KO INSANO e se inscreve no canal para mais lutas épicas! 🎮👊 #MMA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515904/3515904_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-10-05T04:47:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#CriminalStoryWomenCrazy#</video:title>
      <video:description>Ngeribangett #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515903/3515903_720p.mp4</video:content_loc>
      <video:duration>780</video:duration>
      <video:publication_date>2026-10-05T04:47:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral.. Rocky Gerung</video:title>
      <video:description>Dulu katanya jika waktunya datang dia menolak mentah mentah, eh giliran beneran datang tidakada alasan untuk menolak #indonesiapolitikrockygerungprabowogibran</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515902/3515902_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T04:46:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aliens and humans are friends</video:title>
      <video:description>A very rare friendship between aliens and humans #alien #man #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515901/3515901_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:46:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Simple trigger mechanism slingshot</video:title>
      <video:description>Simple trigger mechanism slingshot, how to make slingshot, DIY bamboo slingshots #Slingshot #DIY #trigger #craft</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515900/3515900_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T04:45:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>asmr Bag make up mermaid</video:title>
      <video:description>Asmr bag make-up #Asmr #asmrrelaxing #asmrbag #relaxingsatisfying #relaxingsound #relaxingsatisfyingsound #ambiensound #asmr2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515899/3515899_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:45:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bigg Boss season 20 episode 28. Day 27.Salman Demands Honest Answers.720p</video:title>
      <video:description>Bigg Boss season 20 episode 28. Day 27.Salman Demands Honest Answers.720p.Salman Speak a Borong episode. Please subscribe kar lo mujhe to more videos. #Jiohotstar #Febspot.com ❤️Subscribe. #IndiaandAmerica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515898/3515898_720p.mp4</video:content_loc>
      <video:duration>2146</video:duration>
      <video:publication_date>2026-10-05T04:43:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Free sightseeing with no ticket required</video:title>
      <video:description>Free sightseeing with no ticket required cianjur selatan #Travel #wisata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515897/3515897_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T04:41:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tiger woman</video:title>
      <video:description>dance swimming #beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515896/3515896_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T04:40:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachueiras Mais Bonitas do Brasil</video:title>
      <video:description>As cachoeiras são verdadeiros espetáculos da natureza, cercadas por paisagens exuberantes, florestas, pedras e águas cristalinas. Elas são destinos perfeitos para quem busca tranquilidade, aventura e contato com a natureza. Além da beleza das quedas d’água, muitas cachoeiras oferecem piscinas naturais ideais para se refrescar e momentos incríveis para fotografar. Cada lugar possui características únicas, tornando a experiência especial para viajantes, famílias e amantes da natureza. #Viajem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515895/3515895_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:40:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing Cucumber Time Lapse</video:title>
      <video:description>Watch a tiny cucumber seed grow into a healthy green vine and produce fresh cucumbers! 🥒🌱 This satisfying time-lapse captures the amazing journey from seed to harvest. #cucumbertimelapse #cucumberseedgrowth #growingcucumberfromseed #cucumberplantgrowth #cucumbergrowing #seedtocucumber #plantgrowthtimelapse #vegetablegrowing #gardening #cucumberplant #growingvegetables #naturetimelapse #satisfyingplantgrowth #garden #harvest</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515894/3515894_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DongYi EP (5)</video:title>
      <video:description>سریال افسانه دونگی دوبله فارسی بدون سانسور قسمت پنجم #سریال</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515893/3515893_720p.mp4</video:content_loc>
      <video:duration>3821</video:duration>
      <video:publication_date>2026-10-05T04:39:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A chicken and a cat are friends</video:title>
      <video:description>The worlds of chickens and cats are different, yet they are always friends. #cat #chiken #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515892/3515892_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T04:39:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senja aesthetic</video:title>
      <video:description>Hanya video hiburan #senja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515891/3515891_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:39:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT FOR END 7</video:title>
      <video:description>It turns out he is a shapeshifting cat. #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515890/3515890_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T04:38:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main skuisi</video:title>
      <video:description>Main pasir di pantai sambil main skuisi #permainan #skuisi #anak #pantai #pasir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515889/3515889_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T04:38:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStoryfromUK#</video:title>
      <video:description>Ngeriiiahhhh #Chinde900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515888/3515888_720p.mp4</video:content_loc>
      <video:duration>1550</video:duration>
      <video:publication_date>2026-10-05T04:36:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>soft ball cake</video:title>
      <video:description>Soft ball cake is a delightful bite-sized snack with a round shape. It has a very soft, fluffy, and moist texture that feels light in the mouth. Made from basic ingredients like flour, sugar, eggs, and milk, this cake offers a gentle, sweet taste with a comforting buttery or vanilla aroma. It is usually baked or steamed, making it a perfect, melt-in-your-mouth treat to enjoy with a cup of tea or coffee. #soft #ball #cake #fluffy #texture #vanilla #aroma #enjoy #coffe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515887/3515887_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-05T04:36:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night marker</video:title>
      <video:description>Indonesia’s night market is full of lights, food, games, and fun. Many people come with their families to enjoy delicious street food, colorful rides, and a lively atmosphere. #Nightmarket #lively</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515886/3515886_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T04:36:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pulau naga</video:title>
      <video:description>Pulau naga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515885/3515885_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:35:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>De R$ 30 a R$ 30.000: turista pega táxi em São Paulo e motorista cobra três zeros a mais</video:title>
      <video:description>De R$ 30 a R$ 30.000: turista pega táxi em São Paulo e motorista cobra três zeros a mais</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515884/3515884_720p.mp4</video:content_loc>
      <video:duration>504</video:duration>
      <video:publication_date>2026-10-05T04:35:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautiful scenery 12</video:title>
      <video:description>#foryou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515883/3515883_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:35:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagi santaii</video:title>
      <video:description>Selamat pagi #uwuo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515882/3515882_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T04:34:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonésia</video:title>
      <video:description>Arquipélago da Indonésia 🌴🌊 A Indonésia é um dos destinos mais fascinantes do mundo, formado por milhares de ilhas com praias paradisíacas, florestas tropicais, vulcões, cultura rica e uma biodiversidade impressionante. Entre os lugares mais conhecidos estão Bali, Java, Sumatra, Lombok e as ilhas de Komodo. Um verdadeiro paraíso para quem ama natureza, aventura, praias e paisagens inesquecíveis. #Viajem</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515881/3515881_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T04:34:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy day 16</video:title>
      <video:description>Happy day #Mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515880/3515880_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T04:34:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bukan sekedar hobi</video:title>
      <video:description>Pelan pelan satu kunci dalam satu waktu #Hobiyangakansayakuasai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515879/3515879_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T04:34:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>win coy</video:title>
      <video:description>mlbb</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515878/3515878_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T04:33:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cute cat 64</video:title>
      <video:description>#cat #cute #viral #car #animal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515877/3515877_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T04:33:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Person Who Destroyed Your Confidence Did It on Purpose</video:title>
      <video:description>There is a specific kind of damage that does not look like damage from the outside. It does not leave visible marks. It arrives through comments disguised as jokes. Through comparisons delivered as concern. Through criticism wrapped in the language of help. And through a consistent patient systematic dismantling of your belief in yourself that happened so gradually you did not notice it was happening. Until one day you could not remember the last time you felt capable. Confident. Worthy of taking up space. In this video we expose the full psychology of covert confidence destruction. We cover exactly how confidence gets destroyed gradually through deniable incremental damage. Why you were chosen specifically — and why the qualities that made you a target are the same qualities that make you capable of genuine depth and care. The four specific tactics used in almost every case of covert confidence destruction. And what it actually takes to rebuild confidence that was deliberately dismantled rather than simply never developed. If you have ever wondered why your self doubt feels like it came from nowhere — this video is going to show you exactly where it came from. If you have ever felt like you used to be more confident and cannot explain what changed — this video is for you. If there is a voice in your head that sounds like yours but tears you down before you have even tried — this video is going to show you whose voice it actually is. Your confidence was not lost. It was taken. And this video is the beginning of taking it back. 🔔 Subscribe for weekly psychology that goes this deep into what makes us human. 💬 Drop a comment — what is the specific thing someone said or did that you now recognise was designed to make you doubt yourself? Just describe the moment. #Psychology</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515876/3515876_720p.mp4</video:content_loc>
      <video:duration>433</video:duration>
      <video:publication_date>2026-10-05T04:32:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Small Donation Could Change His Day</video:title>
      <video:description>He is all alone, trying to make a living by selling used items. If you would like to help or make a donation, you can send it through PayPal. Every donation, no matter how small, can make a difference. I will create content and show you the moment when I deliver the donations from all of you directly to him. Thank you for your kindness and support. ❤️ paypal.me/Tuminaalfian #donate</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515875/3515875_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:32:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cincu Hijau Daun Murni</video:title>
      <video:description>Jika temen-temen punya keluhan panas dalam, radang tenggorokan. Salah satu solusinya ya Ini Cincau Hijau Daun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515874/3515874_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T04:31:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌸 Grace &amp; Serenity — Whispers of the Heart 🪷</video:title>
      <video:description>Three gentle moments of peace and beauty. Holding fresh pink lotuses in the morning light, resting beside a bamboo flute, and sitting quietly in a blooming garden. Soft pastels, blooming flowers, and a peaceful smile — where nature meets timeless grace. 🌿💫 #SerenityLotusLoveGracefulBeautyNatureMagicPeacefulMomentsPastelDreamsGardenBloomDivineBeautyTimelessElegancePureHeart</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515873/3515873_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T04:30:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hospital 6</video:title>
      <video:description>Santai enjoy #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515872/3515872_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T04:30:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main gitar 7</video:title>
      <video:description>Melodilagu #uwuo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515871/3515871_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-10-05T04:29:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Living Room Transformation with a Stunning 3D Epoxy River Floor 😱</video:title>
      <video:description>Watch this incredible living room transformation! A simple room is completely upgraded with a stunning 3D epoxy floor featuring a realistic river illusion. The final result looks absolutely amazing and mesmerizing! 🤯🔥 #3Depoxyfloor #epoxyriverfloor #3Dfloordesign #livingroomrenovation #livingroommakeover #epoxyflooring #realistic3Dfloor #riverillusionfloor #modernlivingroom #luxuryinterior #homerenovation #interiordesign #floortransformation #amazingfloor #satisfyingtransformation #modernhome #stunningrenovation #viralrenovation #homemakeover #3Dinteriordesign</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515870/3515870_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T04:29:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita da vovó bolo Musse de chocolate</video:title>
      <video:description>🍫 Receitas da Vovó – Bolo Mousse de Chocolate Uma receita irresistível para quem ama chocolate! O Bolo Mousse de Chocolate combina uma massa fofinha com um recheio cremoso e uma cobertura deliciosa. Perfeito para aniversários, sobremesas especiais ou para aquele café da tarde em família. Aprenda o passo a passo e descubra outras receitas deliciosas no nosso blog Receitas da Vovó. 👉 Acesse: marcelommq.blogspot.com #Bolo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515869/3515869_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T04:29:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oscar for BEST drama</video:title>
      <video:description>Animal funniest #Animal #funniest #Oscar #TheBEST #viral #drama #Febspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515868/3515868_720p.mp4</video:content_loc>
      <video:duration>110</video:duration>
      <video:publication_date>2026-10-05T04:28:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>সকালে এই জিকির ১০০ বার পড়লে কী হয়</video:title>
      <video:description>সকালে এই জিকির ১০০ বার পড়লে কী হয় | Islamic Shorts #shorts #tranding সকালে ১০০ বার জিকির, লা ইলাহা ইল্লাল্লাহ ১০০ বার, লা ইলাহা ইল্লাল্লাহ ফজিলত, সকালে জিকিরের ফজিলত, ১০০ বার জিকিরের ফজিলত, ১০০ নেকির আমল, ১০০ গুনাহ মাফ, শয়তান থেকে হেফাজতের আমল, শয়তান থেকে বাঁচার আমল, তাওহিদের জিকির, কালিমার ফজিলত, গুরুত্বপূর্ণ জিকির, সকালের আমল, সকালবেলার আমল, প্রতিদিনের আমল, সহিহ হাদিসের আমল, হাদিসের ফজিলত, ইসলামিক আমল বাংলা, ইসলামিক জিকির বাংলা, ইসলামিক শর্টস বাংলা, বাংলা ইসলামিক ভিডিও, La ilaha illallah 100 times, La ilaha illallah benefits, morning dhikr, morning adhkar, Islamic reminder Bangla, Islamic Shorts Bangla, Hadith Bangla #সকালে১০০বারজিকির #লাইলাহাইল্লাল্লাহ১০০বার #লাইলাহাইল্লাল্লাহফজিলত #সকালেজিকিরেরফজিলত #১০০বারজিকিরেরফজিলত #১০০নেকিরআমল #১০০গুনাহমাফ #শয়তানথেকেহেফাজতেরআমল #শয়তানথেকেবাঁচারআমল #তাওহিদেরজিকির #কালিমারফজিলত #গুরুত্বপূর্ণজিকির #সকালেরআমল #সকালবেলারআমল #প্রতিদিনেরআমল #সহিহহাদিসেরআমল #হাদিসেরফজিলত #ইসলামিকআমলবাংলা #ইসলামিকজিকিরবাংলা #ইসলামিকশর্টসবাংলা #বাংলাইসলামিকভিডিও #Lailahaillallah100times #Lailahaillallahbenefits #morningdhikr #morningadhkar #IslamicreminderBangla #IslamicShortsBangla #HadithBangla</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515867/3515867_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T04:28:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodStory❤️#</video:title>
      <video:description>BagusCeritanya #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515865/3515865_720p.mp4</video:content_loc>
      <video:duration>823</video:duration>
      <video:publication_date>2026-10-05T04:27:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A train passes by</video:title>
      <video:description>The scene of a train passing along a road amidst heavy traffic on two intercity routes created a unique moment where these events coincided. #train</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515864/3515864_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T04:26:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crab Mentality</video:title>
      <video:description>The behavior of crabs pulling each other back or hindering one another when one tries to climb out of a bucket is known as &quot;Crab Mentality.&quot; #crab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515863/3515863_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T04:26:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>খেলনার দোকান</video:title>
      <video:description>খেলনার দোকান</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515862/3515862_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T04:26:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fresh fish sushi</video:title>
      <video:description>Fresh fish sushi is a traditional Japanese dish consisting of seasoned vinegared rice topped or rolled with high-quality, raw, or cooked fresh seafood #Fresh #fish #sushi #traditional #Japanese #dishconsisting #seasoned #vinegared #rice #toppedorrolled #high-quality #raw #cooked #seafood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515861/3515861_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T04:25:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#capcut #tiktok #douyin #ootd #affiliate #fbpro</video:title>
      <video:description>#Capcut #tiktok #douyin #ootd #affiliate #fbpro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515860/3515860_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T04:23:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wisata di gunung</video:title>
      <video:description>Berwisata di lereng gunung sambil makan nasi bakar #perjalanan #wisata #pegunungan #makan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515859/3515859_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:22:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carmen</video:title>
      <video:description>Carmenita so prety #Carmen #h2h #carmenita</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515858/3515858_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:22:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nasi kotak part2</video:title>
      <video:description>Chicken in Peanut Coconut SauceTender chicken pieces simmered in a rich, savory, and aromatic sauce made from blended peanuts, creamy coconut milk, and traditional Indonesian spices. #Makanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515857/3515857_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T04:22:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UNABOMBER 2026</video:title>
      <video:description>UNABOMBER 2026 #runner #trending #mustwatch #viral #fyp #viraltoday #2026movies #therage #THEUPRISING #TRUESTORY #TRUEEVENTS #UNABOMBER</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515856/3515856_720p.mp4</video:content_loc>
      <video:duration>6006</video:duration>
      <video:publication_date>2026-10-05T04:22:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fight doubts, banish negative thoughts, realize that fatigue is natural but giving up is a choice, a</video:title>
      <video:description>Fight doubts, banish negative thoughts, realize that fatigue is natural but giving up is a choice, and focus on being the best #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515855/3515855_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:21:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>olahraga gym</video:title>
      <video:description>membentuk badan dengan olahraga gym #gym</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515854/3515854_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T04:21:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita da vovó Charlotte</video:title>
      <video:description>🍰 Receitas da Vovó – Sabores que lembram momentos especiais Bem-vindo ao Receitas da Vovó, um cantinho especial para quem ama cozinhar e descobrir receitas deliciosas! Aqui você encontra receitas caseiras, bolos, doces, sobremesas, tortas, salgados, pães e muitas outras delícias que fazem parte da nossa cozinha. Nosso objetivo é trazer receitas práticas, saborosas e fáceis de preparar, inspiradas naquele gostinho especial da comida feita com carinho pela vovó. ❤️ Acompanhe nossas novidades, aprenda novas receitas e surpreenda sua família e seus amigos com pratos incríveis. 👉 Acesse o blog: marcelommq.blogspot.com #Bolo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515853/3515853_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:21:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skating lessons</video:title>
      <video:description>The video is about children having fun while enjoying the skating lesson #Skateforfun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515852/3515852_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T04:21:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing Tomato Time Lapse</video:title>
      <video:description>Watch a tiny tomato seed grow into a beautiful green plant and produce fresh, juicy tomatoes! #tomatotimelapse #tomatoseedgrowth #growingtomatoes #tomatoplantgrowth #tomatofromseed #seedtotomato #plantgrowthtimelapse #gardening #growingvegetables #tomatogrowing #naturetimelapse #satisfyingplantgrowth #garden #harvest #tomatoplant</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515851/3515851_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:20:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Candice cantip skil game bleach</video:title>
      <video:description>#Gamebleach #Candicecantip #fyp #game #vidio #view</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515850/3515850_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T04:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;JANGAN ABAIKAN! Lakukan Hal Ini Jika Kamu Gak Sengaja Nabrak Kucing Di Jalan...&quot;</video:title>
      <video:description>Mitos lokal percaya menabrak kucing bisa mendatangkan sial, kuncinya kamu harus segera menguburnya dengan layak, bahkan disarankan membungkusnya pakai baju yang kamu pakai. Kamu sendiri percaya gak sama mitos ini?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515849/3515849_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T04:18:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>enjoy it’s moment</video:title>
      <video:description>True happiness is being surrounded by good friends and sharing unforgettable moments together #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515848/3515848_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T04:17:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vendez vos entrées Facilement _ Stratégie Étudiante Gagnante</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #vendezentréesfacilementstratégieétudiantegagnante</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515847/3515847_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T04:16:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>83 art4of5</video:title>
      <video:description>Female art template</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515846/3515846_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T04:15:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uk Movie Film 🇱🇷🇺🇸</video:title>
      <video:description>BalliBotMogis #TrendingReels #FYP #ViralTikTok #MillionViews #TechMagic #SmartBot #AITrend #RobotViUK MOVIES 🇬🇧 #FypmoviefilmFilmerklärungUKMOVIES🇬🇧furyoufllowmeBalliBotMogisTrendingReelsFYPViralTikTokMillionViewsTechMagicSmartBotAITrendRobotVi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515845/3515845_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T04:15:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cute nuyy</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515844/3515844_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T04:15:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>82 art3of5</video:title>
      <video:description>Female art template</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515843/3515843_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:14:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Top USA Movie 🇱🇷🇺🇸</video:title>
      <video:description>BalliBotMogis #TrendingReels #FYP #ViralTikTok #MillionViews #TechMagic #SmartBot #AITrend #RobotVi #USA #Uk #BalliBotMogisTrendingReelsFYPViralTikTokMillionViewsTechMagicSmartBotAITrendRobotViUKMOVIES🇬🇧furyoufllowme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515842/3515842_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-10-05T04:14:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bohay 2</video:title>
      <video:description>dance bohay #foryouIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515841/3515841_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T04:14:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vente de Luxe _ 108k€ en 2 mois avec Vinted</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #venteluxe108k€2moisvinted</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515840/3515840_720p.mp4</video:content_loc>
      <video:duration>122</video:duration>
      <video:publication_date>2026-10-05T04:14:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mountain 10</video:title>
      <video:description>sarangan lake, magetan, east java #traveller</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515839/3515839_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T04:14:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>81 art2of5</video:title>
      <video:description>female art template</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515838/3515838_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T04:13:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌺 இன்றைய அம்மன் ல்லியமான ராசி பலன் இன்று</video:title>
      <video:description>🌺 இன்றைய அம்மன் அருள்வாக்கு &amp; துல்லியமான ராசி பலன் இன்று 05-10-2026 | திங்கட்கிழமை புரட்டாசி 19</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515837/3515837_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T04:12:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>80 ART1OF5</video:title>
      <video:description>female paint template</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515836/3515836_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:12:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UK MOVIES 🇬🇧 #furyou #fllowme</video:title>
      <video:description>UK MOVIES 🇬🇧 #UKMOVIES🇬🇧furyoufllowmeFypmoviefilmFilmerklärungBalliBotMogisTrendingReelsFYPViralTikTokMillionViewsTechMagicSmartBotAITrendRobotVi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515835/3515835_720p.mp4</video:content_loc>
      <video:duration>472</video:duration>
      <video:publication_date>2026-10-05T04:12:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prety birtd</video:title>
      <video:description>#Aividio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515834/3515834_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T04:12:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nice place in my life is a beach</video:title>
      <video:description>The beach is where I feel most at peace. The sound of the waves calms my mind, and the ocean brings a sense of tranquility to my soul. #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515833/3515833_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T04:11:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YouTube _ La Stratégie Gagnante pour des Résultats Durables</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #YouTubestratégiegagnanterésultatsdurables</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515832/3515832_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T04:10:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata mutiara 35</video:title>
      <video:description>Manusia bermuka dua = orang yang menampilkan dua sikap berbeda: manis/baik di depan, buruk/mencela di belakang . 📖 Arti - KBBI: tidak jujur, munafik, tidak konsisten - Satu wajah di depanmu, wajah lain di belakangmu; kata tidak sejalan dengan perbuatan 🔍 Ciri-ciri - Ramah &amp; memuji di depan, menyebarkan gosip/menjelekkan di belakang - Sikap berubah-ubah tergantung siapa yang dihadapi - Suka mengadu domba &amp; memanfaatkan orang lain - Janji mudah diucap tapi sering diingkari - Pura-pura netral padahal punya kepentingan pribadi ❓ Penyebab - Ingin diterima semua pihak / takut kehilangan keuntungan - Kurang percaya diri, menutupi diri aslinya - Cinta pujian &amp; kedudukan, ingin menang sendiri ⚠️ Dampak - Merusak kepercayaan, menimbulkan konflik &amp; perselisihan - Dalam ajaran agama termasuk sifat tercela (dzul wajhain) 🛡️ Cara Menghadapi - Tetap tenang, jangan ikut terlibat gosip - Batasi informasi pribadi, jaga jarak - Percaya pada tindakan, bukan sekadar kata-kata manis - Tetap jujur &amp; konsisten pada diri sendiri #Manusiabermukadua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515831/3515831_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T04:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chilli 2</video:title>
      <video:description>Agriculture of Chilli in somewhere of Sleman Yogyakarta #AgricultureChilli</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515830/3515830_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T04:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cute doll cake</video:title>
      <video:description>This is an adorable 3D teddy bear cake that looks just like a real plush toy. The cake is covered in rich chocolate buttercream, piped intricately with a grass tip to create a realistic, fluffy fur texture. It features cute round ears, dark glossy eyes made of fondant, and a small black nose. To add a festive touch, the bear is wearing a bright red fondant bowtie around its neck. It is almost too cute to eat and perfect for a child&apos;s birthday celebration. #cute #doll #cake #Character</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515829/3515829_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T04:09:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautifull kids watching tv</video:title>
      <video:description>beautifull kid girl watching tv,memories me,together with me in my life</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515828/3515828_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:09:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ataque com machado e heroísmo: o que se sabe sobre voo da Flydubai</video:title>
      <video:description>Ataque com machado e heroísmo: o que se sabe sobre voo da Flydubai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515827/3515827_720p.mp4</video:content_loc>
      <video:duration>467</video:duration>
      <video:publication_date>2026-10-05T04:08:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He intended to surprise his wife</video:title>
      <video:description>He intended to surprise his wife, but it backfired on him just look at his expression. #FunnyVideos #Comedy #Hilarious #Humor #MemesDaily #LaughOutLoud #JustForFun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515826/3515826_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T04:08:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagnez de l&apos;Argent Facilement_ Méthode Révolutionnaire!</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #gagnezlArgentfacilementméthoderévolutionnaire</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515825/3515825_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:08:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kraras river viqueque</video:title>
      <video:description>Kraras river viqueque #Kraras #viqueque #sand #river #timorleste</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515824/3515824_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T04:07:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagnez de l&apos;argent avec 0€ _ La méthode de mon ex</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #gagnezlargentméthodemonex</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515823/3515823_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T04:06:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing 🐱 2</video:title>
      <video:description>Kucing kabur #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515822/3515822_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T04:06:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagner de l&apos;argent facile _ Organiser des soirées étudiantes</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #gagnerlargentfacileorganisersoiréesétudiantes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515821/3515821_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T04:05:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kodok 2</video:title>
      <video:description>Kodok dan buaya #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515820/3515820_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:05:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fresh fruit cake</video:title>
      <video:description>English Fruit Cake is a kind of cake that is typical and famous from England. This cake is made of dough filled with various kinds of dried fruit, such as raisins, currants, cherries, apricots, and dried orange peels. This cake combines sweet and savory flavors with the delicacy of dry fruits, creating an indulgent and delightful experience. #fresh #fruit #cake #Topping #Garnish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515819/3515819_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T04:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hopes 3</video:title>
      <video:description>Your mind, mapping and all about yourself #mecca</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515818/3515818_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T04:04:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>paddy field art</video:title>
      <video:description>An unusual sight unfolded as a drone flew over the rice fields, revealing a form of line art resembling a labyrinthine painting. #greennature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515817/3515817_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T04:04:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata mutiara 34</video:title>
      <video:description>Video ini seseorang yang di manfaatkan oleh orang yang pernah Kita tolong #Musuhyangpalingmenyakitkanadalah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515816/3515816_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T04:03:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Al qur&apos;an surah Al Insyirah. Alam nashroh.</video:title>
      <video:description>Al qur&apos;an surah Al Insyirah. Alam nashroh. #Alquran #surahAlInsyirah #Alamnashroh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515815/3515815_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T04:03:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 7</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515814/3515814_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T04:02:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fish Farming 2</video:title>
      <video:description>Fish Farming Tilapia farming has become popular among local residents because it can boost the local economy. #FishFarmingTilapia #People #indonesia #world</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515813/3515813_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T04:02:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gagner 2000€_mois pendant tes études _ 9 méthodes prouvées !</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #gagner2000€pendantétudes9méthodesprouvées</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515812/3515812_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T04:01:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Videos 57 2</video:title>
      <video:description>Videos 57 #Videos57</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515811/3515811_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T04:01:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Discord pour Créateurs _ Boostez Votre Communauté et Ventes !</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #discordcréateursboostezvotrecommunautéventes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515810/3515810_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T04:00:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>THE UPRISING</video:title>
      <video:description>#runner #trending #mustwatch #viral #fyp #viraltoday #2026movies #therage #THEUPRISING #TRUESTORY #TRUEEVENTS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515809/3515809_720p.mp4</video:content_loc>
      <video:duration>7693</video:duration>
      <video:publication_date>2026-10-05T03:58:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing Chili Pepper Time Lapse</video:title>
      <video:description>Watch a tiny chili pepper seed transform into a healthy green plant and eventually produce fresh red chilies. #chilipeppertimelapse #chiliseedgrowth #chiliplant #growingchilifromseed #pepperplantgrowth #seedtoplant #planttimelapse #gardening #naturetimelapse #growingpeppers #chiligrowing #timelapseplant #satisfyinggrowth #gardeningvideo #natureshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515808/3515808_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devenez Créateur UGC et Gagnez 2000€_mois Facilement</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #devenezcréateurUGCgagnez2000€facilement</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515807/3515807_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T03:57:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesian atmosfer 🇮🇩</video:title>
      <video:description>Indonesian football atmosphere🔥 #indonesia #football #Indonesianfootballatmosphere</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515806/3515806_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T03:57:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beak cinematic</video:title>
      <video:description>beak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515805/3515805_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:57:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Is this the world we created?</video:title>
      <video:description>Queen&apos;s song - Is this the world we created sang by Kadri Muhammad, a singer from Jakarta, Indonesia #queen #songs #beatifulsong #kadrimuhammad #indonesia #jakarta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515804/3515804_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T03:57:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A very daring blind person</video:title>
      <video:description>A blind man recklessly rode a motorcycle on the road, showing absolutely no fear; however, his recklessness led to disaster when he crashed into a truck and fell. #Comedy #HumorFunnyvideos #Comedysketch #Funnyfails #ExpectationvsReality #Plottwist #Caughtoncamera</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515803/3515803_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:56:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Démarrez votre business _ Stratégie Client Facile</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #démarrezvotrebusinessstratégieclientfacile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515802/3515802_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:56:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 6</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515801/3515801_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T03:56:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Domingou……</video:title>
      <video:description>Boa noite galera!!!! #Trend #vibe #kwai #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515800/3515800_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T03:55:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Créez Votre Propre Montre Unique et Lucrative!</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #créezvotrepropremontreuniquelucrative</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515799/3515799_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-05T03:55:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>79 FEEL</video:title>
      <video:description>tiktok template just one click</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515798/3515798_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T03:53:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Fyp#movie#film#Filmerklärung</video:title>
      <video:description>#Fyp#movie#film#FilmerklärungUK #London #BritishCelebrities #RoyalFamily #PrinceHarry #MeghanMarkle don&apos;t miss My Video 💯🚀😔🫂 #FypmoviefilmFilmerklärungUKLondonBritishCelebritiesRoyalFamilyPrinceHarryMeghanMarkledontmissMyVideo💯🚀😔🫂</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515797/3515797_720p.mp4</video:content_loc>
      <video:duration>89</video:duration>
      <video:publication_date>2026-10-05T03:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bald Eagle filmed hunting - Amazing !</video:title>
      <video:description>Professional photographer courtesy #BaldEagle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515796/3515796_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T03:52:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515795</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515795/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freesia Fantasy: Magical Fairy Forest Exploration in Roblox</video:title>
      <video:description>​Welcome to Freesia Fantasy! Join us on a peaceful and magical journey through an enchanted forest filled with glowing mushrooms, beautiful waterfalls, and magical fairy vibes in Roblox. ​Sit back, relax, and enjoy the magical scenery with serene background music. Don&apos;t forget to like, comment, and subscribe for more aesthetic Roblox adventures! ✨🧚‍♀️🍄 #​FreesiaFantasy #RobloxFreesiaFantasy #RobloxAesthetic #RobloxFairyForest #MagicalRobloxWorld #RobloxCinematic #RelaxingRobloxGameplay #FairyTaleRoblox #RobloxShowcase #RobloxCozyVibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515795/3515795_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T03:52:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gin ichimaru game bleach</video:title>
      <video:description>#Game #ginichimaru #gamebleach #vidio #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515794/3515794_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T03:52:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As the new school year begins, and with determination and resilience</video:title>
      <video:description>As the new school year begins, and with determination and resilience, the children of Gaza continue their learning journey, towards the future. ❤️🔥 #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515793/3515793_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T03:52:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Família continua sem notícias de gaúcho desaparecido na Espanha há cinco meses</video:title>
      <video:description>Família continua sem notícias de gaúcho desaparecido na Espanha há cinco meses</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515792/3515792_720p.mp4</video:content_loc>
      <video:duration>600</video:duration>
      <video:publication_date>2026-10-05T03:52:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Créez des Vidéos Virales Facilement_ La Technique Secrète Révélée!</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #créezvidéosviralesfacilementtechniquesecrèterévélée</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515791/3515791_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T03:52:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A large demonstration is taking place in Piccadilly Circus, central London, in solidarity with Pales</video:title>
      <video:description>A large demonstration is taking place in Piccadilly Circus, central London, in solidarity with Palestine. #Palestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515790/3515790_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T03:51:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing 🐈 2</video:title>
      <video:description>Kucing oren #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515789/3515789_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T03:51:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cours Particuliers_ La Méthode SECRÈTE pour Gagner GROS</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #coursparticuliersméthodeSECRÈTEgagnerGROS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515788/3515788_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-10-05T03:50:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lady car dongky</video:title>
      <video:description>Lady car dongky is happy #Cardongky</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515787/3515787_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:50:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 5</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515786/3515786_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T03:50:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A large demonstration is taking place in Piccadilly Circus, central London, in solidarity with Pales</video:title>
      <video:description>A large demonstration is taking place in Piccadilly Circus, central London, in solidarity with Palestine. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515785/3515785_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T03:50:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>monyet menyalakan kipas angin</video:title>
      <video:description>lagi duduk santai diatas kursi sambil memutar kipas angin #fypforyouviralvideopendekmonyetfanspage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515784/3515784_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T03:49:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>77 FOR LOVERS ONLY</video:title>
      <video:description>lonely and painful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515783/3515783_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T03:49:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Augmente Tes Prix_ Vendre Tes Vidéos Facilement</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #augmentetesprixvendrevidéosfacilement</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515782/3515782_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T03:49:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515780</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515780/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pro-Palestinian activists gathered in solidarity outside the Green Party conference in Brighton, Eng</video:title>
      <video:description>Pro-Palestinian activists gathered in solidarity outside the Green Party conference in Brighton, England, ahead of tomorrow&apos;s vote on a motion declaring Zionism a form of racism, and urging the party to take a firm stand against Zionism. #Palestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515780/3515780_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T03:48:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>76 SEA BED</video:title>
      <video:description>tiktok template sooooo nice</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515779/3515779_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:48:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>eaaaa</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515778/3515778_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T03:47:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5 Millions d&apos;abonnés avec Lya_ La Stratégie Secrète</video:title>
      <video:description>#onlinegeldverdienen #nebenjob #onlineaufgaben #geldverdienenvonzuhause 💻 Serez-vous en ligne ? Puis allez à Clickworker et ! Dort kannst du verschiedene Aufgaben online erledigen – flexible, wann and wos es dir passt. 👉 Essayez Clickworker en détail et en détail ! https://clickworker.app/QqoURz #5millionsabonnésstratégiesecrète</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515777/3515777_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-10-05T03:47:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Cat Just Did Something HILARIOUS 😂🐱</video:title>
      <video:description>You won’t believe what this cat does next 😂 Watch until the end for the funniest moment! 🐱 #cat #funnycat #funnycats #cutecat #catvideo #hilariouscat #catsbeingfunny #funnyanimal #cuteanimals #adorablecat #viralcat #catreaction #catmoments #funnypet #pets #animalvideos #viralanimals #catlovers #cutepets #funnyvideos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515776/3515776_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T03:47:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>⭕️ A touching moment when released prisoner Issam Abu Ghalyoun hugged his children, his mother, and </video:title>
      <video:description>⭕️ A touching moment when released prisoner Issam Abu Ghalyoun hugged his children, his mother, and his family after being released, after a month of detention following his arrest while working at the border, along with four other released prisoners. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515775/3515775_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T03:47:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tebak kata</video:title>
      <video:description>video viral dan sangat menghibur #fypforyouviralvidiolucufanspage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515774/3515774_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T03:46:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sicantik imut</video:title>
      <video:description>Kecantikan yang sempurna</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515773/3515773_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:45:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pretty with no boy</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515772/3515772_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T03:45:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The holy Quran</video:title>
      <video:description>Al Qur&apos;an #Religi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515770/3515770_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T03:44:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Israeli occupation forces set fire to a vehicle and sprayed provocative slogans during an attack on </video:title>
      <video:description>⭕ Israeli occupation forces set fire to a vehicle and sprayed provocative slogans during an attack on a house in southern Hebron, occupied West Bank. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515769/3515769_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:44:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Preman susah pensiun</video:title>
      <video:description>Pertarungan di jalan tak terelakan #Video #vidioshort #Ai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515768/3515768_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:43:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>German police attack pro-Palestinian protesters at Alexanderplatz station, Berlin</video:title>
      <video:description>German police attacked pro-Palestinian protesters at Berlin&apos;s Alexanderplatz station during a rally in support of Gaza civilians and calling for an end to Israel&apos;s genocide. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515767/3515767_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T03:42:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the beauty of the scenery</video:title>
      <video:description>This is the truly delightful beauty of nature.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515766/3515766_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:42:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>edisi lbaran idul fitri</video:title>
      <video:description>#virall #fyp #indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515765/3515765_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T03:42:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 4</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515764/3515764_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T03:41:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orang ini gak dapat dapat</video:title>
      <video:description>Kenapa aku ga dapat dapat ikan #Memancing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515763/3515763_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T03:41:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cheetah hunting - Incredible</video:title>
      <video:description>How does someone manage to film this ? #Nature #cheetah #hunting</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515762/3515762_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T03:40:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tikus buta di kawal kodok</video:title>
      <video:description>Tapi tidak di saka ada sekor rumabah yang menyerang #cartun#vidio #Jepangrusia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515761/3515761_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T03:40:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>wild forest honey harvest</video:title>
      <video:description>wild forest honey harvest #wildforesthoneyharvest</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515760/3515760_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T03:39:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sesi latihan persiapan Final nanti tanggal 5 Oktober nanti👍👍 #FIFAASEANCAP #TIMNASINDONESAI #foryou</video:title>
      <video:description>sesi latihan persiapan Final nanti tanggal 5 Oktober nanti👍👍 #FIFAASEANCAP #TIMNASINDONESAI #foryou #timnas #timnasindonesia #fifaaseancup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515759/3515759_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-05T03:39:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Chinese supporter waves a Palestinian flag during a friendly football match between Palestine and </video:title>
      <video:description>A Chinese supporter waves a Palestinian flag during a friendly football match between Palestine and China in Chongqing, China. #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515758/3515758_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T03:39:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Police Chase Night Escape_ Guns, Drifts, and Broken Glass!</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515757/3515757_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-05T03:36:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 3</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515756/3515756_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-05T03:36:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sarah Connor&apos;s Parking Garage Ambush_ Intense Gunfight &amp; Mystery Metal!.</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515755/3515755_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T03:36:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Huis e huide ♥️ 64</video:title>
      <video:description>Meus bebês lindos Huis e huide ♥️ Uma estória de superação ♥️ #Calopsitas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515754/3515754_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-10-05T03:36:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hahah 3</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515753/3515753_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:35:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kidnapped_! Intense Car Fight &amp; Emotional</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515752/3515752_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T03:35:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Police Chase_ Man With Rifle &amp; Metallic Transformation!.</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515751/3515751_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T03:35:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tumbler stainless</video:title>
      <video:description>Botol air minum stainless motif tumbler sedotan 2 variasi free gantungan dengan bahan stainless steel SUS 304 yang tahan panas dan dingin, dilengkapi sedotan karet silikon lembut dan anti tumpah, bisa digunakan dua cara dengan sedotan atau tanpa sedotan, termasuk free gantungan dan free box, serta ringan dan mudah dibawa kemana saja. ✨ beli sekarang https://s.shopee.co.id/5VVesZtTyB?exp_info=tt_6ZM81JAA #Bisnis #afliate #Tumblerviral #buruanchekout</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515750/3515750_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:33:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Budaya jawa dan budaya nusantara</video:title>
      <video:description>Indah nya perbedaan budaya Indonesia #Budayatradisi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515749/3515749_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:33:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny momment 36</video:title>
      <video:description>#funny #australia #newzealand #uk #usa #canada</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515748/3515748_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:33:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>after ea</video:title>
      <video:description>#makan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515747/3515747_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:32:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aerial view of Biak Aerial view of Biak City City, Papua.y, Papua.Aerial view of Biak City, Papua. A</video:title>
      <video:description>An aerial view of Biak City, Papua, reveals a stunning coastal landscape that blends tropical natural beauty with the infrastructure of a strategic port city. Situated along Cendrawasih Bay, Biak City is characterized by white sandy beaches, clear waters ranging from deep blue to turquoise, and expansive coral reefs clearly visible from above. #Papuanaturalbeauty #HiddenparadiseinPapua #PristinebeachesofPapua #UntamedbeautyofPapua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515746/3515746_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T03:32:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A verdade sobre duas civilizações.</video:title>
      <video:description>Depois de muito misterio a verdade e revelada e a humanidade vai desfrutar da tecnologia de uma raça desenvolvida . #alienigena #raças #encontro #misterios</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515745/3515745_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T03:31:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesian Independence day 2</video:title>
      <video:description>Indonesian Independence day #IndonesianIndependenceday</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515744/3515744_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:30:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MasyaaAllah pinternyaaa😍</video:title>
      <video:description>Lahap banget makan pakai kuah santan dan telur yg sudah di potong potong😍 Pintar ya!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515743/3515743_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-05T03:29:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>She Stepped Onto the Stage… Then Everyone Went Silent! 😱</video:title>
      <video:description>A breathtaking moment on stage that caught everyone’s attention! She walked in calmly, prepared for her performance, and then delivered an unexpected move that left the audience stunned. The atmosphere was incredible! #StagePerformanceDance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515742/3515742_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T03:27:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lingkaran kecil cerita besar</video:title>
      <video:description>Gak butuh tempat mewah yang penting kumpul #Ditanyakapaninsafjawabnyanantiterus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515741/3515741_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:26:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesjus music 🎵</video:title>
      <video:description>Lagu jesjus music free song internasional 🎵 #jesjusmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515740/3515740_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T03:23:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Elegant Summer Dress Walk | Beautiful Outdoor Fashion &amp; Lifestyle</video:title>
      <video:description>#ElegantDress #Fashion #SummerDress #Outdoor #Lifestyle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515739/3515739_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T03:23:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Slowmotion cat</video:title>
      <video:description>Slowmotion cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515738/3515738_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-05T03:21:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mysterious Car Talk_ What&apos;s YOUR Story</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515737/3515737_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T03:20:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;Pare de se comparar_Você e única.&quot;</video:title>
      <video:description>💔 **VOCÊ ESTÁ SOFRENDO POR COMPARAR A SUA VIDA COM A DOS OUTROS?** Você vê alguém conquistando aquilo que você deseja e começa a pensar que está atrasada, que não é capaz ou que a sua vida nunca vai mudar? Pare um instante e pense nisso: **você está comparando a sua realidade com aquilo que consegue enxergar da vida de outra pessoa.** Você não conhece todas as lutas dela. E não pode permitir que as conquistas de alguém se transformem em motivo para desvalorizar a sua própria história. 📖 “Cada um examine os próprios atos.” — Gálatas 6:4 Hoje, tome uma decisão: pare de olhar tanto para o caminho dos outros e comece a cuidar do seu. Você ainda pode aprender, crescer, reconstruir e viver novos começos com Deus. 💬 Escreva nos comentários: **MINHA HISTÓRIA TEM VALOR!** 📲 Envie este vídeo para alguém que precisa ouvir essa mensagem hoje. 📌 Salve para lembrar: você não precisa ser igual a ninguém para reconhecer o seu valor. #PareDeSeComparar #VocêTemValor #RecomeçoComDeus #Autoestima #Superação #Fé #Reconstrução #MensagemDeDeus https://recomecar.valdamultimarcas.com #PareDeSeCompararVocêTemValorRecomeçoComDeusAutoestimaSuperaçãoFéReconstruçãoMensagemDeDeus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515736/3515736_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:19:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pretty boy 2</video:title>
      <video:description>Pretty boy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515735/3515735_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T03:19:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Sailed 10,707 KM from Florida to Egypt - Here&apos;s What It Looks Like on a Map</video:title>
      <video:description>How far is Egypt from the USA by boat? Much farther than you think! This animated map shows a sailboat traveling 10,707 kilometers (6,653 miles) from Florida, USA all the way to Egypt. The epic journey crosses: 📍 The Bahamas 📍 The Atlantic Ocean 📍 Morocco &amp; North Africa 📍 The Strait of Gibraltar 📍 The entire Mediterranean Sea 📍 Finally arriving in Egypt This is one of the longest transatlantic sailing routes in the world! #USAtoEgypt #DistanceFromUSAToEgypt #AtlanticCrossing #SailingRoute #Geography #MapAnimation #TravelFacts #Egypt #USA #FloridaToEgypt #StraitOfGibraltar #MediterraneanSea #Education</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515734/3515734_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T03:19:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Walking Dead_ Expansão do Universo e Séries Derivadas.</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515733/3515733_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T03:18:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animasi semangka</video:title>
      <video:description>#Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515732/3515732_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T03:18:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Walking Dead_ Retorno_ Venda de Canais e Renda em Dólar!</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515731/3515731_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T03:18:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Promised Myself This Life</video:title>
      <video:description>I Promised Myself This Life #music #song #IPromisedMyselfThisLife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515730/3515730_720p.mp4</video:content_loc>
      <video:duration>209</video:duration>
      <video:publication_date>2026-10-05T03:17:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TERNYATA KAKI SENDIRI</video:title>
      <video:description>expresi lucu anak kaget</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515729/3515729_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-05T03:17:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pose nuy</video:title>
      <video:description>#vlog</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515728/3515728_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T03:17:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Negan Mata Glenn_ A Cena Mais Chocante de TWD</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515727/3515727_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T03:17:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>asmr coconut cutting skills 2</video:title>
      <video:description>asmr coconut cutting skills #asmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515726/3515726_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T03:17:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pecel</video:title>
      <video:description>Ready setiap hari kamis dan minggu depan toko tunas muda snack #pasarciawitalipurwadadi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515725/3515725_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T03:17:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Walking Dead_ audiência recorde e queda brutal.</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515724/3515724_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T03:16:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tumhein Dil Se Kaise Juda Hum Karenge l Apu Rahman l तुम्हारे दिल से कैसे जुदा हम करेंगे l</video:title>
      <video:description>Romantic Hindi Song #tumhein dil se kaise juda hum Karenge #movie song doodh ka karz #cover song hindi #coversong #bollywood song #doodh ka karz song #romantic hindi song #sad song #love song #old movie song #viral #तुम्हारे दिल से कैसे जुदा हम करेंगे Song- Tumhein Dil Se Kaise Juda Hum Karenge Covered By Apu Rahman #Main Artist- Anuradha Paudwal &amp; Mohammad Aziz Lyrics- Anand Bakhsi Music- Anu Malik Movie- Doodh Ka Karz #tumheindilsekaisejudahumKarenge #moviesongdoodhkakarz #doodhkakarzsong #coversonghindi #coversong #bollywoodsong #romantichindisong #oldmoviesong #viral #तुम्हारेदिलसेकैसेजुदाहमकरेंगे #sadsong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515722/3515722_720p.mp4</video:content_loc>
      <video:duration>402</video:duration>
      <video:publication_date>2026-10-05T03:16:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dancer 49</video:title>
      <video:description>Beautyfull dancer #Dancercantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515721/3515721_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T03:14:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Peejuang seorang ayah</video:title>
      <video:description>Perjuangan seorang ayah tentang kehidupan, semoga sehat selalu. #Pekerjaan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515720/3515720_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T03:14:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Remebering 1976 - Year of The Cat</video:title>
      <video:description>Al Stewart - Great Music ! #AlStewart #YearoftheCat #1976</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515719/3515719_720p.mp4</video:content_loc>
      <video:duration>272</video:duration>
      <video:publication_date>2026-10-05T03:13:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>current situation in the Palestinian school settlement#freepalestine</video:title>
      <video:description>current situation in the Palestinian school settlement#freepalestine #Freepalestine</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515718/3515718_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T03:12:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful bonsai 2</video:title>
      <video:description>One of the sellers specializing in bonsai #plantstreesgreeni</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515717/3515717_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:12:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Metel slug level 2</video:title>
      <video:description>I am playing metalslug next level 2 #Metalslug #fyp #tranding #gamers #gaming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515716/3515716_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T03:12:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan Salah! 5 Trik Bikin Rapport yang Jarang Orang Tahu 🔥</video:title>
      <video:description>imana caranya bikin orang cepat nyaman, percaya, dan nyambung sama kita? 👀 Dalam video ini, kamu akan belajar 5 tips sederhana untuk membangun rapport dengan lebih cepat dan efektif. Cocok buat bisnis, networking, pertemanan, sampai membangun personal branding. Tonton sampai akhir—tips terakhir bisa mengubah cara kamu berinteraksi dengan orang lain! 🔥 #caramembangunrapport #tipsmembangunrapport #caramembuatorangnyaman #caramendapatkankepercayaan #caracepatakrabdenganorang #komunikasiefektif #tipskomunikasi #skillkomunikasi #interpersonalskills #networking #personalbranding #businessnetworking #caraberkomunikasi #rahasiakomunikasi #tipsbisnis #mindsetbisnis #socialskills #relationshipbuilding #buildrapport #howtobuildrapport #communicationskills #businesstips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515715/3515715_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-05T03:11:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monyetnya kok bisa punya cewek</video:title>
      <video:description>Si monyet naik motor merah bareng cewek baru, senyum-senyum pakai kacamata hitam, kayak anak motor paling kece! &gt; Eh di pinggir jalan, MANTANNYA nungguin! Lihat monyet lewat sama yang baru, langsung ngamuk-ngamuk 😡 Bukannya kemarin aku yang dipeluk di situ?!&quot; Terakhir, sendal melayang! 🤣🩴 Monyet satu ini emang buaya darat, eh buaya hutan! #monyetmonyetlucudramacintasegitaselingkuhviralngakakmonyetviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515714/3515714_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:11:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bagaimana menurut kalian? 2</video:title>
      <video:description>Udah cocok belum?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515713/3515713_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T03:11:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cry to my family broken</video:title>
      <video:description>#Quotes #sad #indonesia #family #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515712/3515712_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T03:09:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Miss You Still</video:title>
      <video:description>I Miss You Still #music #song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515711/3515711_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-10-05T03:08:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Virall 7</video:title>
      <video:description>Viral #Hiburan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515710/3515710_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T03:07:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Burung hama yang jadi favorit</video:title>
      <video:description>#1111</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515708/3515708_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T03:06:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 742</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE GARDEN PART 742 #HOST #AMERIKA #BEAUTIFUL #SEXY #GARDEN #PART742</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515707/3515707_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-05T03:05:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515706</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515706/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>littel stars one earth</video:title>
      <video:description>movie india #movieindia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515706/3515706_720p.mp4</video:content_loc>
      <video:duration>468</video:duration>
      <video:publication_date>2026-10-05T03:05:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imagens, foi filmado, por câmera 📷</video:title>
      <video:description>Mais umas, daquelas filmagens por câmeras. #sobrenaturalterror</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515705/3515705_720p.mp4</video:content_loc>
      <video:duration>356</video:duration>
      <video:publication_date>2026-10-05T03:04:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best skills 5</video:title>
      <video:description>Best skills #Olahraga #skilssepaturoda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515704/3515704_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T03:04:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 741</video:title>
      <video:description>HOST AMERIKA ERIKAT BEAUTIFUL SEXY ONNTHE BEACH MIMI PART 741 #HOST #AMERIKA #BEAUTIFUL #BEACH #MIAMI #PART741</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515703/3515703_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T03:02:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keep going...</video:title>
      <video:description>Keep going. Your story isn’t over yet. #Nevergiveup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515702/3515702_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T03:01:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Marcelo and Ronaldo s friendship 💞💞💪🏻💘</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖💖💖💖💖💖💖💖💖💖💖✨💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515701/3515701_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T03:00:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chloe Chua</video:title>
      <video:description>She plays Paganini&apos;s Violin Concerto nº 1 #Paganini #Concerto #ChloeChua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515700/3515700_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-10-05T02:59:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to earn money with febspot ? ❤️</video:title>
      <video:description>Have a nice day ❤️ #Travel #paris #france #dance #earn #money #refferal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515699/3515699_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T02:59:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kuningan Village Life - Peaceful Morning Walk in Kuningan, Indonesia</video:title>
      <video:description>Enjoy the peaceful Kuningan Village Life in West Java, Indonesia. A quiet morning walk through a village street with houses, green trees, and a beautiful mosque with a green dome. This is real daily life in Kuningan - calm, simple, and healing. Perfect for relaxing and slow living vibes. 📍Location: Kuningan, West Java, Indonesia. Follow for more Kuningan Village Life videos! #KuninganVillageLife #villagelifeKuningan #KuninganWestJava #morningwalkvillage #peacefulvillageIndonesia #KuninganKota #ruralIndonesia #slowliving #villagewalk #Indonesianvillage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515698/3515698_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T02:58:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you all 💘💘</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖✨💖✨🙏🏻💖💖✨💖💖✨💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515697/3515697_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T02:58:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>random vidio</video:title>
      <video:description>🦅 #Burung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515696/3515696_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T02:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing dan tikus 2</video:title>
      <video:description>Kucing gembul dan tikus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515695/3515695_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:58:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>सौंफ भोजन के बाद क्यों खाई जाती है?</video:title>
      <video:description>सौंफ भोजन के बाद क्यों खाई जाती है? #सौंफभोजनकेबादक्योंखाईजातीहै</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515694/3515694_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:58:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❤️Mini rescue story! 92</video:title>
      <video:description>Fun &amp; learning #Usa #China #france #Romania #britania #brazil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515693/3515693_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:57:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ichigo game bleach soul resonance</video:title>
      <video:description>#gamegamebleachvidiofyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515692/3515692_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T02:57:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Miss Who You Were, Not Who You Are</video:title>
      <video:description>I Miss Who You Were, Not Who You Are #music #song</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515691/3515691_720p.mp4</video:content_loc>
      <video:duration>214</video:duration>
      <video:publication_date>2026-10-05T02:57:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUGBANG DI DALAM KELPA</video:title>
      <video:description>Ada yang tau ga ini makanan apa.? #Mugbang #makan #besar #makanan #lezat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515690/3515690_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-05T02:57:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tensura</video:title>
      <video:description>peak🔥 #paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515689/3515689_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T02:56:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thr best</video:title>
      <video:description>#Racing #motorscyle #race #bike #motor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515688/3515688_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T02:56:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❤️Mini rescue story! 91</video:title>
      <video:description>Fun &amp; learning #Usa #China #Romania #Britania #Brazil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515687/3515687_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:56:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515686</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515686/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❤️Mini rescue story! 90</video:title>
      <video:description>Fun &amp; learning #Usa #china #Brazil #Britania #Canada #Romania</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515686/3515686_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:55:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yeshanagula the paradise video song 😍🥰</video:title>
      <video:description>King 👑 is Bling 👑💖👑 👑👑👑👑👑👑👑👑💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515685/3515685_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T02:55:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing ngantuk</video:title>
      <video:description>Kucing ngantuk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515684/3515684_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:54:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>portugal vs norway 2</video:title>
      <video:description>#football #portugal #norway #newzealand #usa #uk #canada #australia #japan #korea #china #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515683/3515683_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T02:53:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you all 💞💞</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑😍💗😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515682/3515682_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T02:53:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of duty 27</video:title>
      <video:description>Call of Duty: Black Ops 6 gameplay on PS5 in 4K at 60FPS. This high-security mission features stealth action, dangerous infiltration, and intense combat within a heavily guarded, restricted facility. Experience the realistic gameplay of Call of Duty: Black Ops 6 as agents enter a secure complex, bypass enemy defenses, and uncover critical information hidden deep within. The operation involves tense encounters, close-quarters combat, and high-stakes objectives in a tightly locked-down environment. If you enjoy Call of Duty gameplay, covert missions, and ultra-realistic 4K combat experiences, this video delivers a thrilling, action-packed military experience. 🎮 About the Game Call of Duty: Black Ops 6 is a first-person shooter developed by Treyarch and Raven Software and published by Activision. The game features a campaign focused on espionage, conspiracy, covert missions, and fast-paced combat set in the early 1990s. Call of Duty: Black Ops 6 Gameplay Call of Duty: Black Ops 6 PS5 Gameplay (4K 60FPS) Call of Duty: Black Ops 6 High-Security Mission Gameplay Call of Duty: Black Ops 6 Facility Infiltration Gameplay #callofduty #callofdutymw4 #newcallofduty #callofduty2026 #worstcallofduty #callofdutynext #callofdutyfacts #callofdutygames #callofdutywarzone #cpredscallofduty #callofdutydetails #callofdutysecrets #callofdutyshorts #callofdutygameplay #callofdutyvanguard #callofdutyminecraft #minecraftcallofduty #callofdutycontroller #callofdutyremastered #callofdutycampaign #callofdutymultiplayer #callofdutycoldwar #worstcallofdutygames #callofdutynext2026 #bestcallofdutygame #trending #shooter</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515681/3515681_720p.mp4</video:content_loc>
      <video:duration>2125</video:duration>
      <video:publication_date>2026-10-05T02:53:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby yamal fun at the work 😝😘</video:title>
      <video:description>King 👑 is Bling 👑💖👑 👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515680/3515680_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-05T02:53:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SIN CITY (2005) 2</video:title>
      <video:description>*Sin City* transports viewers to Basin City, a sinful metropolis where crime, corruption, and violence are part of everyday life. The narrative unfolds through several intersecting stories: Marv, a brutal man seeking vengeance for the death of the woman he loved; Hartigan, an aging cop fighting to protect a girl from a powerful predator; and Dwight, a man entangled in a world of *femme fatales* and bloody betrayal. Every corner of the city is fraught with dark moral choices—in a place built on sin and blood, is justice still attainable, or is it merely an illusion for those foolish enough to hope? #Unitedstates #crime #thriller #film #movie #movies #sincity2005 #sincity</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515679/3515679_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T02:52:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Classic TT</video:title>
      <video:description>#Motorcycle #bike #race #isleofman #indah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515678/3515678_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T02:52:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WOR DANCING IN JAPANESE GOA BINSARI | Relics of World War II on Biak Island, Papua</video:title>
      <video:description>In Biak culture, *Wor* is viewed from two perspectives: as a traditional ceremony and as a traditional song. As a ceremony, *Wor* holds symbolic significance in Bias life, embodying cultural values that govern their relationships with the Creator, with one another, and with their natural environment. Within Bias religious tradition, *Wor* is regarded as a sacred ceremony. This is reflected in the Biak philosophy &quot;*Nggo Wor Baindo Na Nggo Mar*,&quot; which means &quot;without the traditional ceremony or festival, we would die.&quot; Consequently, traditional ceremonies are of vital importance to the Bias people. One such ceremony is performed to safeguard an individual during the various transitions of social roles throughout their life. #BiaktribePapua #Papuantraditionaldance #PapuanbodypaintingPapuanindigenoustribes #savepapua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515677/3515677_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-10-05T02:52:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute baby 🥰 kindness with animals 💗</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑😍💗💗😍😍😍😍🥰🥰😍😍🥰🥰😍😍🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515676/3515676_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-05T02:51:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The story of CR7&apos;s development and his beautiful dribbling.🐐</video:title>
      <video:description>The story of CR7&apos;s development and his beautiful dribbling.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515675/3515675_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T02:49:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kalian pilih siapa nih ?</video:title>
      <video:description>Kalian pilih siapa nih ?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515674/3515674_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T02:49:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Power against snow</video:title>
      <video:description>Locomotives facing snow #Locopmotives #snow #power</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515673/3515673_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T02:48:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Baby Elephant Playing in the Rain | Adorable Elephant Splashing in Tropical Jungle</video:title>
      <video:description>Watch this adorable baby elephant playing joyfully in the rain! Set in a lush tropical jungle with a stunning waterfall, the little elephant splashes in the river, sprays water with its trunk, and shelters under a giant leaf as raindrops fall. #cutebabyelephant #elephantplayinginrain #babyelephantsplashingwater #cuteanimalsinjungle #tropicalwildlife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515672/3515672_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:48:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Isle of man</video:title>
      <video:description>#Motorcycle #race #bike #indah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515671/3515671_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T02:48:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuma modal Rp20 ribu bisa jadi Rp1,9 juta? Kok bisa? 🤯 Jangan skip, hitungannya bikin melongo!”</video:title>
      <video:description>Siapa sangka modal kecil bisa menghasilkan angka yang fantastis! 💰 Simak hitungannya sampai akhir dan cari tahu bagaimana peluang bisnis bisa dimulai dari modal sederhana.” #modal20ribu #modalkeciluntungbesar #bisnismodalkecil #usahamodal20ribu #caramenghasilkanuang #peluangbisnis #idebisnis #bisnispemula #usahamenguntungkan #tipsbisnis #bisnisdarinol #carajadisukses #cuandarimodalkecil #menghasilkanuangdarimodalkecil #strategibisnis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515670/3515670_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T02:48:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Show speed inside 💠</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515669/3515669_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T02:47:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Old lady Locomotive</video:title>
      <video:description>Old syle, but still working... #Locomotives #style</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515668/3515668_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T02:47:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515667</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515667/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Having coffee by the beach</video:title>
      <video:description>Having coffee by the beach #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515667/3515667_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T02:46:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soldier 🪖💪🏻 didn&apos;t expect him</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗💗😍💗💗😍💗</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515666/3515666_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T02:46:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MONTAIN AGUNG</video:title>
      <video:description>Pemandangan GUNING AGUNG yang sangat indah dan cantik menemani pagi ini #gunungagung #bali #alamai #natural #vibes #infoubud #infobali #budayabali #tradisiadatbali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515665/3515665_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T02:46:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>como a vida humilha um pobre 😂😂😂 3</video:title>
      <video:description>#mundo #brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515664/3515664_720p.mp4</video:content_loc>
      <video:duration>797</video:duration>
      <video:publication_date>2026-10-05T02:45:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stylish make you more charming 💓💓✨</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨🙏🏻👼🏻😊💕💕💕💕💕💕</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515663/3515663_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T02:45:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pencak silat Indonesia</video:title>
      <video:description>Pencak silat Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515662/3515662_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-05T02:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>prepare billiard</video:title>
      <video:description>#billliard</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515661/3515661_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T02:44:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lush Green Rural Paddy Field View</video:title>
      <video:description>A stunning aerial view capturing vast, lush green rice fields stretching across the peaceful countryside. Surrounded by dense trees and coconut palms, this natural landscape creates a refreshing, tranquil, and picturesque scenery. #ricefields #paddyfield #aerialview #lushgreen #countryside #rurallandscape #naturalbeauty #tropicallandscape #agriculture #scenicview #coconuttrees #naturebackground #peacefulvillage #greenfields #droneperspective</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515660/3515660_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T02:44:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>free fire gaming video 4</video:title>
      <video:description>Free fire gaming video #Gaming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515659/3515659_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T02:44:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby ❤️ king 👑</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖💖💖💖 💖💖💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515658/3515658_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-05T02:42:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bride 41</video:title>
      <video:description>The Bride</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515657/3515657_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T02:42:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ronaldo Neymar s little girl 💞</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑👑👑👑👑💖💖✨💖💖✨💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515656/3515656_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T02:41:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Just Noticed Something Strange Growing on This Tree! 😱🌿”</video:title>
      <video:description>Have you ever seen something like this growing on a tree? 🌿😳 At first glance, it looks completely normal… but the closer you look, the more interesting it gets! What do you think this is — a root, a vine, or something else? 🤔👇 Drop your answer in the comments! #NaturePlantsPlantLoversNatureLoversTreeVinesGardeningPlantFactsAmazingNatureNatureVideoInterestingDidYouKnowViralVideoReels</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515655/3515655_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-10-05T02:40:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gabut 7</video:title>
      <video:description>nunggu org lama jadi weh #bandung</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515654/3515654_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T02:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>netherland vs serbia</video:title>
      <video:description>#football #netherland #australia #usa #uk #canada #newzealand #japan #korea #china</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515653/3515653_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-10-05T02:39:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ballibotmogis</video:title>
      <video:description>movie cliping #movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515652/3515652_720p.mp4</video:content_loc>
      <video:duration>599</video:duration>
      <video:publication_date>2026-10-05T02:39:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lamine 💓💗</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗😍 💗💗😍💗💗💗💗😍💗😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515651/3515651_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T02:38:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alan Walker know</video:title>
      <video:description>Alan Walker know who&apos;s the GOAT #CristianoRonaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515650/3515650_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T02:38:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 😘🤟🏻 all</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖💖💖💖✨💖✨💖💖✨💖💖✨💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515649/3515649_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-05T02:37:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>anime.</video:title>
      <video:description>#amvanimeamv4kanimeedit4k</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515648/3515648_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-10-05T02:37:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My dream car BMW</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515647/3515647_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T02:36:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I love this city 😍</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515646/3515646_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T02:35:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gravel</video:title>
      <video:description>Gravel production site #Gravel #production #site #Hera #timorleste</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515645/3515645_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T02:35:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When 16 year old yamal shocked 😳</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515644/3515644_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T02:34:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just dance ❤️</video:title>
      <video:description>Hii, follow to foolback ❤️ thx Have a nice day ❤️ #Travel #paris #france #earning #meaning #withdraw</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515643/3515643_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T02:33:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My dream car 🚗</video:title>
      <video:description>King 👑 is Bling 👑💖👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515642/3515642_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T02:33:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Walking in New York City 🏙️</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨🙏🏻💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515641/3515641_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T02:32:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bread vendor in the village</video:title>
      <video:description>#Bread #vendor #village</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515640/3515640_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T02:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bocanilce 52</video:title>
      <video:description>Agora vai viu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515639/3515639_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-10-05T02:30:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mann Mera</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515638/3515638_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T02:30:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cebolinha</video:title>
      <video:description>Escutou td e babado</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515637/3515637_720p.mp4</video:content_loc>
      <video:duration>102</video:duration>
      <video:publication_date>2026-10-05T02:29:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral 211</video:title>
      <video:description>LAGU POP MELAYU PLAYLIST SLOW ROCK TERBAIK🔥MUTIARA IPANK🔥DI RANTAI DI GELANGI RINDU EXIST🔥 #Viral #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515636/3515636_720p.mp4</video:content_loc>
      <video:duration>3476</video:duration>
      <video:publication_date>2026-10-05T02:29:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dance , dance , dance</video:title>
      <video:description>Fantastic ! #StreetDance #musicclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515635/3515635_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T02:28:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>all great history🐐</video:title>
      <video:description>All of CR7&apos;s magnificent history and his insane dribbling skills.🐐@gtinxz #crazydrible #cr7🐐 #realmadrid #primecr7</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515634/3515634_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-05T02:26:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why African Mums Use Their Torchlight Like This! #shorts  #africanmothers</video:title>
      <video:description>The infamous African mum torchlight inspection remains the ultimate test of childhood stealth in 2026. Whether you are living in Lagos or Nairobi, that sudden beam of light hitting your room instantly triggers memories of every secret you tried to hide. Most people still get flashbacks whenever they see a flashlight in the dark. 🔦 Rate your mum&apos;s inspection skills from 1-10! 👇 #africanparents #africancomedy #naijacomedy #parenting #Africancomedy #Africandrama #Africanmemes #Africanmum #Africanparents #Africanshorts #Africanskits #Ghanacomedy #GrowingupinAfrica #Lagos #Nairobi #africamemes #africanhumor #comedy #comedyshorts #funny #funnyafrica #ghanaianskits #ifblueyhadafricanparents #naijacomedy #naijaskits #parenting #parentinghumor #parentingskits #raissaartista #shorts #viralskits</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515633/3515633_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:25:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivasi hidup 49</video:title>
      <video:description>Fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515632/3515632_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T02:24:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baru kali ini aku liat Erine pose nya pake jempol</video:title>
      <video:description>Baru kali ini aku liat Erine pose nya pake jempol #erinejkt48 #odc48 #jkt48</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515631/3515631_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T02:23:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515630</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515630/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video lucu 30</video:title>
      <video:description>video lucu tiktok #yuordudh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515630/3515630_720p.mp4</video:content_loc>
      <video:duration>158</video:duration>
      <video:publication_date>2026-10-05T02:22:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waktunya olah raga</video:title>
      <video:description>Waktunya olah raga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515629/3515629_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T02:22:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Family enjoy in park</video:title>
      <video:description>Family enjoy in park #park #enjoy #family</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515628/3515628_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T02:21:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pemandangan indah di pantai</video:title>
      <video:description>Saat aku melihat pemandangan yang sangat indah di suatu pantai #Pantai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515627/3515627_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T02:20:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUANDO A FÉ FOR SUA ÚNICA FORÇA 🙏 ORE ISSO E CONFIE EM DEUS</video:title>
      <video:description>Sua fé está fraca e os caminhos parecem incertos? 🙏 Faça esta oração, entregue seus medos a Deus e confie que Ele está à frente dos seus passos. ❤️ #oraçãodafé #oraçãoparafortalecerafé #oraçãoparaaumentarafé #oraçãoparaconfiaremDeus #oraçãopoderosa #oraçãoforte #oraçãocristã #oraçãodefé #oraçãoparamomentosdifíceis #oraçãoparaquemestádesanimado #oraçãopararenovaraesperança #Deusfortaleceminhafé #Deusestáàfrente #confiaremDeus #féemDeus #oraçãoparacomeçarasemana #oraçãodedomingo #oraçãoparavenceromedo #oraçãoparaabrircaminhos #JesusCristo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515626/3515626_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T02:19:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Can’t Stay Away? Meghan Markle’s New Video Triggers backlash Over &quot;Private Life&quot;</video:title>
      <video:description>Can’t Stay Away? Meghan Markle’s New Video Triggers backlash Over &quot;Private Life&quot; #royalfamily</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515625/3515625_720p.mp4</video:content_loc>
      <video:duration>118</video:duration>
      <video:publication_date>2026-10-05T02:18:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515624</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515624/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Konnersport vs Red Bull no Red Bull Ring Braking Point</video:title>
      <video:description>In Chapter 2 of Braking Point 3 in F1 25, Konnersport takes on Red Bull at the legendary Red Bull Ring in Austria. Callie Mayer and Aiden Jackson face moments of tension and rivalry in a race packed with drama and excitement. 🚀 🎮 PC Gameplay with: 🖥️ Intel i5-13400F 🎮 RTX 3060 12GB 💾 32GB RAM 🏎️ Logitech G29 #F125 #BrakingPoint #AustriaGP #RedBullRing #CallieMayer #AidenJackson #F125storymode #BrakingPointChapter2 #CorridanaÁustria #F125freeweekend #Formula1Game #GameplayPC #RTX3060 #LogitechG29 #SimRacing #volanteg29 #volante #Wheelg29 #wheel #Racing #simulador #arcade #W68TqL64</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515624/3515624_720p.mp4</video:content_loc>
      <video:duration>892</video:duration>
      <video:publication_date>2026-10-05T02:17:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Evanescence 5</video:title>
      <video:description>Evanescence</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515623/3515623_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-05T02:16:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR straight from my noggin 🤓</video:title>
      <video:description>#asmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515622/3515622_720p.mp4</video:content_loc>
      <video:duration>127</video:duration>
      <video:publication_date>2026-10-05T02:16:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video funny18198</video:title>
      <video:description>Video funny18198 #Cryfunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515621/3515621_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T02:16:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayub park enjoying</video:title>
      <video:description>Ayub park enjoying #Enjoy #park #sports</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515620/3515620_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T02:15:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mi semana</video:title>
      <video:description>Una semana de entreno #Gym #deportes #esfuerzo #pasion #sacrificio #motivacion #hierros</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515618/3515618_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T02:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SIN CITY (2005)</video:title>
      <video:description>Sin City membawa penonton ke Basin City, sebuah kota penuh dosa tempat kejahatan, korupsi, dan kekerasan menjadi bagian dari keseharian. Inti cerita terjalin melalui beberapa kisah yang saling bersinggungan: Marv, pria brutal yang mencari pembalasan atas kematian wanita yang dicintainya; Hartigan, polisi tua yang berjuang melindungi seorang gadis dari predator berkuasa; dan Dwight, pria yang terjebak dalam dunia femme fatale dan pengkhianatan berdarah. Setiap sudut kota ini dipenuhi pilihan moral yang kelam — di kota yang dibangun di atas dosa dan darah, apakah keadilan masih mungkin ditegakkan, atau hanya ilusi bagi mereka yang terlalu berani berharap? #Film #movie #sincity2005 #sincity #movies</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515617/3515617_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T02:12:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 88</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515616/3515616_720p.mp4</video:content_loc>
      <video:duration>333</video:duration>
      <video:publication_date>2026-10-05T02:10:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UnRefugioParaElAmor 2</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515615/3515615_720p.mp4</video:content_loc>
      <video:duration>628</video:duration>
      <video:publication_date>2026-10-05T02:10:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UnRefugioParaElAmor</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515614/3515614_720p.mp4</video:content_loc>
      <video:duration>260</video:duration>
      <video:publication_date>2026-10-05T02:09:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>movie scan</video:title>
      <video:description>the printing money movie #moviescan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515613/3515613_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-05T02:09:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Baby Triceratops in the Rain | Adorable Dino Shelter in Jurassic Jungle</video:title>
      <video:description>Meet the cutest baby Triceratops caught in a tropical rainstorm! This tiny dino explores a lush Jurassic jungle with waterfalls, splashes in muddy puddles, then finds shelter under a rock cave and a giant leaf as the rain falls. #cutebabydinosaur #babytriceratops #dinosaurintherain #cutedinovideo #jurassicjungleanimals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515612/3515612_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:09:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 50</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515611/3515611_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-10-05T02:09:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeo de Jesus orando 15</video:title>
      <video:description>História bíblica #SãoPaulo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515610/3515610_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-05T02:08:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 119</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515609/3515609_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-05T02:08:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hypernovae: The Universe’s Most Powerful Stellar Explosions</video:title>
      <video:description>Hypernovae are extraordinarily powerful stellar explosions associated with the deaths of some massive stars. These dramatic events can release immense amounts of energy and launch powerful jets of material into space. Scientists study hypernovae to understand stellar evolution, cosmic explosions, and how heavy elements are created and distributed throughout the universe. #HypernovaeSpaceFactsStellarExplosionAstronomyUniverseSpaceScienceCosmicEventsStarDeathDeepSpaceAmazingUniverse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515608/3515608_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:08:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 118</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515607/3515607_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T02:08:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 49</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515606/3515606_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T02:07:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This is called *martabak manis*—the most delicious food in the world. If you like this video, feel f</video:title>
      <video:description>This is called *martabak manis*—the most delicious food in the world. If you like this video, feel free to leave a comment!, thankyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515605/3515605_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T02:07:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of duty 26</video:title>
      <video:description>Battlefield Hardline gameplay on PS5 in 4K 60FPS. A dangerous prison escape unfolds inside Miami Federal Prison as the mission turns into a desperate fight for freedom. Experience ultra realistic Battlefield Hardline gameplay as the characters move through restricted areas, navigate prison corridors, and attempt to escape the heavily guarded facility. The mission features tense encounters, close-quarters action, dramatic escapes, and intense urban environments. If you enjoy Battlefield Hardline gameplay, prison escape missions, police action, and immersive 4K gameplay, this video delivers an intense experience. 🎮 About Game Battlefield Hardline is a 2015 first-person shooter developed by Visceral Games and published by Electronic Arts. The game focuses on police and criminal conflicts, featuring a single-player campaign, investigations, pursuits, and action across urban environments. Battlefield Hardline gameplay Battlefield Hardline PS5 gameplay 4K 60FPS Battlefield Hardline prison escape Battlefield Hardline Miami mission #callofduty #thecallofduty #callofdutymw4 #newcallofduty #callofduty2026 #worstcallofduty #callofdutynext #everycallofduty #callofdutynews #callofdutywarzone #callofdutymobile #callofdutyvanguard #callofdutyremastered #callofdutyminecraft #minecraftcallofduty #tdawgsmittycallofduty #callofdutymultiplayer #callofdutydocumentary #callofdutycoldwar #worstcallofdutygames #callofdutynext2026 #blackopscallofduty #callofdutywarzone3 #modernwarfarecallofduty #game #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515604/3515604_720p.mp4</video:content_loc>
      <video:duration>1443</video:duration>
      <video:publication_date>2026-10-05T02:07:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Moss Resembling The Edelweiss</video:title>
      <video:description>A Moss Resembling the Edelweiss. If we look even closer, this moss flower bears a striking resemblance to the Edelweiss flower. #edelweisshikersclimbers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515603/3515603_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-05T02:07:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SaborATi 21</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515602/3515602_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T02:07:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 87</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515601/3515601_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-05T02:06:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 86</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515600/3515600_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-05T02:06:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SaborATi 20</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515599/3515599_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T02:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 48</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515598/3515598_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T02:05:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan-jalan 8</video:title>
      <video:description>Sedang jalan menuju ke bendara #jakarta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515597/3515597_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:04:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌊 What If Humans Could Live Under the Ocean?</video:title>
      <video:description>Imagine waking up in a beautiful underwater home surrounded by colorful sea life… 🌊🐠🏡 Would you live here? #Amazing #underwaterhouse #underwaterworld #underwaterhome #oceanhouse #lifeunderthesea #underwatercity #oceanlife #deepsea #underwaterliving #fantasyworld #beautifulocean #marinelife #oceanadventure #underwaterarchitecture #AIvideo #AIgenerated #amazingplaces #hiddenworld #futuristichome #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515596/3515596_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:04:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 85</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515595/3515595_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T02:04:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 117</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515594/3515594_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T02:04:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 47</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515593/3515593_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T02:04:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan tanya keadaan aku bagaimana ?</video:title>
      <video:description>Jangan tanya keadaan aku bagaimana ? #trishajkt48 #trishaonly48</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515592/3515592_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T02:03:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 116</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515591/3515591_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-05T02:03:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SaborATi 19</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515590/3515590_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T02:03:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 84</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515589/3515589_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T02:02:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 115</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515588/3515588_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T02:02:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 83</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515587/3515587_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T02:02:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>video lucu 29</video:title>
      <video:description>lucu #cartonanimasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515586/3515586_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T02:01:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Valentina valiente 46</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515585/3515585_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-10-05T02:01:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 114</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515584/3515584_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T02:01:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 113</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515583/3515583_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T02:00:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just beautiful 2</video:title>
      <video:description>Just beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515582/3515582_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:00:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SaborATi 18</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515581/3515581_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T02:00:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>just beautiful</video:title>
      <video:description>Just beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515580/3515580_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T02:00:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 112</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515579/3515579_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-10-05T01:59:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ElRenacerDeLuna 111</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515578/3515578_720p.mp4</video:content_loc>
      <video:duration>129</video:duration>
      <video:publication_date>2026-10-05T01:59:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zetian</video:title>
      <video:description>Support me #Mobilelegends #virals #highlight #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515577/3515577_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-10-05T01:59:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515576</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515576/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rumah 5</video:title>
      <video:description>Pagi di rumah yang cerah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515576/3515576_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-05T01:59:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 82</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515575/3515575_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-05T01:58:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TierraDeAmorYCoraje 81</video:title>
      <video:description>Novelas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515574/3515574_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T01:58:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Cutest Cat Wink You&apos;ll See Today!</video:title>
      <video:description>Did this adorable chubby tabby just wink at you? Watch this cute kitty steal the show with its big round eyes and irresistible charm! #CatWinkCuteCatsTabbyCatFunnyCatsCatsOfTikTokReelsInstagramCutePetsCatShortsChubbyCatWholesomeContent</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515572/3515572_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T01:58:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stones bacan satisfaying</video:title>
      <video:description>Proses pembuatan batu cincin #stone #batuakik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515571/3515571_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:56:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIBAYE DIBAYO SONG OF THE MAMUNA TRIBE OF PAPUA</video:title>
      <video:description>one of the traditional songs from Papua, which tells about the nature of Papua #Savepapua #Song #Papuarainforest #Papuabiodiversity</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515570/3515570_720p.mp4</video:content_loc>
      <video:duration>320</video:duration>
      <video:publication_date>2026-10-05T01:53:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mogu Mogu Monkey - Janji Manis (Cover Closehead)</video:title>
      <video:description>Cover musik #musikindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515569/3515569_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-05T01:52:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>........ 11</video:title>
      <video:description>........</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515568/3515568_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T01:52:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cristiano Ronaldo 147</video:title>
      <video:description>Thank you capt #cristianoronaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515567/3515567_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T01:51:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time of the 2026 world cup season 2</video:title>
      <video:description>Back then, it was World Cup season. I was rooting for England, and their flag was flying in front of my house.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515566/3515566_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-10-05T01:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CCTV at the Kalikangkung toll gate on the outskirts of Semarang, Central Java, Indonesia.</video:title>
      <video:description>The moment cars and trucks pass through the toll gate.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515565/3515565_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T01:51:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best build from wooden</video:title>
      <video:description>Amazing building car #Car #build #model</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515564/3515564_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-05T01:50:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eternal peace</video:title>
      <video:description>Welcome to my chanel #musicsoundeffectinspiration</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515563/3515563_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-10-05T01:49:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful sunrise 5</video:title>
      <video:description>Best sunrise to see #Sunrise</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515562/3515562_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-05T01:48:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tubarão 3</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515561/3515561_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T01:47:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tubarões</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515560/3515560_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T01:45:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asana</video:title>
      <video:description>Cool pour une ambiance hot #Fun #danse #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515559/3515559_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T01:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desenho animado 58</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515558/3515558_720p.mp4</video:content_loc>
      <video:duration>387</video:duration>
      <video:publication_date>2026-10-05T01:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat Nabi Ayyub Kehilangan Segalanya, Inilah Doa yang Ia Panjatkan</video:title>
      <video:description>Kisah tentang ujian terberat nabi ayyub sepanjang hidupnya #Kisahislam #kisahnabi #nabiayyub #sejarahislam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515557/3515557_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-10-05T01:44:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ronaldo&apos;s prime goat era 😍</video:title>
      <video:description>Ronaldo&apos;s prime goat era 😍 #goatcristianoronaldo #primecr7</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515556/3515556_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T01:43:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Can This Industrial Shredder Destroy an Entire Motorcycle?</video:title>
      <video:description>An old motorcycle meets a massive industrial twin-shaft shredder. Watch the wheels, frame, engine, fuel tank, and exhaust get pulled downward and destroyed piece by piece. #IndustrialShredder #Motorcycle #HeavyMachinery #Recycling #Shredding #Satisfying</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515555/3515555_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T01:39:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 6</video:title>
      <video:description>Reencontro dos desconhecidos Parte 12 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515554/3515554_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-10-05T01:36:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keindahan di pedesaan alam sunda</video:title>
      <video:description>Keindahan pemandangan pedesaan Sunda yang begitu indah dengan alam yang asli nuansa ketenangan. #Pemandangan #pedesaan #keindahanalam #alamsunda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515553/3515553_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:36:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motifasi 16</video:title>
      <video:description>#Usa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515552/3515552_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-05T01:35:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time of the 2026 world cup season</video:title>
      <video:description>Back then, it was World Cup season. I was rooting for England, and their flag was flying in front of my house. #Wordcup #inggris #love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515551/3515551_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:34:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Evanescence 4</video:title>
      <video:description>Evanescence</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515550/3515550_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T01:34:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video terbaru silahkan nonton 2</video:title>
      <video:description>Video drama #Videodrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515549/3515549_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:33:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Evanescence 3</video:title>
      <video:description>Evanescence</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515548/3515548_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-05T01:33:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This 1 Minute Will Make You Forget All Your Problems</video:title>
      <video:description>&gt; Sometimes we don&apos;t need expensive healing... &gt; Just sit in front of a campfire, listen to the wood crackling, watch the sunset over the lake. For a moment, all your problems just disappear. 🍂 &gt; Are you in a phase where you need this kind of peace too? &gt; Don&apos;t skip it, feel the warmth till the end. 🔥 &gt; #healing #sunset #fyphealinghealingjourneysunsetsenjaapiungguncampfiredanaunatureaestheticcalmrelaxingasmrsuaraalamoverthinkingtenangviralmasukberandanatureloverssunsetview</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515547/3515547_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-05T01:32:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dark Energy: The Mystery Expanding the Universe</video:title>
      <video:description>Dark energy is one of the greatest mysteries in modern cosmology. Scientists believe it is responsible for the accelerating expansion of the universe. Although it cannot be directly seen, its effects appear across enormous cosmic distances. Understanding dark energy could reveal fundamental secrets about the universe and its ultimate fate. #DarkEnergyUniverseSpaceFactsCosmologyAstronomySpaceScienceDeepSpaceCosmicMysteryScienceFactsAmazingUniverse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515546/3515546_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:32:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO SÉ PROTEGER</video:title>
      <video:description>GATO MUITO ESPETO SÉ PROTEGE #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515545/3515545_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:32:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video terbaru silahkan nonton</video:title>
      <video:description>Video drama #Videodrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515544/3515544_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:31:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diretor geral da PF faz balanço sobre a segurança nas eleições</video:title>
      <video:description>Diretor geral da PF faz balanço sobre a segurança nas eleições</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515543/3515543_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-10-05T01:31:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You’ve NEVER seen a cat do this before! 😳🐱</video:title>
      <video:description>You’ve NEVER seen a cat do this before! 😳🐱 #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515542/3515542_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:31:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aktivitas keseharian 2</video:title>
      <video:description>Menjaga kestabilan masyarakat yang sedang jualan di pinggiran jalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515541/3515541_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T01:30:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 5</video:title>
      <video:description>Reencontro dos desconhecidos Parte 11 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515540/3515540_720p.mp4</video:content_loc>
      <video:duration>148</video:duration>
      <video:publication_date>2026-10-05T01:30:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beach atmosphere in Biak City, Papua</video:title>
      <video:description>the beautiful beach atmosphere makes the heart calm #Beachvibes #Vitaminsea #Endlessblue</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515539/3515539_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-05T01:29:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO SABE MEXER  NA MÁQUINA</video:title>
      <video:description>GATO SABE MUITO BEM MEXER NA MÁQUINA #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515538/3515538_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T01:28:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat ada uang teman mendekat</video:title>
      <video:description>Ketika ada uang teman mendekat, giliran tak ada uang teman menjauh #Ceritakehidupan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515537/3515537_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-10-05T01:28:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atún 2</video:title>
      <video:description>Atún</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515536/3515536_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T01:28:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milionário 2</video:title>
      <video:description>Aprenda #God</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515535/3515535_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-05T01:27:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aqui se faz aqui se paga</video:title>
      <video:description>Frutas falantes em uma lição de moral #moralmoralidademoraldevida</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515534/3515534_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-10-05T01:26:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATA VAI AS COMPRAS</video:title>
      <video:description>GATA FOI AS COMPRAS NO SHOPPING #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515533/3515533_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T01:25:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uv lagyvsl kags</video:title>
      <video:description>HsgsocyBv #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515532/3515532_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-05T01:23:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 4</video:title>
      <video:description>Reencontro dos desconhecidos Parte 10 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515531/3515531_720p.mp4</video:content_loc>
      <video:duration>191</video:duration>
      <video:publication_date>2026-10-05T01:21:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATINHO SABE COMO PEGAR O PEIXE</video:title>
      <video:description>GATINHO MUITO INTELIGENTE #GATO #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515530/3515530_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T01:20:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Names of modes of transportation</video:title>
      <video:description>Can you name these vehicles? From motorcycles to trucks and taxis. #Vehiclesforkids #kidslearning #Englishvocabulary #learnwithfun #Educationalvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515529/3515529_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T01:19:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>motivation 79</video:title>
      <video:description>beban #motivation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515528/3515528_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T01:17:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>15 mil por semana</video:title>
      <video:description>Um guarda florestal chamado laranjinha irá ganhar mesmo 15 mil por semana humor e comédia desenho animado #humorcomédia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515527/3515527_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-10-05T01:17:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VEJÁ O PRESENTE QUE O GATO GANHOU</video:title>
      <video:description>GATO NÃO GOSTOU DO PRESENTE GANHOU #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515526/3515526_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:17:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 16th</video:title>
      <video:description>Lovely act #Hit💯💥💢💪💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515525/3515525_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-10-05T01:16:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NATUREZA MARAVILHOSA</video:title>
      <video:description>NATUREZA QUE DEUS CRIOU PARA NOS ALEGRAR. #Brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515524/3515524_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T01:16:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 15th</video:title>
      <video:description>Lovely act #Hit💯💥💢💪💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515523/3515523_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-05T01:14:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO GULOSO</video:title>
      <video:description>GATO NÃO GOSTOU DA FES #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515522/3515522_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T01:14:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 14th</video:title>
      <video:description>Lovely act #😘😘</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515521/3515521_720p.mp4</video:content_loc>
      <video:duration>106</video:duration>
      <video:publication_date>2026-10-05T01:13:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Learn gardening</video:title>
      <video:description>Not escaping netizens&apos; comments even though he lives in the mountains #Farming</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515520/3515520_720p.mp4</video:content_loc>
      <video:duration>212</video:duration>
      <video:publication_date>2026-10-05T01:12:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 3</video:title>
      <video:description>Lovely act #Hit💯💥💢💪💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515519/3515519_720p.mp4</video:content_loc>
      <video:duration>128</video:duration>
      <video:publication_date>2026-10-05T01:12:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Martial Master Eps 686</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515518/3515518_720p.mp4</video:content_loc>
      <video:duration>476</video:duration>
      <video:publication_date>2026-10-05T01:12:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 2</video:title>
      <video:description>Lovely act #Hit💯💥💢💪💫</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515517/3515517_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-05T01:11:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO APRONTANO 2</video:title>
      <video:description>GATO SEMPRE APRONTANO #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515516/3515516_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T01:11:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Digimon Beatbreak Eps 43</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515515/3515515_720p.mp4</video:content_loc>
      <video:duration>1413</video:duration>
      <video:publication_date>2026-10-05T01:11:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smart dog 13</video:title>
      <video:description>This dog is smart taking making him self a food and enjoy with his hightech services #Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515514/3515514_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T01:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Good day to Ascend Eps 7</video:title>
      <video:description>Join Now https://pastelink.net/r8w76rit Don&apos;t Forget Follow Like Comment Share THANK YOU FOR WATCHING</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515513/3515513_720p.mp4</video:content_loc>
      <video:duration>1198</video:duration>
      <video:publication_date>2026-10-05T01:10:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bosan😒</video:title>
      <video:description>Butuh penyemangat🙂 #Singapore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515512/3515512_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T01:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GATO QUEBROU A TELEVISÃO</video:title>
      <video:description>GATO FICOU NERVOSO QUEBROU A TELEVISÃO #UNITEDSTATES</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515511/3515511_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T01:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Smiliing little baby with nice fish when his taking sunbathing #Travail</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515510/3515510_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T01:08:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cristiano Ronaldo&apos;s cool bicycle kick 😍</video:title>
      <video:description>Cristiano Ronaldo&apos;s amazing overhead kick left Buffon stunned and rooted to the spot. #CristianoRonaldo #realmadrid</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515509/3515509_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T01:07:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 3</video:title>
      <video:description>Reencontro dos desconhecidos Parte 9 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515508/3515508_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-10-05T01:06:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Proses Pemasangan Atap Bambu</video:title>
      <video:description>Akhirnya atap sirap proyek Ubud selesai juga! 3 bulan kerja dari maket kecil ini. Gimana menurut kalian? Rate 1-10 dong di komen 🌿🙏 #atapbambu #villabambu #disain #Kontruksi #bambubar #tukangbambu #kreatip #seni #orangbali #taksubali</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515507/3515507_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T01:05:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mostafa Elsaadi - I Am the Storm (Legendado)</video:title>
      <video:description>“I Am the Storm”, de Mostafa Elsaadi, é uma música sobre transformar dor, pressão e momentos difíceis em força. A letra acompanha uma jornada de alguém que passou muito tempo tentando fugir da escuridão, carregando o peso dos próprios problemas, até perceber que aquilo que parecia destruí-lo também estava despertando uma força que sempre esteve dentro dele. A tempestade deixa de ser algo a temer e passa a representar a própria transformação. Cada queda, cada cicatriz e cada momento difícil se tornam parte do caminho para recuperar a confiança e seguir em frente. ⚡ Você não precisa fugir da tempestade. Às vezes, precisa descobrir que você também é a tempestade. 🎵 Mostafa Elsaadi - I Am the Storm 🎬 Legendado em português Se essa música falou com você, deixe seu comentário, curta o vídeo e compartilhe com alguém que também está atravessando uma fase de transformação.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515506/3515506_720p.mp4</video:content_loc>
      <video:duration>317</video:duration>
      <video:publication_date>2026-10-05T01:04:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POWER OF KONJI 2</video:title>
      <video:description>Konji is the only thing that can humble any man in the side of a woman no matter how strong the man is“ konji go humble am. For example just watch this guy begin a woman for sex because of konji! This is crazy and funny nehm!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515505/3515505_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-05T01:03:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nouveau série : Tom et Jerry of pyramide Egypte part 1</video:title>
      <video:description>Tom et Jerry of pyramide Egypte</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515504/3515504_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-05T01:02:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amor eterno</video:title>
      <video:description>Amor eterno realidade ou fantasia #amoreternoamoramar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515503/3515503_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-10-05T01:00:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uma lição de vida</video:title>
      <video:description>Exemplo de lição de vida em forma de animação #liçãodevidasigaestadica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515502/3515502_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-05T00:55:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atún</video:title>
      <video:description>Atún</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515501/3515501_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-05T00:54:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NINJA R STOPIE</video:title>
      <video:description>Motorbike stopie #Motorcycle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515500/3515500_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-05T00:52:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuide de sua beleza seja sempre linda</video:title>
      <video:description>Dicas úteis de como cuidar de sua beleza sem agredir a pele #belezasemprelindavisual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515499/3515499_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-05T00:50:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khanpur dam and rainy weather</video:title>
      <video:description>Khanpur dam and rainy weather #Khanpurdam #rain #boats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515498/3515498_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T00:50:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata hari ini 195</video:title>
      <video:description>Kata kata bijak menginspirasi #katabijakmotivasiqoutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515497/3515497_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T00:49:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Empty road car drive</video:title>
      <video:description>Empty road car drive #Car #drive #emptyroad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515496/3515496_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T00:49:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Travling Quetta</video:title>
      <video:description>Travling Quetta #Buses #TravlingQuetta #beautiful</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515495/3515495_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-05T00:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥🔥🔥💪</video:title>
      <video:description>New single track</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515494/3515494_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T00:46:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Race Tamiya 2026</video:title>
      <video:description>Race tamiya 2026 best time for racing #Tamiya #tamiya2026 #fyp #trending #fyp2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515493/3515493_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-05T00:46:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>No trabalho sempre</video:title>
      <video:description>#Brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515492/3515492_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T00:46:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seriusly Movie</video:title>
      <video:description>#Movie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515491/3515491_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-10-05T00:45:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas das frutas 2</video:title>
      <video:description>Reencontro dos desconhecidos Parte 8 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515490/3515490_720p.mp4</video:content_loc>
      <video:duration>138</video:duration>
      <video:publication_date>2026-10-05T00:45:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Two highway bikes</video:title>
      <video:description>Two highway bikes #Motorcycle #bike #together</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515489/3515489_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T00:43:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O inferno existe não vai para lá</video:title>
      <video:description>Busque a Deus não vai para inferno Livre se dos pecados,seja santo Porque sem Santidade ninguém verá a Deus #Cristão #evangelho #gospel #igreja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515488/3515488_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-05T00:42:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lion Farts, Monkey Falls From the Tree! 🦁🐒💨</video:title>
      <video:description>This video is an AI cinematic simulation created purely for entertainment. A lion is relaxing under a tree beside the river when suddenly it lets out a funny fart. At the same moment, a monkey sitting in the tree loses its balance and falls down, creating an unexpected comedy moment! All characters, scenes, and events are digitally generated. No real animals were involved or harmed. #FunnyLion #FunnyMonkey #LionFart #MonkeyFalls #AnimalComedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515487/3515487_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T00:42:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fire 🔥🔥🔥🚒</video:title>
      <video:description>The guy so good</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515481/3515481_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-05T00:40:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Travling Islamabad beautiful view</video:title>
      <video:description>Travling Islamabad beautiful view #Islambad #beauty #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515476/3515476_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-05T00:38:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afternoon ride on a 2 stroke ninja motor bike</video:title>
      <video:description>Afternoon ride on a 2 stroke ninja motor bike #Ninjarr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515473/3515473_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-05T00:37:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good morning ❤️ 2</video:title>
      <video:description>Have a nice day ❤️ #Travel #paris #fyp #new</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515471/3515471_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:37:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Set a strategy for XAU/USD.</video:title>
      <video:description>Set a strategy for XAU/USD now</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515468/3515468_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-05T00:36:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The shaking is steady</video:title>
      <video:description>#Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515466/3515466_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T00:36:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TVアニ</video:title>
      <video:description>Tonight, V stepped into the crowd, taking in live performances at Vogue World: Hollywood. Known for his own standout fashion moments, he kept it effortlessly stylish in a look worthy of the runway. #anime #AMV #video #ai #trending #animation #edit #viral #new</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515465/3515465_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T00:34:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Car drive in tunnel</video:title>
      <video:description>Car drive in tunnel #Tunnel #car #drive</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515461/3515461_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T00:32:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My shop and business</video:title>
      <video:description>My shop and business #Shop #business #finance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515453/3515453_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-05T00:29:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lihat ceramah dulu yuk☺</video:title>
      <video:description>Lemahnya keikhlasan kita #Ceramahislam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515449/3515449_720p.mp4</video:content_loc>
      <video:duration>610</video:duration>
      <video:publication_date>2026-10-05T00:28:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pink Floral Elegance 🌷 | A Sweet &amp; Feminine Look</video:title>
      <video:description>A little pink, a touch of floral, and a whole lot of elegance. 🌸💕 Sometimes, the simplest outfit makes the sweetest statement. #PinkOutfitFloralFashionFeminineStyleOOTDStyleInspoCuteOutfitFashionInspoShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515448/3515448_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:28:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful morning walk on a beach</video:title>
      <video:description>Beautiful morning walk on a beach #Beach #sea #walk #alone</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515447/3515447_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-05T00:28:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautiful fish 3</video:title>
      <video:description>beautiful fish #fish</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515445/3515445_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T00:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful building and rainy weather</video:title>
      <video:description>Beautiful building and rainy weather #Weather #beautiful #rain #building</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515444/3515444_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T00:26:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful nature voices at early morning</video:title>
      <video:description>Beautiful nature voices at early morning #Morning #natural #outdoor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515443/3515443_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-05T00:24:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Cosmic Web: The Universe’s Hidden Structure</video:title>
      <video:description>The universe is shaped like a vast cosmic web, where billions of galaxies gather along enormous filaments of matter. Between these structures lie gigantic cosmic voids containing very few galaxies. This mysterious network stretches across unimaginable distances, revealing how gravity has shaped the large-scale structure of our universe. #CosmicWebSpaceFactsUniverseAstronomyGalaxyCosmologyDeepSpaceSpaceScienceAmazingUniverseCosmicMystery</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515442/3515442_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:23:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sihasyikk</video:title>
      <video:description>#Girls #beautiful #spillmata #ayu #gadisdesa #gadis #bungadesa #cantik #seksi #wanita #videopendek #shorts #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515441/3515441_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-05T00:22:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Impossible Shift: The Area 51 Satellite Photos That Defy Logic6</video:title>
      <video:description>For decades, Area 51 has remained one of the most heavily guarded and secretive locations on Earth. But unclassified satellite images reveal a shocking phenomenon: entire hangars and experimental test structures seem to shift their physical coordinates across the desert floor overnight! #​Area51UFOMysterySatelliteImagesConspiracySecretMilitaryAnomaliesTechnology</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515440/3515440_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-05T00:22:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terikat janji..</video:title>
      <video:description>Film seru #Film</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515439/3515439_720p.mp4</video:content_loc>
      <video:duration>3083</video:duration>
      <video:publication_date>2026-10-05T00:22:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Game English or spanish</video:title>
      <video:description>Video para countryballs indonesia bermain game English or Spanish #countryballs #Bumi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515438/3515438_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-05T00:19:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#goodstoryThailandWomen#</video:title>
      <video:description>Vloger from tahailand #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515437/3515437_720p.mp4</video:content_loc>
      <video:duration>1210</video:duration>
      <video:publication_date>2026-10-05T00:16:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Cat Prank Goes Wrong! 🐱🧽</video:title>
      <video:description>She was washing the dishes when he brought a stack of dirty plates... and tried to make it up to her with an iPhone! 🐱📱 But wait until she opens the box... it&apos;s a sponge! 🧽😂 Watch until the end to see her priceless reaction! Don&apos;t forget to like, comment, and subscribe for more funny cat animations! ✨🐱 #​funnycatprank #catanimation #iphoneprank #catwashingdishes #funnyanimationfyp #catvideo #funnycatstory #3Dcatanimation #cutecats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515436/3515436_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T00:15:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Highway driving</video:title>
      <video:description>Perfect view</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515435/3515435_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-05T00:15:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why Is Mbappé Laughing Like This? 😂⚽</video:title>
      <video:description>#Realmadrrid #mbbape #psg #mbappelaughing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515434/3515434_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-05T00:15:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 17</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515433/3515433_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-05T00:15:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Proficional #saúde #piadascurtas #comedia #humor bora se</video:title>
      <video:description>#Seescrevam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515432/3515432_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T00:15:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It&apos;s okay 🔥🔥🔥</video:title>
      <video:description>It&apos;s okay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515431/3515431_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T00:14:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title># Nunca é tarde para aprender !</video:title>
      <video:description>Os idosos também pode aprender a se conectar. #Nuncaétarde</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515430/3515430_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:14:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waseem tariq 5</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515429/3515429_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T00:14:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fidarabia 17</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515428/3515428_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-05T00:14:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nutgrass / rumput teki</video:title>
      <video:description>#travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515427/3515427_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-05T00:10:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aamiin 3</video:title>
      <video:description>Amin ya rabbal alamiin</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515426/3515426_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-05T00:10:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Latihan voli 2</video:title>
      <video:description>Latihan voli di sore hari bersama rekan kerja #Volley</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515425/3515425_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T00:10:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CLEANING CAR POLICE</video:title>
      <video:description>This close-up shot captures the detailed process of cleaning a vehicle’s exterior. A soft-bristled detailing brush with a black handle gently scrubs the surface, swirling through thick, creamy white soap suds and foam that cover the bodywork. The vehicle features a white base with bold blue lettering and a circular emblem, partially hidden beneath the lather. Glistening water droplets and bubbles cling to the paint, creating a fresh, wet appearance that highlights the careful, thorough cleaning work being done. The lighting emphasizes the texture of the foam and the smooth finish of the vehicle’s surface, conveying a sense of precision and professional care. #Car #toy #police</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515424/3515424_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-05T00:09:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>up to down</video:title>
      <video:description>Sexy Lady #sexy #beauty #umderware</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515423/3515423_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-05T00:08:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kuha River Viqueque</video:title>
      <video:description>In the morning at the kuha river Viqueque municipal - Timor Leste #Kuha #river #viqueque #trip #timorleste</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515422/3515422_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-05T00:07:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>top 5 fishing</video:title>
      <video:description>this video is very interesting for anglers #fish #fishing #top5moment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515421/3515421_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-10-05T00:07:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bet.h.lehem Kud.umb.a Unit 2026</video:title>
      <video:description>Bethlehem Kudumba Unit 2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515420/3515420_720p.mp4</video:content_loc>
      <video:duration>9313</video:duration>
      <video:publication_date>2026-10-05T00:06:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Music DJ Pesta Babi - HSA MUSIC</video:title>
      <video:description>Play again the DJ remix entitled &quot;Pig Party&quot; made by HSA MUSIC #Dj #remix #music #horeg #Indonesia #CentralJava #India #audio #sound</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515419/3515419_720p.mp4</video:content_loc>
      <video:duration>401</video:duration>
      <video:publication_date>2026-10-05T00:05:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It&apos;s okay 2</video:title>
      <video:description>A shot video for the new single track</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515418/3515418_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-05T00:04:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nusa Penida - Bali</video:title>
      <video:description>Beautiful island in bali - Nusa Penida #balinusapenidabeautifulislandnatureindonesiafyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515417/3515417_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-05T00:02:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comedia 13</video:title>
      <video:description>Humor e comédia sorria sempre #comédiahumorcomédiahumor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515416/3515416_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T23:55:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515415</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515415/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot &amp; Sexy Indian Beautiful Desi Woman Sensational Erotic Video - Bong Model Reel Video</video:title>
      <video:description>Hot &amp; Sexy Indian Beautiful Desi Woman Sensational Erotic Video - Bong Model Hot, Desi, Beauty, girl, woman, model, best, top, new, sexy, saree, indian, india, arabic, teen, Desire, video, reel, post, fb, insta, ticktok, live, news, trending, viral, vids, #Amazing, #beauty, #fbreels, #beautiful, #girlfriend, #Women, #beach, #health, #fitness, #design, #artist, #trendingreels, #reelsvideo, #trending, #trend, #business, #gym, #fb, #instagram, #viralvideo, #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids #Amazing #fbreels #beautiful #girlfriend #Women #beach #health #fitness #design #artist #trendingreels #reelsvideo #trend #business #gym #instagram #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515415/3515415_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T23:54:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>R@jwant-2024</video:title>
      <video:description>Rajwant-2024</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515414/3515414_720p.mp4</video:content_loc>
      <video:duration>3579</video:duration>
      <video:publication_date>2026-10-04T23:54:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daria 4</video:title>
      <video:description>David #Mosabimque</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515413/3515413_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:53:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waste of time ? Maybe. But it is so Cute... [2]</video:title>
      <video:description>AI Delirious. Delicious. #Aihumor #cats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515412/3515412_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T23:53:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desi Hot_Model Beautiful Shital Shaw Hot &amp; Sexy video</video:title>
      <video:description>Desi Hot_Model Beautiful Shital Shaw Hot &amp; Sexy video #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids #Amazing #fbreels #beautiful #girlfriend #Women #beach #health #fitness #design #artist #trendingreels #reelsvideo #trend #business #gym #instagram #viralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515411/3515411_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-10-04T23:53:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coffee 24</video:title>
      <video:description>The Coffee will be roasted to be turned into perfect ground coffee #Coffee #Powder #roasted</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515410/3515410_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T23:52:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Waste of time ? Maybe. But it is so Cute...</video:title>
      <video:description>AI Delirious. Delicious. #AI #Humor #Cats</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515409/3515409_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:52:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como evitar as bactérias em casa</video:title>
      <video:description>Dicas úteis para você evitar as bactérias em casa #higienehigienizarhigieneencasa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515408/3515408_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T23:50:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣🤣🤣🤣🥹🤣</video:title>
      <video:description>#🤣🤣</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515407/3515407_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T23:48:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mensagem de Deus Para Quem Não Sabe Qual Caminho Seguir</video:title>
      <video:description>Sentindo incerteza ou medo do futuro? Pare 1 minuto e escute esta mensagem que vai renovar a sua fé e trazer paz ao seu coração. 🙏✨ Mesmo quando a névoa encobre os seus passos e o caminho parecer escuro, Deus conhece o horizonte e cuida de cada detalhe da sua caminhada. Entregue sua ansiedade e confie. Capítulos: 00:00 - Confiando além da névoa 00:25 - A esperança no meio do vale 00:50 - Deus nos caminhos desconhecidos 01:20 - O futuro que pertence a Deus Deixe o seu &apos;Amém&apos; nos comentários, curta para que esta mensagem alcance mais pessoas e inscreva-se para fortalecer sua fé todos os dias! #fé #deus #reflexão #motivaçãocristã #palavradedeus #shorts Pegar imagens: https://www.facebook.com/profile.php?id=100046773042863 #mensagemdedeus #reflexãobíblica #palavradefé #confiaremdeus #oraçãoparaansiedade #motivaçãocristã #deuscuidadevocê #versículododia #paznocoração #superação #vídeoscurtosdefé #deusestánocontrole #shortscristãos #pregaçãomotivacional</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515406/3515406_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-10-04T23:47:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wait Until You See This Sunset 🌅😍</video:title>
      <video:description>A peaceful sunset that feels like a dream. 🌅✨ Sometimes, all we need is a beautiful view and a quiet moment. 🌊❤️ #beautifulsunset #sunsetbeach #oceansunset #breathtakingview #nature #relaxingscenery #tropicalbeach #goldenhour #beautifulnature #cinematicscenery #peacefulocean #sunsetvibes #travelinspiration #relaxingvideo #scenicview #naturelovers #amazingsunset #beachvibes #4knature #viralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515405/3515405_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:46:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pooj@ Meri J@@n 2026</video:title>
      <video:description>Pooja Meri Jaan 2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515404/3515404_720p.mp4</video:content_loc>
      <video:duration>7052</video:duration>
      <video:publication_date>2026-10-04T23:45:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chased by a mad cow</video:title>
      <video:description>Funny video 🤣 #Comedy #funnyvideo #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515402/3515402_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:44:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NIRVANA - LITHIUM - Song Lyrics</video:title>
      <video:description>Song Lyrics NIRVANA - LITHIUM #Nirvana #LITHIUM #songlyrics #liriklagu #oldsongs #lagulawas #music #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515401/3515401_720p.mp4</video:content_loc>
      <video:duration>256</video:duration>
      <video:publication_date>2026-10-04T23:42:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Resposta da Sua Oração Vai Chegar no Momento Certo</video:title>
      <video:description>Está passando por um momento difícil ou esperando a resposta de uma oração? Essa mensagem foi preparada para o seu coração hoje! Neste vídeo curto de reflexão e fé, compreenda como Deus trabalha nos bastidores da sua vida mesmo durante as noites escuras e os caminhos difíceis. Lembre-se: o choro dura uma noite, mas a alegria chega pela manhã. Capítulos: 00:00 - A alegria vem pela manhã 00:25 - O propósito no caminho imperfeito 00:50 - Deus trabalha no silêncio 00:75 - O tempo certo do florescer Se esta palavra tocou seu coração, deixe seu &apos;Amém&apos; nos comentários, compartilhe com quem precisa e inscreva-se para receber paz diária! #mensagemdedeus #fé #deus #oracao #palavradedeus #shorts #versiculododia Pegar imagens: https://www.facebook.com/profile.php?id=100046773042863 #mensagemdedeus #deus #fe #oracao #palavradodia #jesus #versiculobiblico #deusestaagindo #respostadeoracao #consolodedeus #motivacaocrista #esperanca #shortscristaos #devocional #milagre</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515400/3515400_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-04T23:41:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Was Leaving… And His Best Friend Couldn&apos;t Hold Back 😢</video:title>
      <video:description>Some goodbyes are harder than words can explain. 😢 Two best friends. One unforgettable moment. Even when distance separates them, true friendship never disappears. ❤️ If you have a best friend you never want to lose, send this to them. 🤝 #emotionalfriendship #goodbyefriends #bestfriendsforever #sadfriendship #emotionalvideo #friendshipstory #touchingmoment #heartbreakinggoodbye #truefriendship #friendsforever #bestfriend #emotionalshorts #sadvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515399/3515399_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:41:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>oyen nih boss</video:title>
      <video:description>kucing gaul</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515398/3515398_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:41:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515397</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515397/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beauty of Starship Landing</video:title>
      <video:description>Wonderful #Starship #Landing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515397/3515397_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T23:41:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#StoryCriminalFromOregon#</video:title>
      <video:description>goodStory #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515396/3515396_720p.mp4</video:content_loc>
      <video:duration>2140</video:duration>
      <video:publication_date>2026-10-04T23:41:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beauty os Starship Launch</video:title>
      <video:description>Wonderful #Starship #Launch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515395/3515395_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T23:39:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Feel the Breeze: Embrace Your Inner Freedom and Fresh Beginnings</video:title>
      <video:description>Let the wind carry away your doubts and refresh your spirit. Embrace the freedom of the present moment and step into your day with renewed energy and optimism. #​Freshstartmotivation #​Innerfreedommindset #​Outdoorinspiration #​Positiveenergydaily #​Mindfulmoments</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515394/3515394_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-04T23:39:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuidados com a saúde feminina</video:title>
      <video:description>Siga estas dicas simples e úteis para a saúde feminina #saúdesaudefemininasaudavel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515393/3515393_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T23:38:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Y@@r Jigree K@sooti Degree 2026</video:title>
      <video:description>Yaar Jigree Kasooti Degree 2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515392/3515392_720p.mp4</video:content_loc>
      <video:duration>10233</video:duration>
      <video:publication_date>2026-10-04T23:38:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chaos Erupts at Traditional Indonesian Art Performance</video:title>
      <video:description>Chaos broke out during a traditional Indonesian art performance as tensions between people in the crowd escalated. Watch what happened as the situation became increasingly difficult to control. #ThechaosandclashesbetweenpeopleintheareawheretraditionalIndonesianartswereperformedgotoutofcontrol #chaos #Noise #commotion #viral #popular #security #Indonesia #police #citizens #people #humans #teenagers #fyp #Facebook #tiktok #world #videos #latest #traditional #traditionalarts #인도네시아전통예술공연이열리던지역에서사람들간의혼란과충돌이통제불능상태에빠졌다혼란 #소음 #소동 #바이러스처럼퍼지는 #인기있는 #혼란 #보안 #인도네시아 #경찰 #도시 #خرجتالفوضىوالاشتباكاتبينالناسفيالمنطقةالتيتُقامفيهاعروضالفنونالإندونيسيةالتقليديةعنالسيطرة在印尼傳統藝術表演區，人群之間的混亂和衝突失控。</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515391/3515391_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-10-04T23:38:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sound Horeg Jawa Timur</video:title>
      <video:description>Ceksound Karnaval MalangSuko #Soundhoreg</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515390/3515390_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T23:37:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Your Best Friend Makes Everything 10x Funnier 😂</video:title>
      <video:description>Everything is funnier when you&apos;re with your best friend! 😂 From random conversations to unforgettable moments, these are the memories that make friendship special. ❤️ Send this to your funniest best friend! 🤣🤝 #funnyfriends #bestfriends #funnyfriendship #bestfriendmoments #friendshipgoals #funnyvideo #comedyshorts #friendsbeingfunny #bestie #funnymoments #hilariousfriends #friendship #friendsforever #viralfunnyvideo #funnyshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515389/3515389_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:37:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kisahku 2</video:title>
      <video:description>Cerita perjalan hidup yg penuh liku dan tak pernah bisa di tebak endingnya. Semua ku pasrahkan pada sang pencipta Allah swt. #Kisahku #sukaduka #manusia #rahasiahidup #aku #dunia #semuaorang #beranda #cinta #sedih #galau #tuarenta #lahir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515388/3515388_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:37:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eminem without me 2</video:title>
      <video:description>Subscribe for More videos 😁 #Eminem #withoutme #rap #song #good #TikTok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515387/3515387_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:37:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wait for end 😂🤣</video:title>
      <video:description>Funny video #Funnyvideo #comedy #funny #humor #meme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515386/3515386_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T23:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aprenda a Ter Paz e Sabedoria em Momentos Difíceis 📖</video:title>
      <video:description>Precisa de paz e sabedoria para hoje? Assista a esta reflexão inspiradora e renove suas energias espirituais! 🙏✨ Neste vídeo curto, compartilhamos mensagens profundas sobre ser um promotor da paz, o verdadeiro significado de amar o próximo através da escuta atenta e a clássica prece por serenidade, coragem e sabedoria para enfrentar os desafios da vida. 📍 Capítulos: 00:00 - Bem-aventurados os que promovem a paz 00:25 - Amar o próximo é saber ouvir 00:50 - Oração da Serenidade e Sabedoria 💬 Curta, comente amém e compartilhe com quem precisa ouvir isso hoje! 🔔 Se inscreva no canal para mais reflexões diárias de fé e esperança. #FeEmDeus #MensagemEspirutal #ReflexaoDiaria #DeusNoComando #PazESereno #ShortsCristaos Pegar imagens: https://www.facebook.com/profile.php?id=100046773042863 #mensagemdedeus #reflexaododia #versiculododia #oracaodaserenidade #deus #jesus #pazdeespirito #palavradedeus #motivacaocristã #fe #amoraoproximo #sabedoria #devocionaldiario #shortsdefe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515385/3515385_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-04T23:35:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dicas de igiene e proteção feminina</video:title>
      <video:description>Dicas úteis de igiene e proteção feminina #igienesadavel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515384/3515384_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-04T23:34:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BEST ORGASMS - MASSIVE CUMSHOTS - Real Homemade Porn Mr Pussy Licking</video:title>
      <video:description>Content intended for adult audiences (18+). This video is intended for audiences who have met the applicable age restrictions. Please watch wisely and in accordance with the platform&apos;s policies and terms. 🔞 #Pussyzoom</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515383/3515383_720p.mp4</video:content_loc>
      <video:duration>506</video:duration>
      <video:publication_date>2026-10-04T23:34:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat Training</video:title>
      <video:description>Funny Video #Funny #Cat #Zoo #Cute #Animal #Love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515381/3515381_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T23:33:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FRAG Pro Shooter - Gameplay | How to Beat a Defensive Deck</video:title>
      <video:description>FRAG Pro Shooter - Gameplay | How to Beat a Defensive Deck #FragProShooter​ #MobileGame​​​ #Multiplayer​ #fragproshooteredit #fragproshooterofficial #fragproshootergameplay #fragprosootergame #fragprosooter #mobilegameplay #mobilegame #mobilegames #gamesmobile #oldmobilegames #funmobilegames #mobilegaming #bestmobilegames #funnymobilegame #mobilegamesplay #crazymobilegames #funnymobilegames #viralmobilegames #mobile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515380/3515380_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-10-04T23:32:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Está confuso? Entregue seus medos nas mãos de Deus agora</video:title>
      <video:description>Se o seu coração está pesado ou com medo do amanhã, pare tudo e assista até o fim! Deus tem uma resposta clara para o seu caminho hoje. 🙏✨ Neste vídeo reflexivo, você encontrará palavras de esperança para momentos em que tudo parece um labirinto escuro. Descubra a força que nasce ao soltar suas preocupações e permitir que Deus transforme seus desertos em jardins floridos. Capítulos: 00:00 - Entregando os medos a Deus 00:25 - Os passos guiados pelo Senhor 00:50 - Luz na confusão e no labirinto 01:20 - Quando o deserto floresce com a fé Deixe o seu &apos;AMÉM&apos; nos comentários, compartilhe com quem está precisando de esperança e inscreva-se para fortalecer a sua fé todos os dias! ❤️ #PalavraDeDeus #MensagemDeFé #DeusNoControle #ShortsCristãos #OraçãoDoDia Pegar imagens: https://www.facebook.com/profile.php?id=100046773042863 #mensagemdedeus #palavradefé #oraçãoparaacalmarocoração #deuscuidadevocê #deuséfiel #vídeomotivacionalevangélico #passosdedeus #confiançaemdeus #shortsdeoração #mensagembíblicadeconforto #versículosdabíblia #féeesperança #superaçãoefé</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515379/3515379_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-04T23:30:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Was Alone… Until His Best Friend Showed Up ❤️</video:title>
      <video:description>Sometimes, you don&apos;t need many friends. You just need one true friend who stays when everyone else leaves. ❤️ A beautiful reminder that true friendship means being there through the good times and the hard times. 🤝 Tag your best friend! ❤️ #truefriendship #bestfriends #friendshipgoals #friendship #bestfriendforever #loyalfriend #emotionalfriendship #wholesomevideo #friendsforever #friendshipmoment #emotionalvideo #heartwarming #touchingstory #supportivefriend #goodfriends #friendshipstory #bestie #friendshiplove #inspirationalvideo #viralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515378/3515378_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:29:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Suck and lick my sister-in-law&apos;s dick while my husband is away at work</video:title>
      <video:description>Watch till the end</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515377/3515377_720p.mp4</video:content_loc>
      <video:duration>427</video:duration>
      <video:publication_date>2026-10-04T23:28:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DubaiStory</video:title>
      <video:description>Cerita kehidupandubai #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515375/3515375_720p.mp4</video:content_loc>
      <video:duration>1472</video:duration>
      <video:publication_date>2026-10-04T23:26:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>They collided at the start</video:title>
      <video:description>Car racing accident #Carracing #accident</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515374/3515374_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T23:26:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣🤣🤣🤣🤣 10</video:title>
      <video:description>Comedy #Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515373/3515373_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T23:24:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A grande jogada</video:title>
      <video:description>Divertidas frutas falantes em uma grande jogada frutebolesca do fim de copa #esporteesportiva</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515372/3515372_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T23:24:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515371</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515371/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spectacular speedboat accident</video:title>
      <video:description>High-speed #Speedboat #accident</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515371/3515371_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T23:24:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Running over those who were watching the rally</video:title>
      <video:description>Accident during a rally #Rally #car #accident</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515369/3515369_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:22:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Normal skill VS Kings of trampoline 3</video:title>
      <video:description>Watch these crazy skateboard &amp; roller skating tricks! 🔥 Watch till the end for a beautiful surprise ✨ If you enjoyed this video, don&apos;t forget to Like, Share, and Subscribe/Follow for more amazing short clips! #ViralShortsTrendingKaabaArtEntertainmentShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515368/3515368_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T23:21:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Improperly assembled overhead crane</video:title>
      <video:description>Accident at work #Accidents #overheadcrane</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515367/3515367_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:21:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>True Friendship Is Rare… But When You Find It ❤️</video:title>
      <video:description>Some friendships are more than just memories—they become a part of our journey. ❤️ Through laughter, support, and every little moment, a true friend always stays by your side. 🤝✨ Tag your best friend and let them know how much they mean to you! ❤️ #FriendshipBestFriendsTrueFriendshipFriendsForeverFriendshipGoalsBestFriendEmotionalWholesomeViralVideoShortVideoFebspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515366/3515366_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:20:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤫 Dad and Baby have a secret! 👶😂</video:title>
      <video:description>🤫 Dad and Baby have a secret! 👶😂 Dad thinks their little secret is safe… but the baby has other plans! 😆 Will the baby keep the secret or accidentally expose Dad to Mom? 🤣❤️ Watch until the end for the funniest moment! 👍 Like, 💬 Comment, and ❤️ Follow for more adorable family fun! #FunnyBaby #comedy #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515365/3515365_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣😹🦴🤣</video:title>
      <video:description>Comedy #Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515364/3515364_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T23:18:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>playing volleyball</video:title>
      <video:description>Volleyball practice in the afternoon with colleagues. #Volleyball</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515362/3515362_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T23:17:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Heavy bass. NUSA X</video:title>
      <video:description>NUSA X, Firestorm Nusa, Nusantara EDM, Nusantara Electronic, Indonesian EDM, Indonesia DJ, DJ instrumental, Bass House, Festival Bass House, EDM Indonesia, Electronic Dance Music, Festival EDM, DJ Music, Powerful EDM, Heavy Bass, Bass Music, Indonesian Electronic Music, Modern Nusantara Music, Nusantara DJ, EDM Festival, Bass Drop, Festival Drop, Original DJ Instrumental, NUSA X Music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515361/3515361_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T23:16:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 WAIT FOR THE DROP!</video:title>
      <video:description>🔥 **WAIT FOR THE DROP!** FIRESTORM NUSA — NUSA X 132 BPM. Heavy bass. Full festival energy. Turn it up. 🔊</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515360/3515360_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T23:14:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Lion and The Deer: An Impossible Love Story 🦁❤️🦌</video:title>
      <video:description>&quot;Watch this emotional and thrilling story of an impossible love in the jungle. A brave young lion risks his kingdom, his throne, and defies the laws of nature to protect a innocent deer from a fierce wolf and his own pride. Will love change the rules of the wild forever? If you loved this intense and dramatic video, please like, comment, and follow for the next part!&quot; #Lionanddeerstory #impossiblelove #junglerules #lionprotectingdeer #wolfvslionfight #emotionaljunglevideo #animaldrama #predatorandpreylove #beautifulnatureanimations #fantasystory #lionkingdrama #viralvideoFebSpot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515359/3515359_720p.mp4</video:content_loc>
      <video:duration>269</video:duration>
      <video:publication_date>2026-10-04T23:13:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#theFairygodmother#</video:title>
      <video:description>Bagus ceritanya #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515357/3515357_720p.mp4</video:content_loc>
      <video:duration>1134</video:duration>
      <video:publication_date>2026-10-04T23:13:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The economy is very difficult. Is there any solution</video:title>
      <video:description>The economy is very difficult. Is there any solution #TheeconomyisverydifficultIsthereanysolution #home #economics #bussinies #money #residence #night #story #words #meal #video #viral #fyp #trend #latest #WhatsApp #poor #success #work #income</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515356/3515356_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T23:12:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515355</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515355/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>iPhone Duo 2026 in 2003</video:title>
      <video:description>Time traveler #iPhone #iPhoneduo #smartphone #gadget #teknologi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515355/3515355_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T23:12:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mantenha seus cabelos sempre lindos</video:title>
      <video:description>Dicas simples para você manter seus cabelos sempre lindos e brilhantes #saúdecapilarcabelosaudavel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515354/3515354_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T23:11:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GhostStorySingapore#</video:title>
      <video:description>GhostStorySingapore #Chindel900</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515353/3515353_720p.mp4</video:content_loc>
      <video:duration>1393</video:duration>
      <video:publication_date>2026-10-04T23:10:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>👶😂 A BABY WITH BIG DREAMS!</video:title>
      <video:description>👶😂 A BABY WITH BIG DREAMS! He’s only one year old, but he’s already thinking about getting a luxury car! 🚗🤣 He can barely walk, but his dreams are already bigger than ours! 😂❤️ #FunnyBaby #comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515352/3515352_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:09:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ibu ibu Viral joget di pinggir pantai</video:title>
      <video:description>Ibu ibu Viral joget di pinggir pantai #Mother</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515351/3515351_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T23:08:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤣🤣🤣🤣🤣 9</video:title>
      <video:description>#Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515350/3515350_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T23:08:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>home sweet home 🏡</video:title>
      <video:description>no where like home</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515349/3515349_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:07:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>الاسد الصحراء عمر المختار جزء 1</video:title>
      <video:description>الاسد الصحراء عمر المختار جزء 1</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515348/3515348_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T23:06:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mantenha seu corpo saudável</video:title>
      <video:description>Dicas úteis de ginástica para você manter seu corpo sempre saudável #saúdeesportesaudesporte</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515347/3515347_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T23:05:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515346</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515346/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stunning Pair of Lemon Oscar Fish in a Clear Water Tank 💛</video:title>
      <video:description>&quot;Watch this beautiful and vibrant pair of Golden / Lemon Oscar fish swimming gracefully in a crystal-clear aquarium. Their bright yellow color and playful movements make this a truly relaxing and captivating underwater scene for all fish lovers. If you love aquatic life and creative tank setups, please like, comment, and follow the channel for more stunning fish videos!&quot; #GoldenOscarfish #LemonOscar #yellowOscarfish #aquariumfish #beautifulfishtank #freshwatercichlids #relaxingaquariumvideo #petfish #clearwatertank #exoticfish #fishaquariumsetup #FebSpotfishvideo #aquaticlife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515346/3515346_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:05:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515345</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515345/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Man&apos;s best friend</video:title>
      <video:description>animal lover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515345/3515345_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:04:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jupiter’s Ocean of Metallic Hydrogen</video:title>
      <video:description>Deep inside Jupiter, enormous pressure transforms hydrogen into a strange liquid metallic state. This electrically conductive layer is believed to play a major role in generating Jupiter’s powerful magnetic field. #JupiterMetallicHydrogenHydrogenOceanJupiterFactsSpaceFactsAstronomyUniverseSpaceSciencePlanetFactsMagneticFieldSolarSystemNASAScienceFactsCosmicMysteryAmazingUniverseSpaceExplorationSpaceShortsYouTubeShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515344/3515344_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:04:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion 16</video:title>
      <video:description>photoshoot dsy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515343/3515343_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:03:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515342</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515342/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dghjjvc</video:title>
      <video:description>Xfghvcxxsssd #Viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515342/3515342_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T23:02:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Корни Сага о вампирах</video:title>
      <video:description>Корни Сага о вампирах #КорниСагаовампирах</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515341/3515341_720p.mp4</video:content_loc>
      <video:duration>4774</video:duration>
      <video:publication_date>2026-10-04T23:02:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Models 🥂🌹</video:title>
      <video:description>fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515340/3515340_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T23:01:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Majestic Red Arowana Fish Encounter with a Crab! 🐉🦀</video:title>
      <video:description>&quot;Watch this incredible footage of a magnificent Red Arowana fish swimming gracefully and encountering a brave crab at the bottom of a beautifully aquascaped tank. The intense standoff and the vibrant colors of the Arowana make this a must-watch for all aquarium and aquatic life enthusiasts! If you enjoyed this underwater action, please like, comment, and follow the channel for more amazing fish videos!&quot; #RedArowana #Arowanafish #crabencounter #aquariumfish #dragonfish #underwaterface-off #aquascaping #freshwaterpredator #beautifulfishtank #rareaquariumfish #aquaticlife #exoticpets #FebSpotviralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515339/3515339_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T23:01:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Playing the game Mobile Legends.</video:title>
      <video:description>Playing the game Mobile Legends. Hero miya #Mobilelegen #gemeheromiya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515338/3515338_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T22:55:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The pleasure of fucking my sister-in-law in the kitchen in the morning</video:title>
      <video:description>A high school girl has intimate relations with her own sister-in-law #ASEANwomen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515337/3515337_720p.mp4</video:content_loc>
      <video:duration>541</video:duration>
      <video:publication_date>2026-10-04T22:55:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 **You Won’t Stop Laughing! 🤣**</video:title>
      <video:description>😂 **You Won’t Stop Laughing! 🤣** Get ready for a hilarious video packed with funny moments, crazy reactions, unexpected surprises, and nonstop laughter! 😆🔥 Watch until the end—you never know what’s going to happen next! 😂 👍 Like | 🔔 Subscribe | ❤️ Share #FunnyComedyFunnyVideoHilariousFunnyMomentsLaughEntertainmentViral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515336/3515336_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:53:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Red Spotted Discus Fish in Aquarium 🐠</video:title>
      <video:description>&quot;Watch this beautiful and vibrant Red Spotted Discus Fish swimming gracefully in a beautifully set up aquarium. Watch how it interacts with a school of tiny fish and another tank mate in this relaxing underwater scene. Perfect for aquarium lovers and anyone looking for a peaceful nature vibe. Don&apos;t forget to like, comment, and follow for more stunning fish and aquarium videos!&quot; #Discusfish #reddiscusfish #aquariumfish #beautifulaquarium #underwaterworld #relaxingfishvideo #schooloffish #tropicalfish #freshwaterfish #petfish #aquariumsetup #fishfeeding #FebSpotfishvideo #naturevibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515335/3515335_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T22:52:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice video good 2</video:title>
      <video:description>....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515334/3515334_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-04T22:46:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Robot Kartun Main Layang-Layang</video:title>
      <video:description>Video kartun pendek — robot lucu main layang-layang 🪁 #kartun #animasi #lucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515333/3515333_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:46:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 292</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515332/3515332_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:45:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EL MUNDO LA RAE CON UN PROBLEMA DE SALUDO un diálogo en tiempo real entre Géminis de Google y el Poe</video:title>
      <video:description>OJO: solo para personas con clase que no sean ociosos, cortos y tengan tiempo de oír, ver y leer. ¿Hasta cuándo vamos a seguir aguantando normas y academias que se ahogan en un vaso de agua mientras el mundo real busca una respuesta? 🌍✍️No te pierdas este encuentro frontal, crudo y necesario: &quot;El mundo y la RAE con un problema de saludo&quot;. Un diálogo profundo, sin caretas, entre la inteligencia artificial de Google y el poeta Eliad Jhosué, donde desnudamos los enredos del lenguaje, la rigidez institucional y la chispa del pensamiento actual. Este diálogo confirma con veracidad que entre máquina y humano se puede estabilizar una convivencia asincrónica, perfecta y productiva, donde no existen fronteras ni deshumanización que corrompan su hegemonía socio-científica y cultural. Hoy en día le hacen una crítica destructiva a la IA sin ver que existen perspectivas capaces de mejorar la calidad humana al servicio de cualquier materia de la vida. Así como se critica de forma destructiva la música creada enteramente en Suno de manera artificial —algo que corrompe y daña la esencia de convivencia entre la Inteligencia Humana y la IA—, cuando esa creación lleva mano humana, aportes genuinos y sensibilidad, la historia cambia por completo: la convivencia pasa de ser corrompida a convertirse en algo limpio y de gran provecho para la sociedad. Que este diálogo, creado de manera interactiva y en tiempo real, funcione como un juicio sanatorio contra todas aquellas entidades que atacan a la IA en lugar de señalar a quienes la usan de manera indebida e injusta para delinquir. 💻 Nota técnica de producción: Este audiovisual fue editado y producido con PowerDirector, una auténtica fiera que corre como el viento, cero tirones, sin caídas de render y sin la ladilla de estar comprando créditos </video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515331/3515331_720p.mp4</video:content_loc>
      <video:duration>341</video:duration>
      <video:publication_date>2026-10-04T22:45:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515330</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515330/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chekh out this</video:title>
      <video:description>....</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515330/3515330_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T22:43:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Falcon 9 launch</video:title>
      <video:description>Slim. Elegant. Efficient. #Falcon9 #Musk #SpaceX #rocket</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515329/3515329_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T22:42:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Artemis II launch 2</video:title>
      <video:description>From an near public observation point #Artemis #rocket #launch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515328/3515328_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T22:41:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Artemis II launch 1</video:title>
      <video:description>Great view #Artemis #rocket #launch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515327/3515327_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T22:39:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wild Life 4</video:title>
      <video:description>&quot;This is a wildlife video found on the internet. Someone captured a very good moment. Please explain everything about it. #wildlife #cinematicanimalfacts #caughtoncamera #tiger #wildcat #amazingmoment #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515326/3515326_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-10-04T22:38:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2026-10-04T200637.638.mp4</video:title>
      <video:description>https://www.febspot.com/ref/1217291/</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515325/3515325_720p.mp4</video:content_loc>
      <video:duration>111</video:duration>
      <video:publication_date>2026-10-04T22:38:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gimme Gimme Gimme to Me One of It</video:title>
      <video:description>A toy for all of us #Decoration #space #rocket</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515324/3515324_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:38:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>American street</video:title>
      <video:description>A Peaceful Drive Through One of the Most Beautiful American Neighborhoods #america</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515323/3515323_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:36:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus Caminha com Você - Parte 2 / Letra Dola / Intérprete: Francisco Sérgio.</video:title>
      <video:description>Jesus Caminha com Você - Parte 2. Letra Dola / Intérprete: Francisco Sérgio. Letra - Parte 2: Tens escolhas a fazer, caminho para percorre. Mas fique ligado, para não se perder. Entregue tudo ao senhor, Nele pode confiar. Ele vai te guiar, e vai te proteger. Jesus Caminha com você, não importa aonde você vá. Quando você está rezando, Ele está ao teu lado te escutando. &quot;Lembre -se não importa a dificuldade, Jesus está sempre ao seu lado caminhando com você. Peça orientação a Ele, e com certeza Ele vai te dar&quot;. Deixe &quot;Jesus está comigo&quot; nos comentários! #JesusCaminhaComVocê #Fé #DeusTeAma #Criança #FranciscoSérgio #Amor #JesusWalksWithyou #Faith #GodLovesYou #GodlsLove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515322/3515322_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-04T22:35:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This guy does it with his hands</video:title>
      <video:description>Do you guys like this? #Gayboys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515321/3515321_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:33:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DEUS É A SOLUÇÃO PARA TODOS OS SEUS PROBLEMAS.</video:title>
      <video:description>Deus é a solução para todos os seus Problemas. “Pare por um instante e ouça esta palavra: o Senhor é o seu pastor, e nada vai lhe faltar. Mesmo quando o caminho parecer difícil, Deus continua cuidando de você. Confie, porque Ele conhece o caminho e nunca abandona aqueles que Nele esperram&quot;. #Deus #fe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515320/3515320_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T22:33:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515319</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515319/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indo Hijab Slut Fingers Her Wet Pussy</video:title>
      <video:description>What would you feel and do if a woman did this in front of you? #Hijabwomen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515319/3515319_720p.mp4</video:content_loc>
      <video:duration>367</video:duration>
      <video:publication_date>2026-10-04T22:29:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khatron Ke Khiladi Season 15 Episode 20 (Grand Finale)</video:title>
      <video:description>Khatron Ke Khiladi Season 15 Episode 20 (Grand Finale)</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515318/3515318_720p.mp4</video:content_loc>
      <video:duration>5328</video:duration>
      <video:publication_date>2026-10-04T22:29:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PCX mode sad🙂</video:title>
      <video:description>Balapan motor seru di GTA dengan kecepatan tinggi dan berbagai rintangan ,saksikan sampai hakir #GTA5 #GTAV #balapmotor #GTAbalapmotor #GTAracing #motorcycleracing #GTAmotorcycle #GTAgameplay #GTAIndonesia #racinggame #motorGTA #balapanGTA #gameplayIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515317/3515317_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T22:28:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Notícias do Brasil e do mundo</video:title>
      <video:description>Notícias atualizadas de hoje #NotíciasdoBrasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515316/3515316_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-10-04T22:26:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cristiano Ronaldo 146</video:title>
      <video:description>Flashback of GOAT era #cristianoronaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515315/3515315_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T22:26:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The ordinary jackpot Ep 8 Hindi dubbed full latest K-drama</video:title>
      <video:description>The ordinary jackpot Ep 8 Hindi dubbed full latest K-drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515314/3515314_720p.mp4</video:content_loc>
      <video:duration>2770</video:duration>
      <video:publication_date>2026-10-04T22:25:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brassage</video:title>
      <video:description>Multitude linguistique et culturelle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515313/3515313_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-04T22:23:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bird  funny video</video:title>
      <video:description>#Birdspakhi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515312/3515312_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T22:21:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesian women #4</video:title>
      <video:description>Want to see Indonesian women like this? Follow my channel and give me support. |Look at this Indonesian woman, a seductive Asian woman | #Asianwomen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515311/3515311_720p.mp4</video:content_loc>
      <video:duration>594</video:duration>
      <video:publication_date>2026-10-04T22:20:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515310</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515310/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Free mode</video:title>
      <video:description>For enjoyment purpose</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515310/3515310_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T22:17:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>romantic gitar</video:title>
      <video:description>romantic gitar #romanticgitar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515309/3515309_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T22:16:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Look at this Indonesian woman&apos;s expression</video:title>
      <video:description>Indonesian woman who is feeling the pleasure #HijabWomen #IndonesianHijab #Masturbation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515308/3515308_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T22:13:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This girl is living in future filming herself</video:title>
      <video:description>This girl is living in future filming herself #Travel #girl #girls #drone #kamera #fashion #future #video #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515307/3515307_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:12:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>trader anomali</video:title>
      <video:description>#FYP #trader #viral #funny #money</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515306/3515306_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T22:10:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#foryoupage #foryoupage #foryoupage ##fyp #foryou #foryoupage #fypシ #movieclips #film #movie #netfli</video:title>
      <video:description>#foryoupage #foryoupage #foryoupage ##fyp #foryou #foryoupage #fypシ #movieclips #film #movie #netflix #trending #new #foryourpage#tiktok #foryoupageforyoupageforyoupagefypforyouforyoupagefypシmovieclipsfilmmovienetflixtrendingnewforyourpagetiktok</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515305/3515305_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-10-04T22:10:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asmr relaxing satisfying water</video:title>
      <video:description>Beauty asmr relaxing satisfying water #Asmr #relaxing #asmrrelaxing #asmrshorts #asmrsatisfying #asmrstyrofoam #earcandy #deepsleep #ambientsound #sleepsound</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515304/3515304_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T22:10:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>US Ambassador to Israel Mike Huckabee praised Hayun&apos;s heoism Siring the attempted attack on the Flyd</video:title>
      <video:description>US Ambassador to Israel Mike Huckabee praised Hayun&apos;s heroism during the attempted attack on the Flydubai flight. Hayun told the ambassador: &quot;All the little miracles that happened there—they all added up to one big miracle.&quot; #Channel7TikTok #Dubai #Flydubai #YanivHayun #US #Ambassador #praise #Hayun #hero</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515303/3515303_720p.mp4</video:content_loc>
      <video:duration>142</video:duration>
      <video:publication_date>2026-10-04T22:09:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PLAY GROUND</video:title>
      <video:description>Siapa di sini yang punya mimpi punya rumah bambu di tengah sawah Ubud? Absen di komen! Nanti aku DM inspirasi desainnya gratis 🌾 #villabamboo #playground #disainbamboo #kontruksi #arsitektur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515302/3515302_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T22:09:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beauty 45</video:title>
      <video:description>beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515301/3515301_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:05:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thank you CR7</video:title>
      <video:description>End era of GOAT #cristianoronaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515300/3515300_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T22:04:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UNBELIEVABLE</video:title>
      <video:description>She thought he already left, only to see him still lying down after a no Well spent in sweetness. Just imagine the shock on her face!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515299/3515299_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T22:03:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fanny video 115</video:title>
      <video:description>Nice video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515298/3515298_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T22:02:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RKM LEGACY ♒ 341</video:title>
      <video:description>RKM LEGACY ♒ #RKMLEGACY♒</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515297/3515297_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T22:01:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GM GM🫢</video:title>
      <video:description>#Game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515296/3515296_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T21:59:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>For you all</video:title>
      <video:description>Beautifull woman #sexy #lingeri #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515295/3515295_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T21:58:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Musik melayu 2</video:title>
      <video:description>Dengan ada musik galau ya hilang #Pulaupanjang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515294/3515294_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T21:57:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie 5</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515293/3515293_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T21:57:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie 4</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515292/3515292_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:57:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie 3</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515291/3515291_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T21:56:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie 2</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515290/3515290_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T21:56:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LADIES CHOICE</video:title>
      <video:description>Have never try this before but when I did” I realised how cute it looks on me. But then, I said to myself I’ll do this more often as my new style.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515289/3515289_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T21:56:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carly marie</video:title>
      <video:description>Carly marie #Carlymarie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515288/3515288_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-10-04T21:56:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful nature 375</video:title>
      <video:description>Beautiful nature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515287/3515287_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T21:55:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Playing Roblox games with friends</video:title>
      <video:description>Photo content with Roblox friends #Fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515286/3515286_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T21:55:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Berkah 3</video:title>
      <video:description>#Hidup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515285/3515285_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:55:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bertahan</video:title>
      <video:description>#Hidup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515284/3515284_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:55:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🦊 **Hyena vs. Fox — A Fight for Survival in the Harsh Desert! 🐺🔥**</video:title>
      <video:description>🦊 **Hyena vs. Fox — A Fight for Survival in the Harsh Desert! 🐺🔥** In a scorching and unforgiving desert, every drop of water and every meal can mean the difference between life and death. When a powerful hyena encounters a determined fox, a fierce battle for survival begins. 😱🏜️ Who will survive this dangerous confrontation? Watch until the end to witness the struggle, tension, and incredible survival instincts of these wild animals. 👍 Like | 🔔 Subscribe | ❤️ Share</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515283/3515283_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-10-04T21:54:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤲 bersyukur</video:title>
      <video:description>#Doa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515282/3515282_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:54:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Is this what you want?</video:title>
      <video:description>Let&apos;s see how many viewers this video gets. #Indonesianwomen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515281/3515281_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:54:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amin🤲</video:title>
      <video:description>#Doa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515280/3515280_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T21:54:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kehidupan 20</video:title>
      <video:description>#Kehidupan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515279/3515279_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:53:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geol geol</video:title>
      <video:description>#Goyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515278/3515278_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T21:53:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515277</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515277/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naked woman playing</video:title>
      <video:description>How do you feel?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515277/3515277_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T21:52:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Traditional way.</video:title>
      <video:description>Cultural show up 🥰 #Dancers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515276/3515276_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:50:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Blast buzzzeerrr</video:title>
      <video:description>Buzeeer dollar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515275/3515275_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T21:50:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot hot pop🫢</video:title>
      <video:description>#Goyang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515274/3515274_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T21:50:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>James Blunt</video:title>
      <video:description>Mistake #JamesBlunt #Mistake #Music #viral #song #Febspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515273/3515273_720p.mp4</video:content_loc>
      <video:duration>256</video:duration>
      <video:publication_date>2026-10-04T21:49:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goyang sis</video:title>
      <video:description>#Goyangdlu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515272/3515272_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T21:48:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sitting alone at night</video:title>
      <video:description>Alone without anyone in the middle of the night #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515270/3515270_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-04T21:46:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tehnik sadari pikiran emosi dan tubuh</video:title>
      <video:description>Luangkan waktu hanya 60 detik untuk pulang kembali ke diri Anda. Audio pemandu singkat ini dirancang untuk membantu Anda menyadari kondisi pikiran, merangkul perasaan, dan merilekskan tubuh yang tegang di tengah padatnya aktivitas. Duduklah dengan nyaman, gunakan earphone, dan ikuti panduannya. #MindfulnessIndonesiaMeditasi1MenitKesadaranDiriKesehatanMentalSelfAwarenessRelaksasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515269/3515269_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-04T21:46:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sakit itu ketika wanita yang kita sayang selingkuh 😭</video:title>
      <video:description>#sad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515268/3515268_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T21:44:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prat satu kaisar pedang penjaga gununf awal.mula</video:title>
      <video:description>#Indonesiadrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515267/3515267_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T21:44:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean 2</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515266/3515266_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-04T21:42:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeon meshi ep24</video:title>
      <video:description>Sub indo #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515265/3515265_720p.mp4</video:content_loc>
      <video:duration>1497</video:duration>
      <video:publication_date>2026-10-04T21:42:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>aset berharga saat umur 20tahu</video:title>
      <video:description>#edukasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515264/3515264_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T21:41:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeon meshi ep23</video:title>
      <video:description>Sub indo #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515263/3515263_720p.mp4</video:content_loc>
      <video:duration>1702</video:duration>
      <video:publication_date>2026-10-04T21:40:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BATTLE THROUGH THE HEAVENS EPISODE 213</video:title>
      <video:description>Donghua Battle Through The Heavens,season 5,episode 213 Xiaoyan #xiaoyan #btth #donghua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515262/3515262_720p.mp4</video:content_loc>
      <video:duration>1094</video:duration>
      <video:publication_date>2026-10-04T21:40:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skuy mabar</video:title>
      <video:description>#game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515261/3515261_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T21:40:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeon meshi ep22</video:title>
      <video:description>Sub indo #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515260/3515260_720p.mp4</video:content_loc>
      <video:duration>1452</video:duration>
      <video:publication_date>2026-10-04T21:39:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Master Aiim</video:title>
      <video:description>#Game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515259/3515259_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T21:39:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ECO Villa Bamboo</video:title>
      <video:description>Menyatukan mimpi dengan alam melalui detail bambu. Keindahan yang berkelanjutan dari jantung pulau bali #Bali #bambukontruksi #arsitektur #naturevibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515258/3515258_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T21:39:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantic Music</video:title>
      <video:description>Romantic Music #RomanticMusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515257/3515257_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:39:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Push Renked</video:title>
      <video:description>#Game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515256/3515256_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T21:39:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PUSH CS RENKED</video:title>
      <video:description>#Game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515255/3515255_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-04T21:38:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515254/3515254_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-04T21:37:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dungeon meshi ep21</video:title>
      <video:description>Sub indo #Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515253/3515253_720p.mp4</video:content_loc>
      <video:duration>1617</video:duration>
      <video:publication_date>2026-10-04T21:37:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yummy fish</video:title>
      <video:description>Time to eat and taste yummy fish😊 #healthyfood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515252/3515252_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T21:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pedang KAISAR ISTSHAR</video:title>
      <video:description>#Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515251/3515251_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-04T21:36:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😱 **A Terrifying Swing 1,000 Feet Above the Ground!**</video:title>
      <video:description>😱 **A Terrifying Swing 1,000 Feet Above the Ground!** Imagine sitting on a swing at an incredible height of **1,000 feet**! 😳🌍 The fear, suspense, and mystery make this unforgettable moment feel like something out of a movie. But what really happened to this girl? 😨 Did she stay calm, or did something unexpected happen? Watch until the end to discover the shocking moment! 🔥 👍 Like | 🔔 Subscribe | ❤️ Share #ExtremeSwing1000FeetScaryMomentAdrenalineThrillingMysteryExtremeAdventureViralVideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515250/3515250_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T21:35:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>quotes 21</video:title>
      <video:description>quotes geng #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515249/3515249_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T21:34:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love other than yours Episode 6  Hindi dubbed full latest K-drama</video:title>
      <video:description>A Love other than yours Episode Hindi dubbed full latest K-drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515248/3515248_720p.mp4</video:content_loc>
      <video:duration>3861</video:duration>
      <video:publication_date>2026-10-04T21:34:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cry trend on capcut</video:title>
      <video:description>Trend, tiktok, capcut, douyin #Trend #tiktok #capcut #douyin</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515247/3515247_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:33:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hollywood Black Actors Are Richer Than You Think</video:title>
      <video:description>Hollywood Black Actors Are Richer Than You Think #Luxury #Millionaire #Billionaire #Money #Viral #Expensive #Actors #Watches #Celebrities #Boats #Jets #Yachts #TheRichest #KingLuxury #Top10 #ExpensiveThings #MrLuxury #TopLuxury #LuxuryKing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515246/3515246_720p.mp4</video:content_loc>
      <video:duration>2113</video:duration>
      <video:publication_date>2026-10-04T21:32:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Food design</video:title>
      <video:description>Simple very nice clean food arrangements #foodlover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515245/3515245_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T21:32:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gameplay Master Cs Renked</video:title>
      <video:description>Skuy join Mabar...jangan lupa like end komen,🙏 #Gamefirefire</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515244/3515244_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T21:29:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tidak bisa tidur</video:title>
      <video:description>JM 02.24 .mata belum ngantuk . Kenapa ini mata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515243/3515243_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T21:28:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>White gueen</video:title>
      <video:description>#Datealive</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515242/3515242_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T21:26:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean.</video:title>
      <video:description>CAPTAIN PHILLIPS: Tension in the Middle of the Ocean #CaptainPhillips #TomHanks #suspensemovie #thrillermovie #oceanthriller #pirateattack #shiphijacking #hijackedship #cargoship #survivalmovie #seasurvival #oceanattack #maritimethriller #hostagesituation #actionthriller #moviescene #intensemoviescene #Hollywoodmovie #TomHanksmovie #CaptainPhillipsmovie #survivalthriller #piratemovie #seaadventure #mustwatchmovie #viralmovieclip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515241/3515241_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-04T21:25:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515240</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515240/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot; Welcome to the Netherlands 🇳🇱❤️❤️❤️</video:title>
      <video:description>&quot; Welcome to the Netherlands 🇳🇱❤️❤️❤️ #Welcome #to #theNetherlands🇳🇱❤️❤️❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515240/3515240_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-04T21:25:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515239</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515239/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TERKUTUK FILM HOROR INDONESIA TERBARU</video:title>
      <video:description>TERKUTUK FILM HOROR INDONESIA TERBARU #TERKUTUKFILMHORORINDONESIATERBARU</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515239/3515239_720p.mp4</video:content_loc>
      <video:duration>2726</video:duration>
      <video:publication_date>2026-10-04T21:24:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kyunki Saas Bhi Kabhi Bahu Thi 5 October 2026 Full Episode</video:title>
      <video:description>Good #Google</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515238/3515238_720p.mp4</video:content_loc>
      <video:duration>1451</video:duration>
      <video:publication_date>2026-10-04T21:23:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515237</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515237/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Maafi Mang Lo 💔 | Emotional Romantic Song | Roman Urdu Song 2026 | Love &amp; bits Presents</video:title>
      <video:description>🎵 📝 Description ❤️ Love &amp; bits Presents — Maafi Mang Lo ❤️ Ek dil ko chhoo lene wala heart touching romantic song jo mohabbat, judai, regret aur maafi ki kahani bayan karta hai. 💔❤️ “Maafi Mang Lo” ek emotional Roman Urdu love song hai, jismein ek dil apni mohabbat se apni ghalti ki maafi maangta hai aur toote hue rishte ko dobara jorne ki koshish karta hai. 🎵 Song: Maafi Mang Lo 🎤 Style: Professional Human Style ❤️ Genre: Romantic / Emotional 🌙 Language: Roman Urdu 🎬 Presented By: Love &amp; bits 🎧 Music Feel: Soft Piano, Acoustic Guitar, Warm Strings &amp; Cinematic Emotion 💎 Quality: 4K UHD 🎼 Original Song Credits ✍️ Original Lyrics: Love &amp; bits 🎼 Original Composition: Love &amp; bits 🎤 Vocals: Love &amp; bits 🎧 Music Production: Love &amp; bits 🎬 Concept, Editing &amp; Presentation: Love &amp; bits © Copyright Owner: Love &amp; bits Lyrics, composition, music arrangement aur presentation is song ke liye original hain aur Love &amp; bits ki milkiyat hain. Lyrics ka emotional hook: “Maafi mang lo… maafi mang lo, Dil se jo toot gaya, woh jod lo…” Agar aapko heart touching songs, romantic songs, emotional love songs aur Roman Urdu songs pasand hain, to video ko ❤️ LIKE karein, apne friends ke saath SHARE karein aur Love &amp; bits ko SUBSCRIBE karein. 🔔 Subscribe for more original romantic &amp; emotional songs. ⚠️ Copyright Disclaimer © 2026 Love &amp; bits. All rights reserved. Yeh song, iske lyrics, composition, music, vocals, arrangement, artwork aur video presentation Love &amp; bits ka original content hain. Is content ko bina ijazat copy, reproduce, re-upload, distribute, modify, remix, sample ya commercial use karna sakht mana hai. Kisi bhi third-party copyrighted material ka jaan-boojh kar istemal nahi kiya gaya. Agar kisi content owner ko is video se mutalliq koi concern ho, to barah-e-karam Love &amp; bits se rabt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515237/3515237_720p.mp4</video:content_loc>
      <video:duration>293</video:duration>
      <video:publication_date>2026-10-04T21:23:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Romantic Hindi Songs ❤️ | Hindi Love Song | Heart Touching Romantic Music</video:title>
      <video:description>❤️ Romantic Hindi Song – Beautiful Love Song &amp; Heart Touching Hindi Music Enjoy this beautiful romantic Hindi song filled with love, emotion, and soulful melodies. Perfect for anyone who loves romantic Hindi music, heartfelt love songs, and relaxing Bollywood-style melodies. 🎵 Listen, relax, and enjoy the beautiful feeling of love through music. Perfect for: ❤️ Romantic moments 💕 Love and relationship videos 🌙 Relaxing evenings 🎧 Hindi music lovers 💖 Fans of romantic Bollywood-style music Keywords: romantic Hindi song, beautiful love song, heart touching Hindi music, Hindi romantic song, Hindi love song, romantic Hindi music, soulful Hindi song, Bollywood love song, beautiful Hindi song, heart touching love song. #romantichindisong #hindilovesong #romanticsong #beautifullovesong #hearttouchinghindisong #hindiromanticmusic #romantichindimusic #hindisong #hindimusic #lovesong #hearttouchingsong #soulfulhindisong #beautifulhindisong #romanticbollywoodsong #bollywoodlovesong #indianromanticsong #indianlovesong #hindilovemusic #emotionalhindisong #romanticmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515236/3515236_720p.mp4</video:content_loc>
      <video:duration>348</video:duration>
      <video:publication_date>2026-10-04T21:23:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUNKAR _ HOROR INDONESIA TERBARU</video:title>
      <video:description>MUNKAR _ HOROR INDONESIA TERBARU #KeywordSEOmunkar #munkarhoror #malaikatmunkar #kisahmunkar #misterimunkar #hororindonesiaterbaru #ceritahororindonesia #kisahhororterbaru #kisahmistis #ceritamistisindonesia #alamkubur #siksakubur #azabkubur #kisahkematian #misterikematian #kisahseram #ceritaseramterbaru #hororreligi #kisahhororreligi #ceritahororviral #pengalamanmistis #misterialamkubur #malaikatkubur #kisahnyatahoror #horrorindonesia #horormalam #ceritahororterbaru #kisahmengerikan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515235/3515235_720p.mp4</video:content_loc>
      <video:duration>530</video:duration>
      <video:publication_date>2026-10-04T21:22:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Poppy little wtch</video:title>
      <video:description>&quot;Poppy the Little Witch&quot; (Poppy la petite sorcière) is a charming children&apos;s story about a young witch named Poppy who is learning to master her magical powers. ​The Protagonist: Poppy is a kind, curious, and bright young witch who lives in a magical world alongside her clever animal companions. ​The Plot: The story follows Poppy&apos;s daily adventures as she attends magic lessons, learns to fly on her broomstick, and tries to cast spells—which often leads to funny, accidental mishaps. ​The Theme: Through trial and error, Poppy learns important life lessons about patience, friendship, helping others, and believing in herself, showing that making mistakes is just a normal part of growing up.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515234/3515234_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-10-04T21:22:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>رحله متنزه منطقه راجب وفرحه اولادي</video:title>
      <video:description>متنزه عائله عام من أروع متنزاهات منطقة راجب #متنزهمنطقهراجب</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515233/3515233_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-04T21:22:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love other than yours Episode 5 Hindi dubbed full latest K-drama</video:title>
      <video:description>A Love other than yours Episode 5 Hindi dubbed full latest K-drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515232/3515232_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T21:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantic Engagement In Blooming Orchard</video:title>
      <video:description>Romantic engagement scene featuring a couple deeply in love during a beautiful proposal in a blooming orchard. Surrounded by flowering trees and soft natural light, the couple shares genuine emotions as an engagement ring becomes part of their special moment. The picturesque spring landscape creates a dreamy atmosphere for content about marriage proposals, relationships, wedding celebrations, love, happiness, and unforgettable memories. #marriageproposal #romanticcouple #engagement #coupleinlove #proposalmoment #engagementring #romanticproposal #bloomingorchard #springflowers #weddingromance #lovingcouple #romanticmoment #outdoorproposal #relationship #lovestory #weddingengagement #happycouple #springorchard #proposalday #coupleromance #engagementcelebration #weddinginspiration #romanticlove #specialmoment #outdoorromance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515231/3515231_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T21:20:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asteroid heading  to the earth</video:title>
      <video:description>An asteroid heading toward Earth Kamoʻoalewa is an asteroid measuring approximately 20 meters across that is known as Earth&apos;s &quot;quasi-satellite&quot;: it orbits the Sun but remains close to Earth. Some scientists hypothesize that it is a fragment of the Moon ejected during an impact 1–10 million years ago. On July 2, 2026, China&apos;s uncrewed spacecraft Tianwen-2 imaged the object from a distance of about 20 km. However, preliminary data from the James Webb Telescope (currently in preprint) and the images themselves have cast doubt on this hypothesis, so its origins remain uncertain. Samples are scheduled to arrive on Earth in late 2027. #kamooalewa #asteroidserpihanbulan #bulansemu #quasimoon #tianwen-2 #asteroiddekatbumi #kuasisatelit #misteribulan #giordanobruno #asteroidterbaru #faktaangkasa #faktaluarangkasa #astronomi #penemuanterbaru #spacefacts #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515230/3515230_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T21:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E451 3rd October 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E451 3rd October 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515229/3515229_720p.mp4</video:content_loc>
      <video:duration>1349</video:duration>
      <video:publication_date>2026-10-04T21:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E450 2nd October 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E450 2nd October 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515228/3515228_720p.mp4</video:content_loc>
      <video:duration>1326</video:duration>
      <video:publication_date>2026-10-04T21:19:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E449 1st October 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E449 1st October 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515227/3515227_720p.mp4</video:content_loc>
      <video:duration>1330</video:duration>
      <video:publication_date>2026-10-04T21:19:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E448 30th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E448 30th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515226/3515226_720p.mp4</video:content_loc>
      <video:duration>1310</video:duration>
      <video:publication_date>2026-10-04T21:19:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E447 29th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E447 29th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #TumSeTumTakZeetvS01E44729thSeptember2026Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Anu #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515225/3515225_720p.mp4</video:content_loc>
      <video:duration>1380</video:duration>
      <video:publication_date>2026-10-04T21:19:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantic Hindi Song ❤️ | Beautiful Love Song | Heart Touching Hindi Music</video:title>
      <video:description>❤️ Romantic Hindi Song – Beautiful Love Song &amp; Heart Touching Hindi Music Enjoy this beautiful romantic Hindi song filled with love, emotion, and soulful melodies. Perfect for anyone who loves romantic Hindi music, heartfelt love songs, and relaxing Bollywood-style melodies. 🎵 Listen, relax, and enjoy the beautiful feeling of love through music. Perfect for: ❤️ Romantic moments 💕 Love and relationship videos 🌙 Relaxing evenings 🎧 Hindi music lovers 💖 Fans of romantic Bollywood-style music Keywords: romantic Hindi song, beautiful love song, heart touching Hindi music, Hindi romantic song, Hindi love song, romantic Hindi music, soulful Hindi song, Bollywood love song, beautiful Hindi song, heart touching love song. #latesthindiromanticsong #besthindiromanticsong #romanticsongshindi #hindiromanticsongs #hindilovesongs #bestlovesonghindi #romanticindiansong #indianlovesongs #hindimelodysong #hindiemotionalsong</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515224/3515224_720p.mp4</video:content_loc>
      <video:duration>348</video:duration>
      <video:publication_date>2026-10-04T21:18:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Madam, why you lie? You said you were just looking!</video:title>
      <video:description>E be like say market matter no dey finish especially when you talk say you dey just look. This funny encounter for one busy Lagos market stall shows exactly how we dey bargain for Naija. Most traders don experience this kind confusion when customer change mind sharp-sharp. You go see say the way we handle market drama for this 2026 comedy scene is pure vibes. 😂 Rate this customer her serious face 1-10! 👇 #Drama #naijacomedy #marketgist #money #Nollywood #funnyjoke #marketprank</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515223/3515223_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T21:17:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ALAS ROBAN _ HOROR INDONESIA TERBARU</video:title>
      <video:description>Tentu, ini deskripsi yang cocok untuk konten YouTube bertema horor: Deskripsi YouTube — Alas Roban Horor **ALAS ROBAN — HOROR INDONESIA TERBARU** Alas Roban dikenal sebagai salah satu kawasan yang menyimpan banyak cerita mistis dan kisah horor di Indonesia. Di balik jalan yang panjang, hutan yang lebat, dan suasana yang sunyi, beredar berbagai cerita tentang kejadian aneh yang dialami para pengendara maupun orang-orang yang pernah melewati kawasan ini. Dalam video kali ini, kita akan menyelami **kisah horor Alas Roban**, mulai dari pengalaman misterius, penampakan makhluk tak kasatmata, hingga kejadian-kejadian yang sulit dijelaskan dengan logika. ⚠️ **PERINGATAN:** Video ini mengandung cerita horor dan dapat membuat sebagian penonton merasa takut atau tidak nyaman. Disarankan untuk tidak menonton sendirian jika mudah merasa takut. Simak ceritanya sampai selesai dan temukan misteri apa yang sebenarnya tersembunyi di balik **Alas Roban**. #Berikutkeywordyangcocokuntuk“ALASROBAN–HORORINDONESIATERBARU”alasroban #alasrobanhoror #alasrobanangker #misterialasroban #kisahalasroban #ceritahororalasroban #hororindonesiaterbaru #ceritahororindonesia #kisahmistisindonesia #tempatangkerindonesia #hutanangker #jalanangker #kisahnyatahoror #pengalamanmistis #penampakanalasroban #misterihutan #ceritahororterbaru #horormalam #kisahmisteri #urbanlegendindonesia #ceritamististerbaru #horrorindonesia #hororviral #kisahseram #ceritaseram</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515222/3515222_720p.mp4</video:content_loc>
      <video:duration>1890</video:duration>
      <video:publication_date>2026-10-04T21:15:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515221</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515221/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>First Dragon Season 1 Episode 2 In Hindi</video:title>
      <video:description>Enjoy #FirstDragon #Anime #HindiAnime #TeleportAnime #MagicAnime #SoldierAnime #TeleportSoldierAnime #SpiritsAnime #AnotherWorldAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515221/3515221_720p.mp4</video:content_loc>
      <video:duration>1002</video:duration>
      <video:publication_date>2026-10-04T21:15:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MOON SHRINGKING LIKE RAISIN</video:title>
      <video:description>The Moon is shrinking like a raisin! It is shrinking because its interior continues to cool. As the crust contracts, it cracks and buckles, forming stair-like cliffs that are tens of meters high and several kilometers long. NASA&apos;s uncrewed spacecraft, the Lunar Reconnaissance Orbiter, has photographed more than 3,500 of these cliffs. According to NASA, the Moon&apos;s width has decreased by about 50 meters over the last few hundred million years—a process often likened to a grape turning into a raisin. Coming up tomorrow: temperatures on the Moon—daytime heat hotter than boiling water. Subscribe for daily space facts. #bulanmenyusut #bulanmengecil #bulansepertikismis #nasa #lunarreconnaissanceorbiter #lro #tebingbulan #faktabulan #faktaangkasa #faktaluarangkasa #astronomi #faktanasa #moonshrinking #spacefacts #shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515220/3515220_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T21:15:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A better tomorrow</video:title>
      <video:description>short story</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515219/3515219_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:13:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grilled Fish 2</video:title>
      <video:description>Take a short break while eating grilled fish. #Fish #eat #Timorleste #manatuto #trip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515218/3515218_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T21:13:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funniest Cute Animals Compilation 😂🐶🐱 | Try Not to Laugh!</video:title>
      <video:description>Get ready for a dose of happiness! 🐶🐱🐼❤️ Watch this adorable compilation of funny animals, silly moments, cute reactions, and hilarious pet fails that will make your day! From playful puppies to mischievous cats and other adorable animals, these funny moments are guaranteed to put a smile on your face. 😍 Which animal made you laugh the most? Let us know in the comments! 👇 👍 Like, 💬 Comment, and 🔔 Subscribe for more funny and adorable animal videos! #CuteAnimals #FunnyAnimals #AnimalCompilation #FunnyPets #CutePets #TryNotToLaugh #AnimalLovers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515217/3515217_720p.mp4</video:content_loc>
      <video:duration>1707</video:duration>
      <video:publication_date>2026-10-04T21:11:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515216</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515216/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kafir jasad di tolak bumi</video:title>
      <video:description>kafir jasad di tolak bumi #Keywordyangbisadipakaikafir #jasadditolakbumi #jenazahditolakbumi #mayatditolaktanah #jasadtidakhancur #kisahjenazah #kisahkematian #azabkematian #kematianmengerikan #kisahnyata #misterikematian #tandaazab #pelajarankematian #alamkubur #siksakubur</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515216/3515216_720p.mp4</video:content_loc>
      <video:duration>653</video:duration>
      <video:publication_date>2026-10-04T21:11:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nenhuma arma contra ti prosperará</video:title>
      <video:description>Nenhuma arma forjada contra ti prosperará. Ele garante a tua proteção e a tua vitória. Isaías 54:17 Compartilha com quem precisa de ouvir isto hoje. #devocional #palavradedeus #fé #isaías #bíblia #versículododia #proteção Podes usar o mesmo texto no CapCut ou no YouTube. Se for para o modelo do CapCut, diz-me e encurto. #Fé #certezanaaçãodeDeus #alegria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515215/3515215_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T21:10:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Magic Repo Man Dumped by My Party, Ill Cash In With a Cute Support Fairy to Become the Strongest Epi</video:title>
      <video:description>Kashita Maryoku wa Ribobarai de Kyousei Choushuu Youzumi to Party Tsuihousareta Ore wa, Kawaii Support Yousei to Issho ni Toritateta Maryoku wo Unyou shite Saikyou wo Mezasu Episodes 1 Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515214/3515214_720p.mp4</video:content_loc>
      <video:duration>1371</video:duration>
      <video:publication_date>2026-10-04T21:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Mistério do Concreto Romano: Ele se Repara?</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515213/3515213_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T21:09:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Ingrediente Secreto que Parecia um Erro</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515212/3515212_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T21:07:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não Era Mágica: A Verdadeira Receita do Concreto Romano</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515211/3515211_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T21:06:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FUNNY VIDEO 38</video:title>
      <video:description>If you want to find this video funny, laugh and don&apos;t forget to follow and leave a comment about this video, thank you. 🤗 #Comedy #funnyvideo #funny #meme #humor #news #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515210/3515210_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T21:06:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Haiwaan (2026) | Hindi Dubbed Full Movie | Latest South Indian Action Thriller</video:title>
      <video:description>Watch Haiwaan (2026) in Hindi — an intense South Indian action thriller packed with suspense, drama, powerful characters and thrilling action sequences. A gripping story filled with mystery, revenge and unexpected twists. #Haiwaan #HindiDubbed #2026Movie #SouthMovie #Action #Thriller #FullMovie #HindiMovie #LatestMovie #SouthIndian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515209/3515209_720p.mp4</video:content_loc>
      <video:duration>9570</video:duration>
      <video:publication_date>2026-10-04T21:06:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Experimento Chocante Recria Concreto que se Cura</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515208/3515208_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T21:05:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot; Rotterdam#South Holland❤️❤️❤️</video:title>
      <video:description>&quot; Rotterdam#South Holland❤️❤️❤️ #Rotterdam #south #Holland</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515207/3515207_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-04T21:05:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Engenharia Não é Competição: Concreto Antigo</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515206/3515206_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-04T21:04:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como Funciona a Química da Auto-Reparação</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515205/3515205_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T21:03:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Hipótese da Mistura a Quente dos Romanos</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. Fontes principais para consulta Science Advances — Hot mixing: Mechanistic insights into the durability of ancient Roman concrete: https://www.science.org/doi/10.1126/sciadv.add1602 MIT News — Riddle solved: Why was Roman concrete so durable?: https://news.mit.edu/2023/roman-concrete-durability-lime-casts-0106 UC Berkeley Engineering — Researchers shed new light on ancient concrete’s extraordinary durability: https://engineering.berkeley.edu/news/2026/07/researchers-shed-new-light-on-ancient-concretes-extraordinary-durability/ ✅ INSCREVA-SE NO CANAL: https:</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515204/3515204_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T21:02:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Concreto Romano Que Parece Se Reparar</video:title>
      <video:description>Algumas estruturas romanas atravessaram quase dois mil anos, enfrentando chuva, terremotos e até água do mar. O mais curioso é que certas amostras apresentam fissuras preenchidas por novos minerais, como se o próprio material tivesse encontrado uma forma de se reparar. Neste vídeo, investigamos se os romanos realmente criaram um concreto que se cura sozinho. Vamos explicar o papel da cinza vulcânica, da cal, da água do mar, da mistura a quente e dos minerais que podem preencher fissuras finas ao longo do tempo. Também vamos separar o que os estudos científicos realmente mostram dos exageros: o concreto romano não era indestrutível, não existe uma receita única e o autorreparo depende da composição do material, da presença de água e das condições da fissura. A resposta não é mágica. É uma combinação de química, geologia, engenharia e milhares de anos de transformação. Se você gosta de história, ciência e mistérios explicados com evidências, inscreva-se no Além da Evidência e acompanhe as próximas investigações. E até a próxima investigação. Este vídeo foi produzido com apoio de ferramentas de inteligência artificial. A pesquisa, o roteiro, a verificação das informações e a edição são realizados pelo Além da Evidência. #ConcretoRomano #EngenhariaRomana #História #EngenhariaAntiga #Ciência #Arqueologia #ConcretoAutorreparável #MateriaisdeConstrução #ImpérioRomano #AlémdaEvidência</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515203/3515203_720p.mp4</video:content_loc>
      <video:duration>635</video:duration>
      <video:publication_date>2026-10-04T21:01:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jupiter’s Great Red Spot: The Giant Storm</video:title>
      <video:description>Jupiter’s Great Red Spot is a gigantic rotating storm in the planet’s atmosphere. It has been observed for centuries and is wider than Earth, making it one of the Solar System’s most fascinating atmospheric phenomena. #GreatRedSpotJupiterJupiterStormSpaceFactsAstronomyUniverseSpaceSciencePlanetFactsSolarSystemNASACosmicMysteryScienceFactsAmazingUniversePlanetaryScienceSpaceExplorationSpaceShortsYouTubeShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515202/3515202_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T21:01:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ao no Hako Season 2 Episodes 1</video:title>
      <video:description>Please Subscribe my Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515201/3515201_720p.mp4</video:content_loc>
      <video:duration>1540</video:duration>
      <video:publication_date>2026-10-04T21:01:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drishyam: The Conclusion (2026) | Hindi Full Movie | Ajay Devgn | Tabu | Crime Thriller</video:title>
      <video:description>Watch Drishyam: The Conclusion (2026), the final chapter of the gripping Drishyam franchise. Starring Ajay Devgn, Tabu, Shriya Saran and Jaideep Ahlawat, this intense crime mystery thriller brings Vijay Salgaonkar&apos;s story to its ultimate conclusion, filled with suspense, secrets, twists and unexpected turns. #DrishyamTheConclusion #Drishyam3 #2026Movie #AjayDevgn #Tabu #HindiMovie #CrimeThriller #MysteryMovie #Thriller #Bollywood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515200/3515200_720p.mp4</video:content_loc>
      <video:duration>8377</video:duration>
      <video:publication_date>2026-10-04T21:00:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Kitten Watching Rain on Window | Cozy Rainy Day Sleep</video:title>
      <video:description>A tiny tabby kitten watches raindrops fall on the window on a cozy rainy evening. With big curious eyes, the kitten looks outside, then snuggles into a soft blue blanket and falls asleep peacefully by the warm window light. Super cute, calm, and cozy — perfect for relaxing and falling asleep. In this video: 🐱 Adorable tabby kitten by a rainy window 🌧️ Raindrops rolling down the glass 🕯️ Warm cozy light and peaceful evening mood 🧶 Kitten snuggling in a soft knit blanket 😴 Sleepy kitten falling asleep to the rain #cutekittenrain #kittenwatchingrainwindow #cozyrainydaycat #kittensleepingpeacefully #cutetabbykitten</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515199/3515199_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:58:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌳 **Cutting Huge Trees with Powerful Tools! 😲🪵**</video:title>
      <video:description>🌳 **Cutting Huge Trees with Powerful Tools! 😲🪵** Watch as massive tree trunks are cut into pieces using powerful tools and specialized equipment. This impressive job requires great effort, skill, precision, and patience! 💪🪚 See how these workers handle enormous pieces of wood and turn a difficult task into an amazing demonstration of hard work and technology. Would you try this challenging job? Let us know in the comments! 👇 👍 Like | 🔔 Subscribe | ❤️ Share #🌳CuttingHugeTreeswithPowerfulTools😲🪵</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515198/3515198_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T20:58:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animal Sounds Song 🐶🐱🐮 | Fun Learning Song for Toddlers &amp; Preschool Kids</video:title>
      <video:description>Welcome to a fun world of animal friends! 🐶🐱🐮🐰🐥 Animal Sounds for Kids is a fun and educational animal song where toddlers, preschoolers, and young children can sing, dance, and learn the sounds of their favorite animals. Can you bark like a puppy? 🐶 Woof, woof! Can you meow like a kitty? 🐱 Meow, meow! What does a cow say? 🐮 Moo, moo! And can you hear the little bird sing? 🐦 Tweet, tweet! Join our happy animal friends as we meet playful puppies, cute kittens, bouncing bunnies, colorful birds, elephants, ducks, frogs, cows, and more! This cheerful kids song helps young children learn: 🐾 Animal names 🎵 Animal sounds 👏 Rhythm and movement 🗣️ Listening and language skills 🐶 Kindness and caring for animals 🌈 Learning through music and play Clap your hands, stomp your feet, and sing along as we explore the wonderful world of animals! Perfect for toddlers, preschool children, kindergarten kids, families, classrooms, playtime, and early learning at home. Our songs are created to make learning simple, colorful, and fun. Through music, movement, repetition, and adorable animal characters, children can discover new words and sounds while enjoying a happy sing-along adventure. 🎶 Sing along with us: Woof, woof, woof! Meow, meow, meow! Tweet, tweet, tweet! Moo, moo, moo! Quack, quack, quack! Ribbit, ribbit! Which animal sound is your favorite? Keep singing, dancing, learning, and having fun with our animal friends. ❤️ Subscribe for more fun kids songs, nursery rhymes, educational songs, animal songs, toddler learning videos, and preschool adventures! #animalsoundsforkids #animalsoundssong #animalsongforkids #kidssongs #nurseryrhymes #songsforkids #toddlersongs #preschoolsongs #animalsounds #learnanimalsounds #animalsforkids #kidslearningsongs #educationalsongsforkids #toddlerlearning</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515197/3515197_720p.mp4</video:content_loc>
      <video:duration>221</video:duration>
      <video:publication_date>2026-10-04T20:55:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT FOR END 😆</video:title>
      <video:description>Funny video #Comedy #funnyvideo #mytrip #meme #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515196/3515196_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T20:55:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>প্লাস্টিক</video:title>
      <video:description>প্লাস্টিক</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515195/3515195_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T20:55:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Selena Gomez And Benny Blanco Live Behind The Scenes</video:title>
      <video:description>How Selena Gomez And Benny Blanco Live Behind The Scenes #Luxury #Millionaire #Billionaire #Money #Viral #Expensive #Actors #Watches #Celebrities #Boats #Jets #Yachts #TheRichest #KingLuxury #Top10 #ExpensiveThings #MrLuxury #TopLuxury #Luxury #Millionaire #Billionaire #Money #Viral #Expensive #Actors #Watches #Celebrities #Boats #Jets #Yachts #TheRichest #KingLuxury #Top10 #ExpensiveThings #MrLuxury #TopLuxury #LuxuryKing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515194/3515194_720p.mp4</video:content_loc>
      <video:duration>1674</video:duration>
      <video:publication_date>2026-10-04T20:51:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Kung Fu Jungle Girl! 🐯 Riding a Giant Tiger | Prehistoric AI Animation Story</video:title>
      <video:description>Welcome to an epic journey into a mysterious, prehistoric world where nature is the only law! This is the story of &quot;Ira,&quot; a fearless tribal girl who wears clothes made entirely from large jungle leaves and vines. Her best friend and ultimate ride is a massive, royal Bengal tiger named Sheru. To protect their peaceful forest from dark forces, this unique duo begins to train together in the ancient art of Kung Fu and martial arts. Watch how a human girl and a wild tiger team up to unleash an unstoppable combat style! This breathtaking visual story is created using advanced AI animation tools. Don&apos;t miss the thrilling final battle! If you enjoyed this adventure, please Like, Share, and Subscribe to our channel for more epic AI stories! Let us know your thoughts in the comments below. #prehistoricgirlandtiger #leafdresstribalwoman #tigerridingactionscene #aikungfutraining #epicjunglebattle #ancientmartialartsstory #junglegirlwarrior #gianttigercompanion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515193/3515193_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T20:51:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😳 **Would You Trust This Engineering?**</video:title>
      <video:description>😳 **Would You Trust This Engineering?** Some engineering designs look absolutely incredible… until you see what could go wrong! 🤯🏗️ In this fascinating video, we take a closer look at an unbelievable engineering project that will make you question everything you thought you knew about construction, machines, and modern technology. Would you trust this design enough to stand near it? 👀 Watch until the end and decide for yourself! 🔥 👍 Like 🔔 Subscribe ❤️ Share with your friends</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515192/3515192_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T20:50:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angan Ep 2  Hindi dubbed full latest drama</video:title>
      <video:description>Angan Ep Hindi dubbed full latest drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515191/3515191_720p.mp4</video:content_loc>
      <video:duration>2281</video:duration>
      <video:publication_date>2026-10-04T20:48:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny video</video:title>
      <video:description>Funny video #Funnyvideo #funny #meme #comedy #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515190/3515190_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T20:48:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smart Cat 6</video:title>
      <video:description>Smart Cat #Animals</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515189/3515189_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T20:47:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny videos 🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣🤣</video:title>
      <video:description>#funnyfunnyvideosforyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515188/3515188_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T20:46:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Acts 161</video:title>
      <video:description>Acts 161</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515187/3515187_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T20:45:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515186</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515186/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Preview Battle Through The Heavens EPISODE 214</video:title>
      <video:description>Preview Donghua Battle Through The Heavens Season 5, Episode 214 #btth #xiaoyan #donghua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515186/3515186_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T20:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sapi nGamuk</video:title>
      <video:description>Sapi ngamuk #TravelHewan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515185/3515185_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T20:44:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Routines 🎉🎉 putting up beautiful room decorations</video:title>
      <video:description>Routines 🎉🎉 putting up beautiful room decorations #girls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515183/3515183_720p.mp4</video:content_loc>
      <video:duration>190</video:duration>
      <video:publication_date>2026-10-04T20:43:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dela apostolska 161</video:title>
      <video:description>Dela apostolska 161</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515182/3515182_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T20:43:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515181</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515181/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angan Ep 1  Hindi dubbed full latest drama</video:title>
      <video:description>Angan Ep 1 Hindi dubbed full latest drama #Kdramaviraltending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515181/3515181_720p.mp4</video:content_loc>
      <video:duration>2205</video:duration>
      <video:publication_date>2026-10-04T20:43:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you all ❣️😘</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515180/3515180_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T20:39:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot; I Love The Netherlands#Utrecht#🙏🙏❤️</video:title>
      <video:description>I Love The Netherlands#Utrecht#🙏🙏❤️ #I #love #Netherlands</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515179/3515179_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-10-04T20:39:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King 👑 is Bling 👑 2</video:title>
      <video:description>Love you 🤟🏻😘🤟🏻🤟🏻🤟🏻🤟🏻😘😘😘😘😘😘😘</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515178/3515178_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T20:38:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515177</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515177/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Susbcribe 10</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515177/3515177_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T20:37:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515176</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515176/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WOW mind-blowing editing</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515176/3515176_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T20:37:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My first video 25</video:title>
      <video:description>#Just</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515175/3515175_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-10-04T20:36:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dima Maghrib Lion Logo Mugs</video:title>
      <video:description>Dima Maghrib Lion Logo Mugs order here: https://teechip.com/dima-maghrib-lion-logo?retailProductCode=24390940EEB4B2-EEEF8707F782-MSV0-TC1004-WHT #gabby williams #golden state valkyries #wnba #wnbaedit #women&apos;s basketball #basketball #art #kuroko no basket #kuroko&apos;s basketball #belly man #anime #artists on tumblr #bhm gainer #basketballpassingdrills #basketballfundamentals #basketballshootingtips #basketballfootworkdrills #basketballforbeginners #howtodunkabasketball #basketballtryoutstips #basketballdefensetips #basketballgamehighlights #basketballpracticeathome #basketballrulesexplained #nbahighlights #howtoshootabasketball #basketballdefense #basketballoffense #basketballtips #shootingdrills #youthbasketballdrills #ballhandlingdrills #basketballconditioning #basketballtrainingathome #basketballmovesforbeginners #basketballcoachtips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515174/3515174_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T20:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wow 😦😳</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑😍💗😍😍😍😍😍😍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515173/3515173_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T20:35:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515172</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515172/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pusing karna pikiran? Ini cara menyadarinya</video:title>
      <video:description>Cara menyadari pikiran biar tenang dan jaga kesehatan mental #Motivasi #kesadaran #pikiran #kesehatanmental</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515172/3515172_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-10-04T20:35:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515171</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515171/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WOW 😳</video:title>
      <video:description>King 👑 is Bling 👑👑💖👑👑👑👑👑👑👑👑👑👑👑</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515171/3515171_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:34:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WOW 😲😳</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515170/3515170_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:33:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A IGREJA DOS GRITOS..</video:title>
      <video:description>Assustador</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515169/3515169_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-04T20:33:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you bro 💖😘 5</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨💖💖✨💖💖✨💖💖✨</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515168/3515168_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:33:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stylish basketball Fan T-shirt Mugs</video:title>
      <video:description>Stylish basketball Fan T-shirt Mugs order here: https://teechip.com/basketbal-dad?retailProductCode=24390940EEB4B2-6B9A9307F6C6-MSV2-TC1004-WHT #gabby williams #golden state valkyries #wnba #wnbaedit #women&apos;s basketball #basketball #art #kuroko no basket #kuroko&apos;s basketball #belly man #anime #artists on tumblr #bhm gainer #basketballtraining #basketballhighlights #basketballdribblingdrills #howtoplaybasketball #basketballworkout #basketballskills #basketballpassingdrills #basketballfundamentals #basketballshootingtips #basketballfootworkdrills #basketballforbeginners #howtodunkabasketball #basketballtryoutstips #basketballdefensetips #basketballgamehighlights #basketballpracticeathome #basketballrulesexplained #nbahighlights #howtoshootabasketball #basketballdefense #basketballoffense #basketballtips #shootingdrills #youthbasketballdrills #ballhandlingdrills #basketballconditioning #basketballtrainingathome #basketballmovesforbeginners #basketballcoachtips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515167/3515167_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T20:33:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515166</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515166/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What if titanoboa snake 🐍⛎</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨🙏🏻👼🏻🙏🏻👼🏻😊💕💕💕</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515166/3515166_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T20:32:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A VOZ DEBAIXO DA CAMA..</video:title>
      <video:description>Aterroriznte</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515165/3515165_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-04T20:32:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you 🤟🏻😘 2</video:title>
      <video:description>King 👑 is Bling 👑💖👑😍💗😍😍🥰🥰🥰🥰</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515164/3515164_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T20:31:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A CRIANÇA QUE NÃO ESTAVA NO CEMITÉRIO.</video:title>
      <video:description>inesplicável</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515163/3515163_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T20:31:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A day in the life</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨💖💖✨💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515162/3515162_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T20:31:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515161</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515161/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OS TRÊS FAROLEIROS QUE DESAPARECERAM.</video:title>
      <video:description>Assustador</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515161/3515161_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-10-04T20:31:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you girl&apos;s 💓😘</video:title>
      <video:description>King 👑 is Bling 👑👑👑👑👑👑💖💖✨💖💖</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515160/3515160_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T20:30:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot Episode 8 Kdrama in Hindi</video:title>
      <video:description>The Ordinary Jackpot Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515159/3515159_720p.mp4</video:content_loc>
      <video:duration>2770</video:duration>
      <video:publication_date>2026-10-04T20:30:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A FOTOGRAFIA NO TÚMULO.</video:title>
      <video:description>Arquivos malditos</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515158/3515158_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-04T20:30:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Learn the tornado pen 🖋️</video:title>
      <video:description>King 👑 is Bling 👑👑💖💖✨🙏🏻👼🏻🙏🏻👼🏻😊💕💕</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515157/3515157_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T20:30:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515155</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515155/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot Episode 7 Kdrama in Hindi</video:title>
      <video:description>The Ordinary Jackpot Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515155/3515155_720p.mp4</video:content_loc>
      <video:duration>2769</video:duration>
      <video:publication_date>2026-10-04T20:28:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ed Sheeran’s Funniest Stage Moment 😂⚽ | Balancing a Ball on Stage</video:title>
      <video:description>A fun and unexpected stage moment featuring Ed Sheeran showing off his playful side with a football. A memorable and entertaining moment for fans! 🎵⚽😂 #EdSheeran #EdSheeranfunny #EdSheeranlive #EdSheeranconcert #EdSheeranstage #EdSheeranperformance #EdSheeranfootball #EdSheeranfunnymoment #EdSheeranfans #singerperformance #liveconcert #funnyconcertmoment #footballtrick #celebritymoment #musicentertainment️⃣HashtagsEdSheeranEdSheeranLiveEdSheeranConcertEdSheeranFansFunnyMomentConcertLivePerformanceFootballMusicViral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515154/3515154_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-10-04T20:27:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m with the tiger</video:title>
      <video:description>AI content video #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515153/3515153_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T20:26:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot Episode 6 Kdrama in Hindi</video:title>
      <video:description>The Ordinary Jackpot Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515152/3515152_720p.mp4</video:content_loc>
      <video:duration>2676</video:duration>
      <video:publication_date>2026-10-04T20:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m not asking to shake hands—please just get me the hammer.</video:title>
      <video:description>At the beginning of the story, a white cat loses some of its fur and asks an orange cat for help, but the orange cat doesn&apos;t understand. #funnycatcomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515151/3515151_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T20:26:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desi Beautiful Model - Sensational Hot Reel Video</video:title>
      <video:description>Desi Beautiful Model - Sensational Hot Reel Video #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Desire #Sensational #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515150/3515150_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-04T20:25:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BRUNO MELLO E MALUKINHO</video:title>
      <video:description>#Forró #PISEIRO #música</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515149/3515149_720p.mp4</video:content_loc>
      <video:duration>146</video:duration>
      <video:publication_date>2026-10-04T20:25:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>لو الحب لسه موجود… بس الاهتمام اختفى، هتكمّل ولا تمشي؟ 💔.mp4</video:title>
      <video:description>Uploading لو الحب لسه موجود… بس الاهتمام اختفى، هتكمّل ولا تمشي؟ 💔.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515148/3515148_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T20:25:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot Episode 5 Kdrama in Hindi</video:title>
      <video:description>The Ordinary Jackpot Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515146/3515146_720p.mp4</video:content_loc>
      <video:duration>2800</video:duration>
      <video:publication_date>2026-10-04T20:24:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New model 2</video:title>
      <video:description>New model sort video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515145/3515145_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T20:23:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>زبان کا لگا ہوا زخم</video:title>
      <video:description>زبان کا لگا ہوا زخم</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515144/3515144_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T20:23:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 16</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515143/3515143_720p.mp4</video:content_loc>
      <video:duration>4070</video:duration>
      <video:publication_date>2026-10-04T20:21:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 15</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515142/3515142_720p.mp4</video:content_loc>
      <video:duration>4262</video:duration>
      <video:publication_date>2026-10-04T20:21:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 14</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515141/3515141_720p.mp4</video:content_loc>
      <video:duration>4115</video:duration>
      <video:publication_date>2026-10-04T20:21:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 13</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515140/3515140_720p.mp4</video:content_loc>
      <video:duration>4010</video:duration>
      <video:publication_date>2026-10-04T20:21:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 12</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515139/3515139_720p.mp4</video:content_loc>
      <video:duration>4077</video:duration>
      <video:publication_date>2026-10-04T20:21:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 11</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515138/3515138_720p.mp4</video:content_loc>
      <video:duration>3967</video:duration>
      <video:publication_date>2026-10-04T20:21:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 10</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515137/3515137_720p.mp4</video:content_loc>
      <video:duration>3724</video:duration>
      <video:publication_date>2026-10-04T20:21:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 9</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515136/3515136_720p.mp4</video:content_loc>
      <video:duration>4344</video:duration>
      <video:publication_date>2026-10-04T20:21:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 8</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515135/3515135_720p.mp4</video:content_loc>
      <video:duration>3781</video:duration>
      <video:publication_date>2026-10-04T20:21:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 7</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515134/3515134_720p.mp4</video:content_loc>
      <video:duration>4109</video:duration>
      <video:publication_date>2026-10-04T20:21:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 6</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515133/3515133_720p.mp4</video:content_loc>
      <video:duration>4009</video:duration>
      <video:publication_date>2026-10-04T20:20:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 5</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515132/3515132_720p.mp4</video:content_loc>
      <video:duration>3711</video:duration>
      <video:publication_date>2026-10-04T20:20:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 4</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515131/3515131_720p.mp4</video:content_loc>
      <video:duration>3703</video:duration>
      <video:publication_date>2026-10-04T20:20:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aunque tengas miedo, confía en Dios</video:title>
      <video:description>Tema: La fe en los momentos difíciles. #emaLafeenlosmomentosdifícilesPersonajesJesús #PedroylosdiscípulosDuración45–60segundos🎬Escena1LatormentainesperadaNarradorUnanoche #JesúsysusdiscípulosnavegabanporelmarcuandounafuertetormentacomenzóasacudirlabarcaLasolasentrabanyelvientoparecíahundirlosPedrogritando¡Señor #despierta¡Vamosamorir¿NovesqueestamosenpeligroJesúslevantándoseconserenidad¿Porquétienentantomiedo¿Todavíanotienenfe🎬Escena2ElpoderdelafeNarradorJesússelevantóyordenóalvientoyalmarquesecalmaranDeinmediato #latormentadesaparecióyunagrantranquilidadcubriólasaguasPedrosorprendido¿Quiéneseste #quehastaelvientoyelmarleobedecenJesúsNotemasConfíaenmí #inclusocuandonocomprendasloqueestásucediendo🙏ReflexiónfinalNarradorAveces #nuestravidatambiénpareceunatormentaTenemosproblemasfamiliares #dificultadeseconómicas #tristezaymomentosenlosquesentimosqueyanopodemosmásPerorecuerdaDiosnosiemprecalmalatormentainmediatamentetambiénpuededartelafuerzaparaatravesarlaCuandosientasmiedo #oraCuandoestéscansado #confíaYcuandonoencuentresunasalida #nopierdaslafe📖“¿Porquétenéismiedo #hombresdepocafe”—Mateo826MensajefinalSihoyestásatravesandounatormenta #escribe“Señor #confíoenti”🙏❤️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515130/3515130_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-10-04T20:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 3</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515129/3515129_720p.mp4</video:content_loc>
      <video:duration>4111</video:duration>
      <video:publication_date>2026-10-04T20:20:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 2</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515128/3515128_720p.mp4</video:content_loc>
      <video:duration>3827</video:duration>
      <video:publication_date>2026-10-04T20:20:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Demon S1 (K-Drama) HINDI Episode 1</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515127/3515127_720p.mp4</video:content_loc>
      <video:duration>4163</video:duration>
      <video:publication_date>2026-10-04T20:20:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E446 28th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E446 28th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515126/3515126_720p.mp4</video:content_loc>
      <video:duration>1340</video:duration>
      <video:publication_date>2026-10-04T20:20:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny Black Cat Raises Its Paws Like a Tiny Boxer 😂🐈‍⬛</video:title>
      <video:description>This adorable black cat suddenly raises its paws and looks ready for a little fight! 😂🐾 Such a funny and cute moment that will make any cat lover smile. #blackcat #funnycat #cutecat #catvideo #funnyanimal #adorablecat #catlover #cuteanimals #catmeme #funnypets #blackkitten #catreaction #playfulcat #viralcatvideo #funnykitten #petvideo️⃣HashtagsBlackCatFunnyCatCuteCatCatVideoCatLoverFunnyAnimalsCatMemeCuteAnimalsKittenViralCat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515125/3515125_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-10-04T20:20:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours Episode 6 Kdrama in Hindi</video:title>
      <video:description>A Love Other Than Yours Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515124/3515124_720p.mp4</video:content_loc>
      <video:duration>3861</video:duration>
      <video:publication_date>2026-10-04T20:19:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot Desi Shivani Arora - Desire video</video:title>
      <video:description>Hot Desi Shivani Arora - Desire video #Hot #Desi #Beauty #girl #woman #model #best #top #new #sexy #saree #indian #india #arabic #teen #Shivani #Arora #Desire #video #reel #post #fb #insta #ticktok #live #news #trending #viral #vids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515123/3515123_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T20:18:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saúde da mulher</video:title>
      <video:description>Dicas interessantes para a saúde da mulher #Saúdesaúdesaudavel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515122/3515122_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T20:16:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy day 15</video:title>
      <video:description>My trip my everything #Mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515121/3515121_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T20:16:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SINAIS QUE DEUS ESTÁ TE PREPARANDO.....  #motivacional #mensagem</video:title>
      <video:description>Talvez você esteja vivendo o momento mais confuso da sua vida… Nada saiu como você planejou. Portas se fecharam. Pessoas se afastaram. E você começou a se perguntar em silêncio: “Deus… o Senhor ainda está comigo?” Mas e se tudo isso não for rejeição? E se for preparação? #oração #família #Deus #Fé #Jesus #inspiração #superação #bíblia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515120/3515120_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T20:15:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours Episode 5 Kdrama in Hindi</video:title>
      <video:description>A Love Other Than Yours Kdrama Netflix #Kdrama #KoreanDrama #Netflix #Drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515119/3515119_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T20:15:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E445 27th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E445 27th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515118/3515118_720p.mp4</video:content_loc>
      <video:duration>1345</video:duration>
      <video:publication_date>2026-10-04T20:14:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E444 26th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E444 26th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515117/3515117_720p.mp4</video:content_loc>
      <video:duration>1315</video:duration>
      <video:publication_date>2026-10-04T20:14:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak (Zee tv) S01 E443 25th September 2026</video:title>
      <video:description>Anu, a kind 20-year-old, and also Aryavardhan, a steady 45-year-old business owner, elude social standards as well as family members protection, beating battles to display that affection exceeds grow older or even perimeters. Tum Se Tum Tak (Zee tv) S01 E443 25th September 2026 Production Company: zee tv Cast/Actors: Sharad Kelkar:Arya , Niharika Chouksey:Anu Tags: Age Gap, Anu, Arya, Businessman, Family, Google Watch, Hurdles, love, Manipulation, mediaaction, Niharika Chouksey, Opposition, Sharad Kelkar, Society, struggle, Transcends, Tum Se Tum Tak, Zee TV #Anu #akind20-year-old #andalsoAryavardhan #asteady45-year-oldbusinessowner #eludesocialstandardsaswellasfamilymembersprotection #beatingbattlestodisplaythataffectionexceedsgrowolderorevenperimetersProductionCompanyzeetvCastActorsSharadKelkarArya #NiharikaChoukseyAnuTagsAgeGap #Arya #Businessman #Family #GoogleWatch #Hurdles #love #Manipulation #mediaaction #NiharikaChouksey #Opposition #SharadKelkar #Society #struggle #Transcends #TumSeTumTak #ZeeTV</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515116/3515116_720p.mp4</video:content_loc>
      <video:duration>1325</video:duration>
      <video:publication_date>2026-10-04T20:14:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CR7 end era</video:title>
      <video:description>Cristiano Ronaldo leave the Portugal national team #cristianoronaldo #realmadrid #fyp #manchesterunited #portugal #CR7 #CristianoRonaldo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515115/3515115_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-04T20:13:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masih banyak yang lebih capek dari kita, jangan lupa bersyukur guys 🥀😭</video:title>
      <video:description>Masih banyak yang lebih capek dari kita, jangan lupa bersyukur guys 🥀😭 #Forrall</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515114/3515114_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T20:11:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New student becomes number one 2 part1</video:title>
      <video:description>This is just for entertainment, please forgive me if there are similarities in names or anything else.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515113/3515113_720p.mp4</video:content_loc>
      <video:duration>249</video:duration>
      <video:publication_date>2026-10-04T20:10:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coba tulis pesan buat ibu,  Tapi janji jangan nangis yah 🥹</video:title>
      <video:description>Coba tulis pesan buat ibu, Tapi janji jangan nangis yah 🥹 #mymomm</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515112/3515112_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T20:10:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Routines 🎉🎉 Fresh out of the shower, I immediately got all dolled up 💄💋👑 to look stunning</video:title>
      <video:description>Routines 🎉🎉 Fresh out of the shower, I immediately got all dolled up 💄💋👑 to look stunning #girls #girlsroutineslookcute</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515111/3515111_720p.mp4</video:content_loc>
      <video:duration>246</video:duration>
      <video:publication_date>2026-10-04T20:09:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mengenalnya tanpa sengaja, Melupakannya hampir gila 🥀🥹</video:title>
      <video:description>Mengenalnya tanpa sengaja, Melupakannya hampir gila 🥀🥹 #fyppppp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515110/3515110_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T20:09:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny animals 189</video:title>
      <video:description>You can see the live ofsmart dog when his start to do his usually activities at home it funny and educative #Gag</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515109/3515109_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T20:08:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Satu pesan buat ayah🥲</video:title>
      <video:description>Satu pesan buat ayah yang sedang bekerja atau di mana pun #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515108/3515108_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-04T20:08:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hemmm 2</video:title>
      <video:description>Galau dikit nihh #Fypsad</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515107/3515107_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T20:06:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy day 14</video:title>
      <video:description>My happy day #Mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515106/3515106_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T20:04:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atmospheric Sci Fi Ambient Fantasy Music</video:title>
      <video:description>Experience serene and otherworldly soundscape designed for deep study, relaxation, and immersion in atmospheric soundscapes. From ambient and space music to soothing melodies ideal for meditation, each track offers a journey through sci-fi-inspired realms reminiscent of Cyberpunk 2077 and Bladerunner. Whether you seek peaceful background music to enhance focus or dark, futuristic compositions for escape, this selection, crafted by a dedicated composer, invites you to explore the depths of imagination and tranquility. #spacemusiccosmosmusicambientmusicbackgroundmusicrelaxingmusicscifisoundscapemeditationmeditationmusicpeacefulmusiccyberpunk2077cyberpunkbladerunnersoothingsoothingmusicsoftmusicstudymusicstudyfocusmusicfocusstudymotivationsciencefictionmusiccomposerdarkmusicfuturisticmusicescapeambientspace</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515105/3515105_720p.mp4</video:content_loc>
      <video:duration>7149</video:duration>
      <video:publication_date>2026-10-04T20:03:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orang terdekatmu</video:title>
      <video:description>Kebanyakan #Paris #canada #kindomunited</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515104/3515104_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T20:03:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nerve Health &amp; Nerve Function Support Supplement – 60 Capsules</video:title>
      <video:description>NerveSoothe Advanced Nerve Support – 60 Capsules is a dietary supplement formulated to support nerve health and normal nerve function. Its advanced nerve support formula is designed for individuals looking to maintain overall nerve wellness as part of a balanced lifestyle. Key Features: Supports healthy nerve function. Promotes overall nerve wellness. Advanced nerve support formula. Convenient 60-capsule bottle. Easy to incorporate into your daily wellness routine. Disclaimer: This product is a dietary supplement and is not intended to diagnose, treat, cure, or prevent any disease. Follow the product label for usage instructions. https://secure.getnervesoothe.com/index-bp-ds#aff=Mrguyz #nervesoothe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515103/3515103_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T20:03:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O AVIÃO QUE SUMIU DO MAPA</video:title>
      <video:description>assustador</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515102/3515102_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T20:02:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A IGREJA ONDE NINGUÉM QUERIA FICAR.</video:title>
      <video:description>terror</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515101/3515101_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T20:01:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kungfu cat 6</video:title>
      <video:description>Kungfu cat #cat #funny #kungfu #cutecat #funnycat #animal #ai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515100/3515100_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T20:00:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy Day 2</video:title>
      <video:description>Happy day #Mytrip</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515099/3515099_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T19:59:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cat 374</video:title>
      <video:description>Komedy cat funny #funnycatkomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515098/3515098_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T19:59:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Village Life 15</video:title>
      <video:description>Experience a scenic animated story depicting the charm, hard work, and warmth of village life on a rainy day. From working in the muddy rice fields under a sudden monsoon storm to preparing a fresh, comforting meal over a traditional clay stove, this video highlights the beautiful simplicity of rural living #VillageLife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515097/3515097_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-10-04T19:57:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TYRANNOSAURUS REX — THE TRUE KING</video:title>
      <video:description>Length: 12.4m · Weight: 9 tons Bite force: 57,000N — strongest of any land animal ever! #TyrannosaurusDinosaurPaleontology</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515096/3515096_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T19:56:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>moeda 40</video:title>
      <video:description>Moeda antiga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515095/3515095_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T19:54:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I went a rickshaw tour</video:title>
      <video:description>Today i went in main.dhaka for an.emergency work and after a lot of time i went there by rickshaw and.that eas an.amazing journey #Dhaka #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515094/3515094_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:54:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio call cantik</video:title>
      <video:description>Vidio call neng cantik yang bikin ngiler #Vidiocallhot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515093/3515093_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-10-04T19:54:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Road of Avalonian Expedition - Official Cinematic Trailer</video:title>
      <video:description>​Follow the epic tale of a brave warrior battling giant golems, exploring mysterious caves, navigating dark dungeons, and discovering tranquil fantasy landscapes. From dark, fiery grounds to peaceful lotus ponds and vibrant forests, witness an unforgettable journey filled with magic, peril, and hope. ​🔹 Game/Project: Road of Avalonian Expedition 🔹 Genre: Fantasy / Action / Exploration / Cinematic Showcase ​If you enjoyed this cinematic story, don&apos;t forget to Like, Comment, and Subscribe for more updates and epic fantasy adventures! 🎮🔥 ​#RoadOfAvalonianExpedition #AvalonianExpedition #FantasyGame #CinematicTrailer #RobloxShowcase #IndieGame #EpicFantasy #GameTrailer #Fantasyworldshowcase #Robloxaestheticenvironment #3Dactionadventuretrailer #Magicalworldwalkthrough #Fantasygameenvironmentdesign #RobloxRPGshowcase #Cinematicgamestory #VirtualfantasyadventureRoadofAvalonianExpedition #RoadofAvalonianExpeditiontrailer #AvalonianExpedition #Fantasygamecinematic #Robloxfantasytrailer #Robloxcinematicshowcase #Epicwarriorfantasygame #Golembattlegame #FantasyRPGtrailer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515092/3515092_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:54:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relatos reais</video:title>
      <video:description>assustador não assista sozinho.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515091/3515091_720p.mp4</video:content_loc>
      <video:duration>834</video:duration>
      <video:publication_date>2026-10-04T19:52:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freefire 34</video:title>
      <video:description>Freefire gameplay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515090/3515090_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:52:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy dance of nicky</video:title>
      <video:description>https://www.febspot.com/ref/1217291/</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515089/3515089_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:51:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kisah kita</video:title>
      <video:description>#Cinta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515088/3515088_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T19:51:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mar Del Plata Beach A Happy Day</video:title>
      <video:description>Mar Del Plata Beach A Happy Day #Mar #Del #PlataBeach #AHappy #Day</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515087/3515087_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T19:51:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Four Hands, Two Sonatas (2026) Ep 12 Finale - Eng Sub</video:title>
      <video:description>{2026} Four Hands, Two Sonatas _ EP. 12</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515086/3515086_720p.mp4</video:content_loc>
      <video:duration>3708</video:duration>
      <video:publication_date>2026-10-04T19:50:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Never imitate how women talk if you don&apos;t want to experience something like this 🤣</video:title>
      <video:description>funny video #Comedy #funnyvideo #meme #Slapstick #humor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515085/3515085_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T19:47:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You’ll Regret Losing Me 💔 | Sad Revenge Song | Emotional Pop/R&amp;B sad song</video:title>
      <video:description>“You’ll Regret Losing Me” is a powerful sad emotional Pop/R&amp;B song about heartbreak, betrayal, losing someone you loved, and finding the strength to rise again. You thought I would break when you walked away. You thought I would spend my life waiting for you. But sometimes the deepest heartbreak becomes the reason we become stronger. 💔 You broke my heart. 🔥 I found my strength. 🖤 And one day, you’ll regret losing me. If you’ve ever been betrayed, abandoned, or made to feel like you weren’t enough, this song is for you. 🎧 Listen with headphones and feel every emotion. ❤️ Like • 💬 Comment • 🔔 Subscribe to **Songiter Bane** for more sad emotional Pop, R&amp;B, heartbreak, revenge and powerful love songs. #YoullRegretLosingMe #sadrevengesong #emotionalrevengesong #heartbreaksong #sademotionalsong #emotionalpopsong #emotionalRB #sadRBsong #breakupsong #betrayalsong #revengebreakupsong #movingonsong #youbrokemesong #powerfulheartbreaksong #lostlovesong #brokenheartsong #sadlovesong #emotionalmalevocal #deepemotionalmusic #painfullovesong #songsaboutbetrayal #songsaboutmovingon #songsaboutbeinghurt #powerfulemotionalsong #cinematicheartbreaksong #modernPopRB #newemotionalsong2026 #motivationalheartbreaksong #relationshipbreakupsong #SongiterBane</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515084/3515084_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-10-04T19:47:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You’ll Regret Losing Me 💔 | Sad Revenge Song | Emotional Pop/R&amp;B</video:title>
      <video:description>“You’ll Regret Losing Me” is a powerful sad emotional Pop/R&amp;B song about heartbreak, betrayal, losing someone you loved, and finding the strength to rise again. You thought I would break when you walked away. You thought I would spend my life waiting for you. But sometimes the deepest heartbreak becomes the reason we become stronger. 💔 You broke my heart. 🔥 I found my strength. 🖤 And one day, you’ll regret losing me. If you’ve ever been betrayed, abandoned, or made to feel like you weren’t enough, this song is for you. 🎧 Listen with headphones and feel every emotion. ❤️ Like • 💬 Comment • 🔔 Subscribe to **Songiter Bane** for more sad emotional Pop, R&amp;B, heartbreak, revenge and powerful love songs. #YoullRegretLosingMe #sadrevengesong #emotionalrevengesong #heartbreaksong #sademotionalsong #emotionalpopsong #emotionalRB #sadRBsong #breakupsong #betrayalsong #revengebreakupsong #movingonsong #youbrokemesong #powerfulheartbreaksong #lostlovesong #brokenheartsong #sadlovesong #emotionalmalevocal #deepemotionalmusic #painfullovesong #songsaboutbetrayal #songsaboutmovingon #songsaboutbeinghurt #powerfulemotionalsong #cinematicheartbreaksong #modernPopRB #newemotionalsong2026 #motivationalheartbreaksong #relationshipbreakupsong #SongiterBane</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515083/3515083_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-04T19:47:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515082</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515082/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senja indah</video:title>
      <video:description>Senja indah cuma kurang #Sadvibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515082/3515082_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T19:46:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cinematic video 6</video:title>
      <video:description>Cinematic video #Cinematicvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515081/3515081_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:46:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hujan 16</video:title>
      <video:description>Menunggu castemer datang #Cukurrambut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515080/3515080_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:46:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#sadvibes</video:title>
      <video:description>😭😭😭😭 #Sadvibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515079/3515079_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:45:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hero Dives Into The Sea To Free A Turtle</video:title>
      <video:description>While sailing through the Baa Atoll in the Maldives, a boat captain spotted a turtle struggling in the ocean. A passenger quickly grabbed his mask and fins and jumped into the water to help. The exhausted turtle was badly tangled in a fishing net, so he brought it back to the boat where the crew carefully cut the net away. After being freed, the turtle was returned to the ocean and successfully swam away. A beautiful rescue and an important reminder of the danger discarded fishing gear can pose to marine wildlife. #turtle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515078/3515078_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-04T19:45:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kenapa Rezeki Terasa Selalu Kurang?.</video:title>
      <video:description>#shorts #shortsislami #surahattalaq #hikmahkehidupan #pengingatdiri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515077/3515077_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T19:45:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mengajari anak sholat</video:title>
      <video:description>Biasakam mengajari anakmu untuk sholat #Sholat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515076/3515076_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T19:44:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perbaikan jalan raya</video:title>
      <video:description>Perbaikan raya di cor ulang #Proyekjalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515075/3515075_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T19:43:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sunset 108</video:title>
      <video:description>Sunset view</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515074/3515074_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T19:43:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gunung Gayatri - Official Roblox Nature &amp; Exploration Showcase</video:title>
      <video:description>Discover lush tropical forests, peaceful river streams, hidden waterfalls, and beautiful mountain views alongside cute yellow-outfitted adventurers. Take a relaxing walk through nature and experience the calming aesthetic atmosphere! ​🔹 Game/Location: Gunung Gayatri (Roblox) 🔹 Theme: Exploration / Nature Showcase / Aesthetic Adventure ​If you enjoyed this cinematic Roblox journey, please Like, Comment, and Subscribe for more showcase videos! 🎮✨ ​#GunungGayatri #RobloxShowcase #RobloxNature #RobloxAesthetic #RobloxAdventure #VirtualExploration #RobloxIndonesia #Robloxcuteavatars #Robloxtropicalforestmap #AestheticRobloxgame #Robloxscenicview #Robloxworldshowcase #Robloxvirtualnature #Robloxrealisticenvironment #RobloxriverwaterfallmapGunungGayatri #GunungGayatriRoblox #Robloxnatureshowcase #Robloxaestheticenvironment #Robloxhikingtrail #Robloxexplorationvideo #Robloxcinematicshowcase #Robloxlandscapeshowcase #Robloxmountainadventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515073/3515073_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:42:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diving into the waterfall 🥰 #travel #hagiangloop #waterfall</video:title>
      <video:description>Diving into the waterfall 🥰 #travel #hagiangloop #waterfall #Diving #into #thewaterfall #travel #hagiangloop #waterfall</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515072/3515072_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T19:42:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sad ending 😩</video:title>
      <video:description>He had tried repeatedly to start the machine but could not, and finally the machine had to end up in the fireplace. 🤭 #Comedy #funnyvideo #meme #funny #Slapstick</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515071/3515071_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T19:41:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 Powerful K-Pop Group Choreography | Insane Dance Performance</video:title>
      <video:description>A high-energy K-pop dance performance featuring powerful moves, synchronized choreography, and dynamic stage moments. From dance practice to live performance, the energy is incredible! 🔥🎶 #kpop #k-pop #kpopdance #kpopchoreography #kpopgroup #groupdance #danceperformance #dancepractice #synchronizeddance #koreanpop #koreandance #idolperformance #livestage #stageperformance #powerfulchoreography #energeticdance #dancevideo #kpopfans #viraldance #trendingkpop️⃣HashtagsKpopKPopDanceKpopChoreographyDancePracticeGroupDanceDancePerformanceKpopGroupKoreanPopStagePerformanceKpopFans</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515070/3515070_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:40:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Air terjun 14</video:title>
      <video:description>Udah lama gak sini, Minggu depan kayaknya gasin dong kesini👍😍 #Airterjun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515069/3515069_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:40:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>First Dragon Season 1 Episode 1 In Hindi</video:title>
      <video:description>Enjoy #FirstDragon #Anime #HindiAnime #SpiritsAnime #AnotherWorldAnime #TeleportAnime #MagicAnime #SoldierAnime #TeleportSoldierAnime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515068/3515068_720p.mp4</video:content_loc>
      <video:duration>953</video:duration>
      <video:publication_date>2026-10-04T19:38:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asmr styrofoam plastic glass</video:title>
      <video:description>Asmr glass plastic styrofoam #Asmr #asmrglass #plasticasmr #glassplasticasmr #asmrshorts #asmrrelaxing #asmrsatisfying #asmrsleep #asmr2026 #asmrcrinkles #styrofoamplastic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515067/3515067_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T19:37:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mesin</video:title>
      <video:description>pabric</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515066/3515066_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T19:37:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Expedition Ketenangan - Official Fantasy Environment Showcase</video:title>
      <video:description>Embark on a peaceful journey into the magical world of Expedition Ketenangan! 🌿✨ ​Discover serene forests, glowing flora, mystical waterfalls, and tranquility hidden deep within enchanted lands. Relax as you explore vibrant nature scenes designed to bring true peace and calm to your mind. ​🔹 Title: Expedition Ketenangan 🔹 Genre: Fantasy / Relaxation / Nature Exploration ​If you enjoyed this serene fantasy showcase, please Like, Comment, and Subscribe for more magical world explorations! 🍃✨ ​#ExpeditionKetenangan #FantasyWorld #RelaxingEnvironment #GameEnvironment #CinematicTrailer #NatureExploration #Tranquility #ExpeditionKetenangan #ExpeditionKetenanganvideogame #Relaxingfantasyenvironment #Tranquilnaturewalkthrough #Mysticalforestshowcase #Peacefulgamescenery #Cinematicfantasylandscape #Serenegameenvironment #Magicforestexploration</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515065/3515065_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:37:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belum top speed</video:title>
      <video:description>Inova 2kd #Inovatoyota</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515064/3515064_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T19:37:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 Crocodile Challenge Gone WILD! 🐊😱 She Finished the ENTIRE Course! 💪🔥</video:title>
      <video:description>🔥 Crocodile Challenge Gone WILD! 🐊😱 She Finished the ENTIRE Course! 💪🔥 #Viral #Trending #Trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515063/3515063_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:35:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 11th</video:title>
      <video:description>Lovely act #Nextcomingup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515062/3515062_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-10-04T19:35:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>homes</video:title>
      <video:description>house</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515061/3515061_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:35:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wibawa</video:title>
      <video:description>Sangat mengesankan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515060/3515060_720p.mp4</video:content_loc>
      <video:duration>255</video:duration>
      <video:publication_date>2026-10-04T19:35:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cool Lovely act</video:title>
      <video:description>😭😭😭😭 #😒😘</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515059/3515059_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T19:34:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>driver 4</video:title>
      <video:description>tyota</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515058/3515058_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:34:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 10th</video:title>
      <video:description>Nice #Lovelyact</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515057/3515057_720p.mp4</video:content_loc>
      <video:duration>130</video:duration>
      <video:publication_date>2026-10-04T19:33:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terikat janji full</video:title>
      <video:description>Berisi film #Film</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515056/3515056_720p.mp4</video:content_loc>
      <video:duration>3010</video:duration>
      <video:publication_date>2026-10-04T19:33:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 9th</video:title>
      <video:description>Nice #Lovelyact</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515055/3515055_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-10-04T19:32:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Till The End Of The Moon EP 14 Hindi DubbedNew Chinese Drama</video:title>
      <video:description>यह चैनल उन लोगों के लिए है जो चाहते हैं ड्रामा, इमोशन और सस्पेंस एक साथ। यहाँ आपको मिलेंगी बेहतरीन हिंदी शॉर्ट फिल्में और डब्ड चाइनीज़ ड्रामे, जो दिल को छू जाएँ और दिमाग को हिला दें! हर एपिसोड में मिलेगा रोमांच, जज़्बात और ज़िंदगी का एक नया रंग। उच्च गुणवत्ता वाले विजुअल्स, जबरदस्त एक्टिंग और ऐसी कहानियाँ जो आपको अंत तक बाँधकर रखें! 💥 रोज़ नए एपिसोड 🎬 सच्चे जज़्बात, पूरा मनोरंजन ❤️ रोमांस, इमोशन और फैंटेसी से भरपूर कहानी 🔔 सब्सक्राइब करें और घंटी दबाएँ – ताकि आपका अगला पसंदीदा एपिसोड मिस न हो! Till the End of the Moon Till the End of the Moon एक शानदार चीनी फैंटेसी, रोमांटिक और ऐतिहासिक ड्रामा है, जिसमें प्यार, बलिदान, जादू, किस्मत और अच्छाई-बुराई के बीच एक रोमांचक जंग देखने को मिलती है। कहानी एक ऐसी दुनिया की है जहाँ एक शक्तिशाली दानव देवता पूरी दुनिया को तबाह करने की कगार पर होता है। भविष्य को बचाने के लिए एक बहादुर युवती अतीत में वापस जाती है, ताकि उस इंसान की जिंदगी बदल सके जो आगे चलकर विनाश का कारण बनने वाला है। लेकिन जैसे-जैसे वह उसके करीब आती है, दोनों के बीच नफरत, गलतफहमियों और संघर्ष के बावजूद एक अनोखा रिश्ता बनने लगता है। प्यार और किस्मत की यह कहानी उन्हें ऐसे फैसलों के सामने खड़ा कर देती है, जहाँ एक तरफ पूरी दुनिया का भविष्य है और दूसरी तरफ उनका दिल। #KDrama #KDramaEdit #KoreanDrama #KDramaLover #KoreanSeries #KDramaAddict #ViralKDrama #KDramaClips #KDramaRomance #RomanticKDrama #KDramaCuteMoments #KDramaSadScene #KDramaAction #KDramaFunny #FacebookReels #TrendingReels #ViralVideo #FBReels #WatchNow #MustWatch #KDramaLoversKDramaLover #KDramaScene #KDramaStory #KoreanDramaClips #BestKDramaScenes #KDramaMoments #KDramaReels #KDramaHighlights #DramaClips #EmotionalScene #KDramaStatus #SadKDrama #PlotTwist #KDramaShorts #HindiDubbedKDrama #HindiDubbed #UrduDubbed #KDramaInHindi #DramaHouse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515054/3515054_720p.mp4</video:content_loc>
      <video:duration>3344</video:duration>
      <video:publication_date>2026-10-04T19:32:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jelig</video:title>
      <video:description>oilkit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515053/3515053_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T19:32:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Decorative tea cups and kettle set</video:title>
      <video:description>Decorative tea cups and pot set #cupandkettleset #useful #subscribe #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515052/3515052_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:32:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wali - Yank</video:title>
      <video:description>fingerstyle cover #fingerstyle #alifbata #wali #yank</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515051/3515051_720p.mp4</video:content_loc>
      <video:duration>161</video:duration>
      <video:publication_date>2026-10-04T19:32:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen</video:title>
      <video:description>Nice one #Lovely</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515050/3515050_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-10-04T19:32:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>noodle</video:title>
      <video:description>foody</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515049/3515049_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:31:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quranic verse 2</video:title>
      <video:description>Quranic verse</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515048/3515048_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T19:30:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Return of the dominate queen 7th</video:title>
      <video:description>Nice #Sweet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515047/3515047_720p.mp4</video:content_loc>
      <video:duration>115</video:duration>
      <video:publication_date>2026-10-04T19:30:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>foody</video:title>
      <video:description>eatss</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515046/3515046_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:30:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 KIM JINWOO | Powerful Stage Performance</video:title>
      <video:description>An energetic K-pop dance performance featuring synchronized choreography, powerful movements, and an amazing stage atmosphere. The crowd and colorful LED visuals make this performance even more exciting! 🔥🎶 #kpop #k-popdance #kpopperformance #danceperformance #groupchoreography #kpopchoreography #synchronizeddance #stageperformance #koreandance #idolperformance #liveperformance #dancestage #kpopconcert #amazingchoreography #powerfuldance #dancecover #kpopfans #koreanpop #entertainment #viraldance️⃣HashtagsKpopKPopDanceDancePerformanceKpopChoreographyGroupDanceStagePerformanceKpopConcertDanceKoreanPopViralDance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515045/3515045_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T19:29:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Men will always give in to women, even if they are right.😭</video:title>
      <video:description>The man punished his woman for the first time, but the woman did not want to be punished and even though the man finally punished her, the man then apologized and persuaded her not to be angry for too long. #Funnyvideo #comedy #humor #Slapstick #meme</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515044/3515044_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:29:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bride 40</video:title>
      <video:description>The Bride</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515043/3515043_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:29:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>라떼는 말이야 (ratte-neun mariya)</video:title>
      <video:description>I&apos;m a musician from Indonesia who loves turning lyrics into music. This is my latest experimental K-Pop project — hope you guys love it! #Newsongs #KPopeksperimental #musicdigital #originalsongs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515042/3515042_720p.mp4</video:content_loc>
      <video:duration>183</video:duration>
      <video:publication_date>2026-10-04T19:29:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TôO NA VELOCIDADE MAXIMA NO GT RIVALS!</video:title>
      <video:description>RANK B é muito bom com dooge #GTRIVALS</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515041/3515041_720p.mp4</video:content_loc>
      <video:duration>138</video:duration>
      <video:publication_date>2026-10-04T19:28:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prayer for well-being in this world and the Hereafter.</video:title>
      <video:description>Prayer for well-being in this world and the Hereafter.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515040/3515040_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T19:28:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lovex3 (2026) Ep 8 - Eng Sub</video:title>
      <video:description>Lovex3 Episode 8</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515039/3515039_720p.mp4</video:content_loc>
      <video:duration>3311</video:duration>
      <video:publication_date>2026-10-04T19:28:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fortk</video:title>
      <video:description>karton</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515038/3515038_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T19:27:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doa2 buat diri kita sendiri</video:title>
      <video:description>Semoga djabahh 🤲😇</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515037/3515037_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-10-04T19:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Most Beautiful Names of Allah</video:title>
      <video:description>The Most Beautiful Names of Allah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515036/3515036_720p.mp4</video:content_loc>
      <video:duration>196</video:duration>
      <video:publication_date>2026-10-04T19:26:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>carss 3</video:title>
      <video:description>cargo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515035/3515035_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:25:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bebas 3</video:title>
      <video:description>Populerrr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515034/3515034_720p.mp4</video:content_loc>
      <video:duration>233</video:duration>
      <video:publication_date>2026-10-04T19:24:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>my friends 2</video:title>
      <video:description>famiys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515033/3515033_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T19:23:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>house</video:title>
      <video:description>home</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515032/3515032_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T19:22:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dive into You (2026) Ep 4 - Eng Sub</video:title>
      <video:description>EP. 4 DIVE INTO YOU (2026) _ ENG SUB _ Romance_Comed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515031/3515031_720p.mp4</video:content_loc>
      <video:duration>3697</video:duration>
      <video:publication_date>2026-10-04T19:22:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>santai boys</video:title>
      <video:description>driver</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515030/3515030_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T19:21:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qui luta</video:title>
      <video:description>Um ótimo filme 👍</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515029/3515029_720p.mp4</video:content_loc>
      <video:duration>209</video:duration>
      <video:publication_date>2026-10-04T19:20:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kekasih 2</video:title>
      <video:description>Sangat menarik penonton</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515028/3515028_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T19:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>drama cinta</video:title>
      <video:description>reformasi everprosper episod.13</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515027/3515027_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-10-04T19:20:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam ali 453</video:title>
      <video:description>Imam ali 453</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515026/3515026_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T19:19:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR INK</video:title>
      <video:description>Best asmr ink #Asmr #ink #asmrrelaxing #asmrshorts #asmrsatisfying #inksoundinkasmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515025/3515025_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:19:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>See thea old videos</video:title>
      <video:description>...</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515024/3515024_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:19:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam reza 02</video:title>
      <video:description>Imam reza 02</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515023/3515023_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-04T19:19:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam ali 087</video:title>
      <video:description>Imam ali 087</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515022/3515022_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T19:18:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meluk kucing</video:title>
      <video:description>Sowett</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515021/3515021_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other than Yours (2026) Ep 6 in Hindi</video:title>
      <video:description>A.Love.Other.Than.Yours.S01E06</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515020/3515020_720p.mp4</video:content_loc>
      <video:duration>3860</video:duration>
      <video:publication_date>2026-10-04T19:17:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Let&apos;s eat 2</video:title>
      <video:description>Enjoy eating sandwich #breadsupportpositivemind</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515019/3515019_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T19:17:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alam yg indah 5</video:title>
      <video:description>Indahnya ciptaannya #Travel #alam #indah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515018/3515018_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T19:17:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam family 056</video:title>
      <video:description>Imam family 056</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515017/3515017_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T19:17:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam ali 034</video:title>
      <video:description>Imam ali 034</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515016/3515016_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-04T19:16:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515015</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515015/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantis 9</video:title>
      <video:description>Soswett</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515015/3515015_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T19:16:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onça pintada ataca sucuri verde</video:title>
      <video:description>Onça pedra sucuri verde no meio do Pantanal #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515014/3515014_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T19:16:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flying bagpack 02</video:title>
      <video:description>Flying bagpack 02</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515013/3515013_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-10-04T19:16:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>shakira#trendiing #for #shakira</video:title>
      <video:description>shakira#trendiing #for #shakira #shakiratrendiingforshakira</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515012/3515012_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T19:15:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lord Krishna 06</video:title>
      <video:description>Lord Krishna 06</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515011/3515011_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T19:14:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Slip 😂😂</video:title>
      <video:description>#Comedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515010/3515010_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T19:14:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cooking 97</video:title>
      <video:description>Food n cook</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515009/3515009_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-04T19:14:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar terbang part 2</video:title>
      <video:description>Berusaha belajar terbang lagi kembali tapi dengan hal yang sama yang terjadi #belajarterbangkejadianunikfypviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515008/3515008_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T19:13:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lord Krishna 05</video:title>
      <video:description>Lord Krishna 05</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515007/3515007_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T19:13:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Takdir tak pernah ku pilih</video:title>
      <video:description>Takdir tak pernah ku pilih #Takdirtakpernahkupilih</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515006/3515006_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T19:13:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Masarakat maju</video:title>
      <video:description>Mendukung masarakat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515005/3515005_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T19:13:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smartwatch s11</video:title>
      <video:description>Smartwatch</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515004/3515004_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T19:12:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Something Huge Was Hiding Inside This Underwater Wreck… 🐟🌊</video:title>
      <video:description>A diver explores a mysterious underwater wreck when a massive reef fish suddenly appears from the darkness. Stay until the final reveal. #underwater #ocean #reeffish #scubadiving #marinelife #shipwreck #wildlife #oceanexploration #underwateradventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515003/3515003_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:12:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senyum bhgia</video:title>
      <video:description>Tentram</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515002/3515002_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>reels viral • Waiting For Her... ❤️ | Ultra-Realistic Cinematic AI Video</video:title>
      <video:description>&quot;Something special is about to happen today... because she is finally arriving!&quot; ❤️ Experience a beautiful cinematic love story created using advanced AI technology. A boy waits patiently by his motorcycle on a quiet, tree-lined road during the golden hour, anticipating the arrival of his love. Watch how the magic unfolds in this ultra-realistic story. Don&apos;t forget to like, comment, and subscribe for Part 2! 🔔 #AIlovestorypart1 #RomanticAIvideo #CinematicAIshortfilm #AIvideogeneration #UltrarealisticAIvideo #RomanticmotorcyclerideAI #WaitingforherAIstory #Goldenhourcinematicvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515001/3515001_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T19:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3515000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3515000/3515000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Little Hand, A Big Fight 🤍</video:title>
      <video:description>Those tiny hands are going through a tough time. 💔 Stay strong, little one. May you recover soon and smile again. 🙏🤍 #People #blog #Family</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3515000/3515000/3515000_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:11:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mayor tedi 2</video:title>
      <video:description>Sangat dpuji banyak orang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514999/3514999_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-04T19:11:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>online earning this app 2026 62</video:title>
      <video:description>If you&apos;re looking for online earning this platform is for you</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514998/3514998_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T19:11:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New Kokborok Viral Video l Traditional Viral Video</video:title>
      <video:description>Visit My Site Properly 👇👇👇 https://youtube.com/shorts/OzZCDxm42u4?si=3s0VQaaMnXmoFDCT #viralshortMusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514997/3514997_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:10:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melodilagu 3</video:title>
      <video:description>Melodilagu #uwuo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514996/3514996_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:10:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What would you do if you were in that man&apos;s position? 🤭</video:title>
      <video:description>What would you do if you were in that man&apos;s position?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514995/3514995_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T19:10:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mayor tedi</video:title>
      <video:description>Gagah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514994/3514994_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T19:10:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nyore</video:title>
      <video:description>Matahari terbenam #Senjamatahari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514993/3514993_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:09:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Latihan 2</video:title>
      <video:description>Tni</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514992/3514992_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-04T19:09:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Apapun itu</video:title>
      <video:description>Lekas membaik #Paris #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514991/3514991_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:08:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Gravity Tears a Star Apart</video:title>
      <video:description>In extreme binary systems, powerful gravity can pull material away from a nearby white dwarf or other compact star. As the objects spiral closer together, their interaction can produce incredible bursts of energy and gravitational waves. #GravityWhiteDwarfNeutronStarBinaryStarsStarCollisionGravitationalWavesSpaceFactsAstronomyUniverseSpaceScienceCosmicMysteryDeepSpaceAstrophysicsScienceFactsAmazingUniverseSpaceExplorationSpaceShortsYouTubeShorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514990/3514990_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T19:08:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gak kalah jauh sama canada</video:title>
      <video:description>Kejadian #Paris #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514989/3514989_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T19:07:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Hungry Wolf and the Clever Bird</video:title>
      <video:description>An exciting adventure between a ferocious wolf and a species of wild chicken. #worldwide</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514988/3514988_720p.mp4</video:content_loc>
      <video:duration>730</video:duration>
      <video:publication_date>2026-10-04T19:07:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Агент Джонни Инглиш. Перезагрузка</video:title>
      <video:description>Агент Джонни Инглиш. Перезагрузка #АгентДжонниИнглишПерезагрузка</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514987/3514987_720p.mp4</video:content_loc>
      <video:duration>6081</video:duration>
      <video:publication_date>2026-10-04T19:06:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Poto breng</video:title>
      <video:description>Akrap 2 kerabat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514986/3514986_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T19:06:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melodilagu NIKE Ardilla</video:title>
      <video:description>Hiburan melodi gitar #uwuo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514985/3514985_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T19:06:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>online earning this app 2026 61</video:title>
      <video:description>If you&apos;re looking for online earning this platform is for you</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514984/3514984_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:06:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514983</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514983/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CROSSWIND🌬️ Emirates Boeing 777-300ER landing at Brussels Airport</video:title>
      <video:description>CROSSWIND🌬️ Emirates Boeing 777-300ER landing at Brussels Airport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514983/3514983_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T19:06:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata 41</video:title>
      <video:description>#Perjalanan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514982/3514982_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T19:05:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pelantikan</video:title>
      <video:description>Mayor tedi jdi wakil prabowo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514981/3514981_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:04:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other than Yours (2026) Ep 6 - Eng Sub</video:title>
      <video:description>🇰🇷EP. 6 A LOVE OTHER THAN YOURS (2026) _ ENG SUB</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514980/3514980_720p.mp4</video:content_loc>
      <video:duration>3860</video:duration>
      <video:publication_date>2026-10-04T19:04:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>online earning this app 2026 60</video:title>
      <video:description>If you&apos;re looking for online earning this platform is for you</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514979/3514979_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T19:04:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>International presentation</video:title>
      <video:description>The young lady were touched the Hart of people #Global</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514978/3514978_720p.mp4</video:content_loc>
      <video:duration>392</video:duration>
      <video:publication_date>2026-10-04T19:03:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pidato prabowo</video:title>
      <video:description>Pidato buat masa depan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514977/3514977_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T19:03:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bernyanyi 9</video:title>
      <video:description>Bernyanyi embo opo iku #Nyanyi #bernyani #lagu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514976/3514976_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T19:03:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 58</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514975/3514975_720p.mp4</video:content_loc>
      <video:duration>1210</video:duration>
      <video:publication_date>2026-10-04T19:02:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Miyu Ootori</video:title>
      <video:description>Ootori Miyu #vlog #song #Ootorimiyu #jav</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514974/3514974_720p.mp4</video:content_loc>
      <video:duration>262</video:duration>
      <video:publication_date>2026-10-04T19:02:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Don&apos;t skip, let&apos;s count down</video:title>
      <video:description>Cute Kid’s Hilarious Reaction!#Funny #Comedy #Viral #Trending #FunnyVideo #搞笑 #搞笑视频 #爆笑 #热门 #开心一刻 #LOL #Hilarious #爆款 #FunnyMoments #沙雕 #Short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514973/3514973_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:02:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beat deluxe</video:title>
      <video:description>keren apa kurang keren #motorcycle</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514972/3514972_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T19:01:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of duty 25</video:title>
      <video:description>#callofduty #callofdutymw4 #newcallofduty #callofduty2026 #callofdutynews #callofduty2027 #nextcallofduty #everycallofduty #callofdutysbmm #ragecallofduty #rantcallofduty #callofdutyeomm #toxiccallofduty #callofdutynext #callofdutywarzone #callofdutyfuture #callofdutyreboot #callofdutychanges #callofdutymobile #hackingcallofduty #callofdutygameplay #futureofcallofduty #cheatingcallofduty #callofdutycampaign #activisioncallofduty #callofdutysettings</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514971/3514971_720p.mp4</video:content_loc>
      <video:duration>1252</video:duration>
      <video:publication_date>2026-10-04T19:01:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Latihan tni</video:title>
      <video:description>Kompak bersama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514970/3514970_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T19:01:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>asasuu</video:title>
      <video:description>temen lanknat #France</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514969/3514969_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T19:00:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Let&apos;s Go to the Zoo! 🦁🐘🐒 | Animal Sounds Song for Kids | Fun Nursery Rhymes</video:title>
      <video:description>Come along on a fun musical adventure to the zoo! 🌈 Meet friendly lions, elephants, monkeys, tigers, penguins and giraffes while singing, dancing, jumping, clapping and learning animal sounds together! 🐒🐯🐧🦒 🎵 Roar like a lion! 🐘 Stomp like an elephant! 🐒 Jump like a monkey! 🐧 Waddle like a penguin! 🦒 Stretch like a giraffe! This fun and catchy animal song is made for toddlers, preschoolers and young children who love animals, music and dancing. Perfect for: ✨ Kids sing along ✨ Animal sounds ✨ Preschool learning ✨ Toddler activities ✨ Nursery rhymes ✨ Kids dance time ✨ Fun family entertainment 🎶 Sing • Dance • Clap • Jump • Learn! 🎶 Subscribe for more original kids songs, nursery rhymes, animal songs and fun educational music! #Kidssongs #Animalsongs #NurseryRhymes #Animalsounds #Kidsmusic #Songsforkids #ToddlerSongs #PreschoolSongs #Zooanimals #nursery</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514968/3514968_720p.mp4</video:content_loc>
      <video:duration>173</video:duration>
      <video:publication_date>2026-10-04T19:00:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514967</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514967/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagu country</video:title>
      <video:description>Lagu country viral #Lagucountry #wadeforster</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514967/3514967_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T19:00:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bhgiakan masarakat</video:title>
      <video:description>KDM bagja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514966/3514966_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T19:00:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hahaha 57</video:title>
      <video:description>semangat #France</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514965/3514965_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T18:59:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hausa song</video:title>
      <video:description>The young baby were mining song #Global</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514964/3514964_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-10-04T18:59:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib 4</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514963/3514963_720p.mp4</video:content_loc>
      <video:duration>491</video:duration>
      <video:publication_date>2026-10-04T18:59:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orang paling di takuti timoty</video:title>
      <video:description>#edukasi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514962/3514962_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T18:59:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tugas Penjagaan Alat berat</video:title>
      <video:description>#Sukabumi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514961/3514961_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T18:59:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meet a sexy female ghost 😆</video:title>
      <video:description>At first, I was brave, but in the end I was scared and ran away 😂😉😆 #Funnyvideo #comedy #funny #entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514960/3514960_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T18:57:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 52</video:title>
      <video:description>Vidio lucu #UnitedStatesturkeyindia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514959/3514959_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T18:57:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours ep 6 Hindi dubbed K-drama</video:title>
      <video:description>A love other than yours episode 6 Hindi dubbed K-drama #Romance #melodrama #childhoodfriends #friendstolovers #K-drama #Hindidubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514958/3514958_720p.mp4</video:content_loc>
      <video:duration>3861</video:duration>
      <video:publication_date>2026-10-04T18:57:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan lalu lintas</video:title>
      <video:description>#Asian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514957/3514957_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T18:56:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Religi 5</video:title>
      <video:description>Tour</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514956/3514956_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T18:56:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toxic A Fairy Tale for Grown-ups (2026) Hindi Full Movie</video:title>
      <video:description>Toxic A Fairy Tale for Grown-ups (2026) Hindi Full Movie #ToxicAFairyTaleforGrown-ups2026HindiFullMovienewmovieviralvideoToxicAFairypart2ToxicAFairymovie2</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514955/3514955_720p.mp4</video:content_loc>
      <video:duration>10987</video:duration>
      <video:publication_date>2026-10-04T18:54:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The comebeck 😂🤣</video:title>
      <video:description>#life</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514954/3514954_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T18:54:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib 3</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514952/3514952_720p.mp4</video:content_loc>
      <video:duration>350</video:duration>
      <video:publication_date>2026-10-04T18:53:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat in mushola</video:title>
      <video:description>The cat joins the sholawat #FYP #Cat #Funny #ShortVideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514951/3514951_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T18:52:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bermain 17</video:title>
      <video:description>Bermain #Permainan #bermain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514950/3514950_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T18:52:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night 18</video:title>
      <video:description>Riding ninght #motorsepeda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514949/3514949_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T18:52:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Let me sleep... I&apos;m still in my peel</video:title>
      <video:description>Let me sleep... I&apos;m still in my peel #Ai #animation #viral #trending #funnyfruit #trendingvideo #Asmr #village #villagelife</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514948/3514948_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T18:52:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>বান্ধবী কেমন আছো</video:title>
      <video:description>বান্ধবী আমাকে কেমন লাগে</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514947/3514947_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:51:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você lembra desse desenho Nostalgia Pura</video:title>
      <video:description>Quem aí passava as manhãs colado na TV assistindo a esses clássicos? Vamos relembrar os desenhos animados mais icônicos dos anos 80 e 90 que marcaram a nossa infância. Deixe nos comentários qual era o seu favorito e qual faltou nessa lista!#desenhosantigos #anos90 #anos80 #nostalgia #desenhoanimado #infancia #shorts #Anos80 #Anos90 #Antigo #Objetos #objetosantigos #Colecionador #Infancia #retro #Antigamente #Nostalgia #colecionar #Diversão #Saudade #infancia90 #infancia80 #velhostempos #CoisasDosAnos90 #GeraçãoX #Millennials #CulturaPop #ColeçõesShortsBrasil #desenho #desenhoantigo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514946/3514946_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-04T18:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chhota Bheem &amp; Mighty Little Bheem Adventure in Ladduverse | Full Video | King Shahapur Tv Kids</video:title>
      <video:description>Chhota Bheem &amp; Mighty Little Bheem Adventure in Ladduverse | Full Video | King Shahapur Tv Kids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514945/3514945_720p.mp4</video:content_loc>
      <video:duration>1946</video:duration>
      <video:publication_date>2026-10-04T18:50:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vidio lucu 79</video:title>
      <video:description>Rawon gank</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514944/3514944_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T18:50:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sejarah kisah Tiongkok kuno</video:title>
      <video:description>Kisah sejarah kerajaan Tiongkok kuno #sejarahtiongkokfyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514943/3514943_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T18:50:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Little girl happy</video:title>
      <video:description>Little girl play and feel so happy with the music #Indonesia #littlegirl #happy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514942/3514942_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T18:50:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Newst</video:title>
      <video:description>Newst</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514941/3514941_720p.mp4</video:content_loc>
      <video:duration>264</video:duration>
      <video:publication_date>2026-10-04T18:49:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>File It picked the wrong window to look through. 🌧️👀A rainy night. A little roadside store. The cha</video:title>
      <video:description>#FileItpickedthewrongwindowtolookthrough🌧️👀ArainynightAlittleroadsidestoreThechamp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514940/3514940_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T18:49:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>newst</video:title>
      <video:description>News</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514939/3514939_720p.mp4</video:content_loc>
      <video:duration>161</video:duration>
      <video:publication_date>2026-10-04T18:48:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 57</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514938/3514938_720p.mp4</video:content_loc>
      <video:duration>1206</video:duration>
      <video:publication_date>2026-10-04T18:48:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby food feeding bottle with spoon</video:title>
      <video:description>Baby food feeding bottle with spoon #foodfeedingbottle #useful #subscribe #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514937/3514937_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T18:48:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fun vidio 2</video:title>
      <video:description>Kesusu ngeh puron</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514936/3514936_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:47:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Le best</video:title>
      <video:description>Voilà le old et le new #Old #new #ice #fun #cool</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514935/3514935_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-04T18:47:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 51</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514934/3514934_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T18:46:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relaxed Woman Enjoying Sunny Morning At Home With Coffee</video:title>
      <video:description>Elegant brunette woman in a rose-colored silky robe enjoys her first coffee while standing beside an open apartment window. Bright morning sunlight fills the room as she smiles and admires the cityscape outside. The peaceful lifestyle moment combines luxury, comfort, relaxation, and simple morning pleasures. Ideal for stock footage related to coffee, self-care, morning routines, beautiful homes, urban lifestyle, wellness, and positive daily habits. #brunettewoman #morningcoffee #silkyrobe #roserobe #cityview #apartmentwindow #sunnymorning #coffeecup #morningroutine #urbanlifestyle #womansmiling #elegantwoman #longhair #homerelaxation #cozymorning #selfcare #coffeetime #cityscape #naturalsunlight #peacefulmorning #stylishwoman #luxurylifestyle #relaxingathome #morningsunlight #modernapartment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514933/3514933_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T18:46:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>crianças sinceras</video:title>
      <video:description>#mundo #criancas #risada #brasil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514932/3514932_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-04T18:46:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib 2</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514931/3514931_720p.mp4</video:content_loc>
      <video:duration>376</video:duration>
      <video:publication_date>2026-10-04T18:44:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Laila hailaulah</video:title>
      <video:description>Tiada Tuhan yang berhak disembah selain Allah. Semoga hati kita selalu teguh dalam iman dan selalu mengingat-Nya. 🤲 #TurkiChinarusiaingrisBelanda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514930/3514930_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-04T18:44:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>malas</video:title>
      <video:description>mantappp!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514929/3514929_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T18:43:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Portugal Vs Argentina World Cup 2027</video:title>
      <video:description>ronaldo #ronaldo #football #messi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514928/3514928_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T18:43:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic video surat kausar 3</video:title>
      <video:description>Quran majeed Islamic video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514927/3514927_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:43:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours ep 5 Hindi dubbed 2</video:title>
      <video:description>A love other than yours episode 5 Hindi dubbed K-drama 2026 (ongoing drama) A love other than yours episode 5 Hindi dubbed K-drama 2026 (ongoing drama) #AloveotherthanyoursHindidubbed #Hindidubbed #childhoodfriends #friendstolovers #K-drama #Koreandramahindidubbed #drama #romance #melodrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514926/3514926_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T18:43:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rubbish demand</video:title>
      <video:description>Value of a goods should be standard before asking for a high price #Romance</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514925/3514925_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T18:42:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story 146</video:title>
      <video:description>Keputusan terberat ku adalah memutuskan masa depan ku esok harus bagaimana #Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514924/3514924_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T18:42:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic video surat kausar 2</video:title>
      <video:description>Quran majeed Islamic video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514923/3514923_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:42:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kalimah Tauhid</video:title>
      <video:description>لَا إِلٰهَ إِلَّا اللَّهُ Tiada Tuhan yang berhak disembah selain Allah. Semoga hati kita selalu teguh dalam iman dan selalu mengingat-Nya. 🤲 #AmericaindinpakistanBrunaiSiangapuraArabsaudiPrancis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514922/3514922_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T18:39:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😯😳 Easy Prompt App ✈️ | Realistic Airplane Runway Acceleration</video:title>
      <video:description>A stunning ultra-realistic passenger airplane accelerates down a modern airport runway before takeoff. Powerful engines, realistic heat distortion, blinking lights, natural sunlight, and cinematic camera movement create an exciting aviation experience. ✈️🔥 #airplaneacceleration #airplanerunway #passengeraircraft #commercialairplane #airportrunway #aviationvideo #airplaneengine #takeoff #pretakeoff #realisticaircraft #cinematicairplane #internationalairport #photorealistic #ultrarealistic #aviationcinematic #EasyPromptApp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514921/3514921_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:39:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Airport juanda</video:title>
      <video:description>Bandara juanda #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514920/3514920_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T18:38:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ikan chana auranti</video:title>
      <video:description>semangat progres ikan dari kecil #hobi #ikan #progre</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514919/3514919_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:38:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 50</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514918/3514918_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T18:38:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514917/3514917_720p.mp4</video:content_loc>
      <video:duration>295</video:duration>
      <video:publication_date>2026-10-04T18:37:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny videohttps://tinyurl.com/2s4hjmt9</video:title>
      <video:description>https://tinyurl.com/2s4hjmt9 #httpstinyurlcom2s4hjmt9</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514916/3514916_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T18:35:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Just talking music</video:title>
      <video:description>Islamic music refers to musical works that are created in line with Islamic teachings and ethics. It usually contains beautiful lyrics that praise Allah, tell stories of the prophets, encourage doing good deeds, and remind people of kindness, patience, and gratitude. Many Islamic songs use soft melodies and focus more on meaningful words rather than loud instruments. It is loved by many people around the world because it inspires goodness and brings calmness to the soul. #Trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514915/3514915_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-10-04T18:35:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start up episode 6 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514914/3514914_720p.mp4</video:content_loc>
      <video:duration>4904</video:duration>
      <video:publication_date>2026-10-04T18:33:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belajar terbang</video:title>
      <video:description>Hiburan belajar terbang memakai sapu #belajarterbanghiburanlucufyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514913/3514913_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T18:31:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 16 hindi</video:title>
      <video:description>W – Two Worlds Ep 16 hindi #W–TwoWorldsEp16hindiviralvideokdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514912/3514912_720p.mp4</video:content_loc>
      <video:duration>3490</video:duration>
      <video:publication_date>2026-10-04T18:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bela ibu di pesta kuliah kaya dari kerang ajaib episode 2</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514911/3514911_720p.mp4</video:content_loc>
      <video:duration>317</video:duration>
      <video:publication_date>2026-10-04T18:28:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sex porn teen</video:title>
      <video:description>Excitement and suspense #Global #foradults18</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514910/3514910_720p.mp4</video:content_loc>
      <video:duration>704</video:duration>
      <video:publication_date>2026-10-04T18:28:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 49</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514909/3514909_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T18:28:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wowwww 6</video:title>
      <video:description>Watch till end.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514908/3514908_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T18:27:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bayi gemess</video:title>
      <video:description>Baby #Babylucu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514907/3514907_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-10-04T18:27:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANOTHER CRABS THEASURE: olha só 1 desafio e posso usar latinhas para defender</video:title>
      <video:description>ANOTHER CRABS THEASURE: olha só 1 desafio e posso usar latinhas para defender, lega demais #Ninja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514906/3514906_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-10-04T18:26:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pqrt13</video:title>
      <video:description>Pak boy #Katakata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514905/3514905_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-10-04T18:26:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#lovestory 2</video:title>
      <video:description>#All</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514904/3514904_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T18:26:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 15 hindi</video:title>
      <video:description>W – Two Worlds Ep 15 hindi #W–TwoWorldsEp15hindiviralvideoW–TwoWorldsEp15hindi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514903/3514903_720p.mp4</video:content_loc>
      <video:duration>3507</video:duration>
      <video:publication_date>2026-10-04T18:25:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gamas network</video:title>
      <video:description>Gamas gamas #network</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514902/3514902_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T18:24:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mom my love</video:title>
      <video:description>I love mom #Love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514901/3514901_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T18:24:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fakta Unik tentang Kalender yang Jarang Diketahui!</video:title>
      <video:description>Sedikit fakta mengenai kalender yang mungkin kita belum tahu. #fakta #kelender #faktaunik #faktamenarik #masehi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514900/3514900_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-04T18:24:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Part12</video:title>
      <video:description>Sanset #Sorehari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514899/3514899_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T18:24:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Haus!</video:title>
      <video:description>Haus! #Drink</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514898/3514898_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T18:23:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 14 hindi</video:title>
      <video:description>W – Two Worlds Ep 14 hindi #W–TwoWorldsEp14hindiviralvideoW–TwoWorldsEp14hindi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514897/3514897_720p.mp4</video:content_loc>
      <video:duration>3469</video:duration>
      <video:publication_date>2026-10-04T18:21:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic video surat kausar</video:title>
      <video:description>Quran majeed Islamic video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514896/3514896_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:21:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>জীবনে যত কঠিন সময় আসুক না কেন,#calloftamim</video:title>
      <video:description>জীবনে যত কঠিন সময় আসুক না কেন,#calloftamim</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514895/3514895_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T18:21:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan Skip! Kucing Ini Punya Tingkah yang Bikin Gemas! 2</video:title>
      <video:description>Kamu pasti senyum lihat tingkahnya! 😻 Tapi… coba tebak apa yang terjadi berikutnya? You can&apos;t watch this without smiling! 😻 But… can you guess what happens next? 👀 #KucingLucu #KucingGemoy #LucuBanget #KucingIndonesia #funnyCat #CuteCat #CatVideo #CatLovers #FunnyPets #ViralCats #FYPTrending #可爱 #猫咪 #萌宠 #猫咪视频 #搞笑 #宠物日常 #热门</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514894/3514894_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T18:21:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 48</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514893/3514893_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T18:21:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night vibe 2</video:title>
      <video:description>Night view #Nightvibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514892/3514892_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T18:20:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Агент Джонни Инглиш 3.0 (2018)</video:title>
      <video:description>Агент Джонни Инглиш 3.0 (2018) #АгентДжонниИнглиш302018</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514891/3514891_720p.mp4</video:content_loc>
      <video:duration>5313</video:duration>
      <video:publication_date>2026-10-04T18:18:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coughing When the Weather Changes Here’s Why?</video:title>
      <video:description>#WeatherChangeCough #DryCoughRemedy #HealthTips Video Description Do you start coughing as soon as the season shifts or the temperature drops? You&apos;re not alone! In this video, we break down why weather changes trigger persistent coughing, throat irritation, and chest congestion—and what you can do about it. #weatherchangecough #whydoicoughwhenweatherchanges #seasonalcoughcauses #coughingincoldweather #seasonalallergiescough #coldairthroatirritation #drycoughremedy #suddentemperaturechangecough #coughwhenseasonschange #weathershiftsorethroat #whyseasonalcoughhappens #dryaircoughrelief #wintercoughcauses #bronchitisweatherchange #autumncoughremedies #homeremediesforweathercough #soothethroatchangeofweather #allergicbronchitissymptoms #coldweatherbreathingirritation #seasonalchestcongestion #howtostopweathercough #throatticklecoldair #naturalcoughrelief #weathersensitivitycough #protectlungscoldweather #nightcoughtemperaturedrop #seasonalasthmaflareup #airhumiditycough #throatinflammationweather #coughtreatmenttips</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514890/3514890_720p.mp4</video:content_loc>
      <video:duration>474</video:duration>
      <video:publication_date>2026-10-04T18:18:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 13hindi</video:title>
      <video:description>W – Two Worlds Ep 13hindi #W–TwoWorldsEp13hindiviralvideoW–TwoWorldsEp13</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514889/3514889_720p.mp4</video:content_loc>
      <video:duration>3523</video:duration>
      <video:publication_date>2026-10-04T18:18:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zombie lagi takut</video:title>
      <video:description>Ada wabah zombie sedang berkumpul lagi ketakutan tapi malah berubah #Zombie</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514888/3514888_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T18:18:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tentou enganar o patrão</video:title>
      <video:description>Tentou enganar o patrão</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514887/3514887_720p.mp4</video:content_loc>
      <video:duration>163</video:duration>
      <video:publication_date>2026-10-04T18:18:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devolvió la joya y recibió una recompensa que cambió su vida</video:title>
      <video:description>#Devolviólajoyayrecibióunarecompensaquecambiósuvida💍❤️Cap2Alejandrorecuperóelanil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514886/3514886_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-10-04T18:17:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semoga fyp ya</video:title>
      <video:description>#Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514885/3514885_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T18:17:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata mutiara 33</video:title>
      <video:description>Menjadi piatu pulang tanpa pelukan Menjadi Yatin piatu pulang tanpa siapa siapa #Katakatamutiara</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514884/3514884_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T18:16:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como vai patrão</video:title>
      <video:description>Como vai patrão</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514883/3514883_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-10-04T18:15:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chocolatdessert that makes a sensatlon every time! One trick makes the difference</video:title>
      <video:description>Ingredients melted dark chocolate: 400 g-4 0z) sponge tingers: 4 pe eggs: 2 pe corn starch: 50 g (1.8 oz) sugar: 50 g (1.8 oz) lemon: 1 pc milk: 1 |(34 pt) condensed milk: 100 g (3.5 oz) white chocolate: 2 pc sugar: 150 g (5.3 oz) lemon: 1 pc milk: 1 |(34 pt) condensed milk: 100 g (3.5 oz) white chocolate: 2 pc sugar: 150 g (5.3 oz) #‎‎dessert #cook #cookrate #Ingredients #biscuits #Nutella #milk #whippingcream #powderedsugar #cocoa #darkchocolate #milkchocolate‎</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514882/3514882_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-10-04T18:15:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rela ibu di pesta kuliah kaya dari kerang ajaib</video:title>
      <video:description>#pengikut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514881/3514881_720p.mp4</video:content_loc>
      <video:duration>428</video:duration>
      <video:publication_date>2026-10-04T18:15:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sport 79</video:title>
      <video:description>Walking</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514880/3514880_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T18:14:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rimpiendo la calle</video:title>
      <video:description>Nuevo tema</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514879/3514879_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-10-04T18:14:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deep Relaxation Facial &amp; Face Therapy for Sleep</video:title>
      <video:description>relax, unwind, and melt into deep sleep with this ultra-relaxing ASMR facial and face therapy session. Designed specifically to trigger intense tingles and melt away anxiety, this video combines soothing personal attention with crisp, satisfying skincare sounds. Put on your headphones 🎧, close your eyes, and let the gentle triggers guide you into a peaceful night&apos;s rest. #facial #relax #ASMR #Facetherapy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514878/3514878_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-10-04T18:13:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kribo parkir</video:title>
      <video:description>Apa yang sedang anda pikirkan #Semuaorang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514877/3514877_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T18:13:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VAI DESCENDO - Slowed</video:title>
      <video:description>#abdodata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514876/3514876_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T18:13:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FULL HOUSE=풀하우스 EP 14</video:title>
      <video:description>DORAMA 16 EP: EP 14 #doramas #dorama #drama #doramanetflix #doramasnetflix #melhoresdoramas #truebeautydorama #resumendedoramas #doramasdubladosem #ondeassistirdoramas #belezaverdadeiradorama #doramadubladonetflix #cdrama #kdrama #shortdrama #koreandrama #dramacoreano #newdrama #melhoresdoramasdanetflix #shortsdrama #shortdramas #belezaverdadeiradoramanetflix #chinesedrama #asiandrama #dramaresumen #ohmydramas #minidrama #freeshortdrama #revengedrama #dramaseries #dramareview #bestdramas #chinesedramas</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514875/3514875_720p.mp4</video:content_loc>
      <video:duration>3735</video:duration>
      <video:publication_date>2026-10-04T18:13:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 12 hindi</video:title>
      <video:description>W – Two Worlds Ep 12 hindi #W–TwoWorldsEp12hindiviralvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514874/3514874_720p.mp4</video:content_loc>
      <video:duration>3577</video:duration>
      <video:publication_date>2026-10-04T18:12:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funniest Farm Animals 10</video:title>
      <video:description>hese hootin&apos; &amp; hollerin&apos; animals thought they&apos;d find a nice pasture to graze on the farm...little did they know, they&apos;d only find fresh FAILS! 😹🐮 #cuteanimal #anabul #funnything #happy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514873/3514873_720p.mp4</video:content_loc>
      <video:duration>1213</video:duration>
      <video:publication_date>2026-10-04T18:12:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 47</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514872/3514872_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T18:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing marah</video:title>
      <video:description>#Kucing #kucinglucu #kucingmarah #kucinggemoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514871/3514871_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T18:11:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mills Enzo FG white/gold</video:title>
      <video:description>MILLS ENZO FG FOOTBALL SHOES UPPER: MILLS EXOSKIN is a microfiber shoe upper technology that is lightweight, strong, and can hug / provide maximum protection to the foot, designed for players with high mobility. STABILITY: MILLS REINF INTERCROSS is a technology on the outsole of MILLS football shoes like a foundation / cross construction located in the middle part. This technology prevents the shoe from twisting or prevents the player&apos;s foot from injury and provides additional strength and protection from the heel to the middle of the shoe. SOLE-PLATE RESPONSIVE: MILLS LETHAL SPIN is a stud technology that allows maneuvers at the pivot point more easily and quickly, providing full control in performing sharp maneuvers, changing direction quickly, and stability on the field. #football #sepakbola #soccer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514870/3514870_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T18:11:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funniest Pets of 2026 😂 BEST Animal Videos</video:title>
      <video:description>The funniest animals of 2025 are ready to make you laugh, so hit play and enjoy! #cuteanimal #funniest #dog #fun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514869/3514869_720p.mp4</video:content_loc>
      <video:duration>1822</video:duration>
      <video:publication_date>2026-10-04T18:11:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>modeling 5</video:title>
      <video:description>genz and fashion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514868/3514868_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T18:11:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wisata 7</video:title>
      <video:description>Keliling Borobudur dengan BMW jadul #Travel #Borobudur #BMW #Healing #Refresing #Pedesaan #udarasegar #bergembira #ceria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514867/3514867_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T18:09:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Kehidupan Desa: Tenang, Sederhana, dan Bahagia”</video:title>
      <video:description>Kehidupan desa.damai dan bahagia #Kehidupanpedesaan #suasanadesa #sunrise</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514866/3514866_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T18:06:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yamal 10</video:title>
      <video:description>Lamine Yamal nasceu em Esplugues de Llobregat, Barcelona, de pai marroquino e mãe equato-guineense. Cresceu em Granollers e Mataró. Quando tinha sete anos, sua família mudou-se para Barcelona onde jogou pela base do Club de Fútbol La Torreta, e no mesmo ano foi notado pelos olheiros do Barcelona ao marcar um hat-trick numa partida organizada pelos blaugranase logo se juntou a La Masia #LamineYamalBarcelona</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514865/3514865_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-04T18:05:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAMURAI</video:title>
      <video:description>Built a samurai from copper wire #Artwork #art #samurai #japan #USA #fyp #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514864/3514864_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T18:04:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan Skip! Kucing Ini Punya Tingkah yang Bikin Gemas!</video:title>
      <video:description>Kamu pasti senyum lihat tingkahnya! 😻 Tapi… coba tebak apa yang terjadi berikutnya? 👀 You can&apos;t watch this without smiling! 😻 But… can you guess what happens next? 👀 #KucingLucu #KucingGemoy #LucuBanget #KucingIndonesia #FunnyCat #CuteCat #CatVideo #CatLovers #FunnyPets #ViralCats #FYP #Trending #可爱 #猫咪 #萌宠 #猫咪视频 #搞笑 #宠物日常 #热门</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514863/3514863_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-04T18:04:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 45</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514862/3514862_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T18:02:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 11 hindi</video:title>
      <video:description>W – Two Worlds Ep 11 hindi #W–TwoWorldsEp11hindiviralvideoW–TwoWorldsEp11</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514861/3514861_720p.mp4</video:content_loc>
      <video:duration>3586</video:duration>
      <video:publication_date>2026-10-04T18:02:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wahai Tuhanku Aku bukanlah Ahli surga</video:title>
      <video:description>Aku bukanlah ahli surga, hanya seorang hamba yang penuh kekurangan. Semoga setiap langkah, doa, dan taubatku menjadi jalan menuju ridha Allah. 🤲 #AmericaindiaPakistansingapuraBrunai</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514860/3514860_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T18:00:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why is Mr. Krabs willing to do anything for money? 💰</video:title>
      <video:description>Why is Mr. Krabs willing to do anything for money? 💰 #SpongeBob #SpongeBobSquarePants #Cartoon #movie #Funny #trending #usa #america #animation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514859/3514859_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T17:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start Up episode 5 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514858/3514858_720p.mp4</video:content_loc>
      <video:duration>4950</video:duration>
      <video:publication_date>2026-10-04T17:59:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 10 hindi</video:title>
      <video:description>W – Two Worlds Ep 10 hindi #W–TwoWorldsEp10hindiviralvidioW–TwoWorldsEp10</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514857/3514857_720p.mp4</video:content_loc>
      <video:duration>3655</video:duration>
      <video:publication_date>2026-10-04T17:57:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mobile legend 25</video:title>
      <video:description>momen julian savage #mobilelegend #mlbb #julian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514856/3514856_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T17:56:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Survey berbayar 2</video:title>
      <video:description>Lumayan lulus survenya #SurveyCuanRecehan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514855/3514855_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T17:56:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A beautiful woman intends to clean the roof tiles when it is raining heavily but instead slips down </video:title>
      <video:description>A beautiful woman was actually laying roof tiles during heavy rain and slipped and fell, but luckily she was saved by her female friend. #Rooftiles #house #stairs #repairs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514854/3514854_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:55:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;He took ONE pineapple.... and destroyed the whole warehouse! 🍋🍍💥&quot;</video:title>
      <video:description>The ultimate fruit avalanche domino effect. 🍋🌊🍍 # #FruitAvalanche #DominoEffect #3DAnimation #UnexpectedMoments #ChaosIn3D</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514853/3514853_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:54:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love you more Celine</video:title>
      <video:description>Pretty girl #Love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514852/3514852_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T17:53:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI animation video of banana fruit</video:title>
      <video:description>No more drama of bruised fruit in the fridge. Simple yet life-changing. #general</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514851/3514851_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-10-04T17:53:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 46</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514850/3514850_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T17:53:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orang ini lagi meminta memohon</video:title>
      <video:description>orang lagi meminta mohon kepada tuhanya agar hidup lebih baik lagi karna banyak yang mengalami penyesalan pada masa hidupnya #Gayahidup</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514849/3514849_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:53:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start Up episode 4 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514848/3514848_720p.mp4</video:content_loc>
      <video:duration>4846</video:duration>
      <video:publication_date>2026-10-04T17:53:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💔💔💔 4</video:title>
      <video:description>Gasspollll #France</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514847/3514847_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T17:51:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>novelas de frutas 2</video:title>
      <video:description>Reencontro dos desconhecidos Parte 7 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514846/3514846_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-10-04T17:51:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivacional 86</video:title>
      <video:description>Nunca desista #Fé</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514845/3514845_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-10-04T17:51:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Good evening friends, who likes flowers?</video:title>
      <video:description>Good evening friends, who likes flowers? #Flowers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514844/3514844_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T17:51:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bruna Rafaela de França 23</video:title>
      <video:description>Boa música #BrunaRafaeladeFrança</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514843/3514843_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-10-04T17:50:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bruna Rafaela de França 22</video:title>
      <video:description>Vamos ouvir #Boamúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514842/3514842_720p.mp4</video:content_loc>
      <video:duration>156</video:duration>
      <video:publication_date>2026-10-04T17:50:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kontraktor vs konsultan</video:title>
      <video:description>beda gambar, beda kondisi lapangan, langsung panas? Padahal kuncinya bukan cari siapa yang salah-tapi komunikasi, klarifikasi, dan solusi. Pernah mengalami konflik seperti ini di proyek? #Proyek #tekniksipil #infrastruktur #kontraktor #konsultan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514841/3514841_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T17:49:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minum cofy Coklat dan susu perpaduan</video:title>
      <video:description>Nikmatnya minum secangkir copy coklat susu,perpaduan yang nikmat ,lezat dan menjadi candu atau penggemar berat bisa ngurangi selera makannya sekian #Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514840/3514840_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T17:49:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cb nyeni</video:title>
      <video:description>Cb modifikasi motorcycle modification #Motor #motorcycle #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514839/3514839_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T17:49:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bruna Rafaela de França 21</video:title>
      <video:description>Música linda #Viagempelomúsica</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514838/3514838_720p.mp4</video:content_loc>
      <video:duration>335</video:duration>
      <video:publication_date>2026-10-04T17:49:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 9 hindi</video:title>
      <video:description>W – Two Worlds Ep 9 hindi #W–TwoWorldsEp9hindiviralvidiokgrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514837/3514837_720p.mp4</video:content_loc>
      <video:duration>3568</video:duration>
      <video:publication_date>2026-10-04T17:49:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Ronaldo Could Have Scored… But He Chose to Assist ❤️🐐 | The Humble Side of CR7”</video:title>
      <video:description>“He could have scored… but Cristiano Ronaldo chose to pass. And that tells you everything about the man behind the legend. 🐐❤️” Cristiano Ronaldo is known for his goals, incredible finishing, and unbelievable ability to change a game. But sometimes, his greatest moments aren&apos;t the ones where he scores. They&apos;re the moments when he chooses to pass. Even when he has the ability to take the shot himself, Ronaldo has repeatedly created opportunities for his teammates, putting the team&apos;s success ahead of his own statistics. That is the side of Ronaldo that doesn&apos;t always get enough attention. Because being a great player isn&apos;t only about how many goals you score. It&apos;s also about how many teammates you inspire, how many chances you create, and how much confidence you give the people around you. A goal may make you a hero for a moment. But helping your teammate score can make the entire team stronger. That&apos;s not selfishness. That&apos;s leadership. That&apos;s Cristiano Ronaldo. 🇵🇹🐐 Behind the records, trophies, and legendary goals is a player who understands one simple thing: Football is a team game. ❤️⚽ #CristianoRonaldoassists #Ronaldoselflessmoments #CristianoRonaldoteamwork #Ronaldoleadership #CR7assists #CristianoRonaldopassing #Ronaldohelpingteammates #Ronaldoteamplayer #CristianoRonaldohumble #Ronaldoinspirationalmoments #Ronaldobestassists #CristianoRonaldohighlights #CR7motivation #Ronaldofootballskills #CristianoRonaldolegend #RonaldoGOAT #footballteamwork #footballmotivation #soccerteamwork #soccerlegend #Portugalfootball #Ronaldofans #CR7Forever</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514836/3514836_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-10-04T17:48:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Umbrella with air blower for summer</video:title>
      <video:description>Umbrella with air blower for summer #umbrella #useful #subscribe #short</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514835/3514835_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T17:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LAMINE YAMAL BIKIN 3 PEMAIN ATLETICO KELABAKAN! 😱🔥</video:title>
      <video:description>Satu pemain, dikepung beberapa pemain Atletico, tapi Yamal tetap tenang membawa bola! 😮‍💨⚽ Skill, kecepatan, dan keberaniannya benar-benar luar biasa. Apakah Yamal bakal jadi salah satu pemain terbaik dunia? 👑 #LamineYamal #YamalBarcelona #skillLamineYamal #YamalvsAtleticoMadrid #aksiYamal #dribblingYamal #skillBarcelona #BarcelonavsAtleticoMadrid #pemainmudaterbaik #wonderkidBarcelona #footballskills #soccerskills #LaLiga #viralsepakbola</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514834/3514834_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T17:46:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>lghting</video:title>
      <video:description>night #konvoi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514833/3514833_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-10-04T17:45:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>breuy</video:title>
      <video:description>Sruivs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514832/3514832_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T17:45:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>And last letter of your name ?</video:title>
      <video:description>Bobo thought he was just asking Granny a simple question… but Granny had a completely unexpected answer 😂 Watch until the end — you won&apos;t see that coming! 👵 Granny + 👦 Bobo = chaos every time. What would YOU say if your grandma said this? 😂 #funnygranny #grandmahumor #grandmareaction #funnygrandmareaction #grandsongrandma #grandmaandgrandson #absurdcomedy #unexpectedanswer #unexpectedreaction #funnyconversation #relatablegrandma #savagegrandma #funnyfamilycomedy #americanhumor #americancomedy #genzhumor #viralfunnyvideo #comedyvideo #shortcomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514831/3514831_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T17:45:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>night 6</video:title>
      <video:description>lintas sumatra #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514830/3514830_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T17:45:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Acara resmikah</video:title>
      <video:description>Bila acara resmi mungkin kah bimten bila dalam agama mungkin bimten haji atau umroh namun bila bukan acara agama mungkin acara ulang tahun atau acara kantor/dinas. yang lain mungkin acara lamaran atau acara pengajian sekian #Entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514829/3514829_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T17:45:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>senja 8</video:title>
      <video:description>sore hari #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514828/3514828_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T17:44:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quotes 144</video:title>
      <video:description>Ewww #Love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514827/3514827_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T17:44:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>magelang</video:title>
      <video:description>kota #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514826/3514826_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T17:44:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang seafood 5</video:title>
      <video:description>Mukbang #Mukbang #seafood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514825/3514825_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T17:43:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aku sebenarnya kehilangan apanya</video:title>
      <video:description>Malam ini rame tapi di dalam sepi gak sedih gak hambar cuma hambar #Lagimerasalagihambaraja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514824/3514824_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T17:43:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Bee meets Pollen</video:title>
      <video:description>AI Allegory #Bee #abelha #pólen #pollen</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514823/3514823_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T17:43:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start Up episode 3 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514822/3514822_720p.mp4</video:content_loc>
      <video:duration>4994</video:duration>
      <video:publication_date>2026-10-04T17:43:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Cat Chopping Vegetables 🐱🥕🔪</video:title>
      <video:description>This adorable cat chef keeps chopping fresh vegetables in a peaceful countryside kitchen. Simple, satisfying, and wholesome cooking moments! 🥬🐱✨ #cutecat #catcooking #choppingvegetables #catchef #fluffycat #cookingcat #vegetablecutting #cuteanimal #countrysidecooking #satisfyingvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514821/3514821_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:42:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The little kitten didn&apos;t see prey, he saw a friend in need</video:title>
      <video:description>In a world where you can be anything, be kind. 🥺❤️ The little kitten didn&apos;t see prey, he saw a friend in need.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514820/3514820_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:42:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chhota Bheem &amp; Mighty Little Bheem Dholakpur 2090 | Full Video | King Shahapur Tv Kids</video:title>
      <video:description>Chhota Bheem &amp; Mighty Little Bheem Dholakpur 2090 | Full Video | King Shahapur Tv Kids</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514817/3514817_720p.mp4</video:content_loc>
      <video:duration>2687</video:duration>
      <video:publication_date>2026-10-04T17:40:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Secangkir Cooffy</video:title>
      <video:description>menu cooffy tugu luwak yang disajikan ditampilkan oleh ibu lewat dituangkan dari air panas lewat teko .Diminum pagi hari atau sore hari jam 15.30 wib agar tepat waktu tepat sasaran merasakan nikmat dan menimbulkan inspiratif bagi penggemr peminum #entertainment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514816/3514816_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T17:40:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bach Humor</video:title>
      <video:description>AI Delirious Delicious #VermeerBachAIHumorGirlPearl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514815/3514815_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T17:40:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WIRTZ BIKIN LAWAN CUMA BISA TERDIAM! 😱🔥</video:title>
      <video:description>Gerakan dan permainan Wirtz memang beda kelas! ⚽🔥 Momen seperti ini yang bikin pertandingan sepak bola makin seru. Menurut kalian, Wirtz bakal jadi salah satu pemain terbaik dunia? 👀 #FlorianWirtz #Wirtz #skillWirtz #aksiWirtz #Wirtzfootball #Wirtzedit #pemainmudaterbaik #skillsepakbola #highlightsepakbola #footballskills #socceredit #viralsepakbola</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514814/3514814_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-04T17:39:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Never talk to grandma before coffee</video:title>
      <video:description>Bobo thought he was just asking Granny a simple question… but Granny had a completely unexpected answer 😂 Watch until the end — you won&apos;t see that coming! 👵 Granny + 👦 Bobo = chaos every time. What would YOU say if your grandma said this? 😂 #funnygranny #grandmahumor #grandmareaction #funnygrandmareaction #grandsongrandma #grandmaandgrandson #absurdcomedy #unexpectedanswer #unexpectedreaction #funnyconversation #relatablegrandma #savagegrandma #funnyfamilycomedy #americanhumor #americancomedy #genzhumor #viralfunnyvideo #comedyvideo #shortcomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514813/3514813_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T17:39:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>belajar 2</video:title>
      <video:description>Berdiskusi bersama teman sekolah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514812/3514812_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-10-04T17:38:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak 4th October 2026 Episode 453</video:title>
      <video:description>Tum Se Tum Tak 4th October 2026 Episode 453 1. &quot;A love story wrapped in sorrow&quot; 2. &quot;A tale of love and heartbreak&quot; 3. &quot;A painful journey of love&quot; 4. &quot;A love that ended in tears&quot; 5. &quot;A doomed love story&quot; 6. &quot;A love story that broke hearts&quot; 7. &quot;A romance filled with sadness&quot; 8. &quot;A bittersweet love story&quot; 9. &quot;A love story lost to fate&quot; 10.&quot;A tragic romance&quot; 11.&quot;A Tum Se Tum Tak All Episode #TumSeTumTak4thOctober2026Episode453</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514811/3514811_720p.mp4</video:content_loc>
      <video:duration>1338</video:duration>
      <video:publication_date>2026-10-04T17:37:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>novelas de frutas</video:title>
      <video:description>Reencontro dos desconhecidos Parte 6 #Reencontro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514810/3514810_720p.mp4</video:content_loc>
      <video:duration>175</video:duration>
      <video:publication_date>2026-10-04T17:36:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tarian tradisional 2</video:title>
      <video:description>Uuuuu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514809/3514809_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-10-04T17:36:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bergadang hanya untuk ketenangan</video:title>
      <video:description>Butuh ketenangan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514808/3514808_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T17:35:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islam 44</video:title>
      <video:description>Islam iss beutifull🥰 #Travel #paris #prancis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514807/3514807_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T17:35:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I swear that sound just came from the kitchen</video:title>
      <video:description>Bobo thought he was just asking Granny a simple question… but Granny had a completely unexpected answer 😂 Watch until the end — you won&apos;t see that coming! 👵 Granny + 👦 Bobo = chaos every time. What would YOU say if your grandma said this? 😂 #relatablecomedy #comedy #funnygranny #grandmahumor #funnyfamilycomedy #americanhumor #americancomedy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514806/3514806_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T17:35:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grandpa and beautiful woman were fishing, their bait was bitten by a monitor lizard.</video:title>
      <video:description>A grandfather and a beautiful woman were fishing in the river, but the bait was eaten by a monitor lizard. #Monitorlizard #fish #grandfather #beautifulwoman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514805/3514805_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:34:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>El árbitro que intentó parar a Messi 😳⚽🔥</video:title>
      <video:description>Cuando Messi empieza a correr, hasta el árbitro tuvo que reaccionar. 😳⚡ Una jugada llena de velocidad, habilidad y magia de Lionel Messi. El fútbol de Messi siempre encuentra una manera de sorprender. 🐐⚽ ¿Crees que alguien podía detenerlo en ese momento? 👀👇 Contenido para todos los fans de Messi, LaLiga, Champions League y el fútbol europeo. 🌍🏆 🏷️ Hashtags #Messi #LionelMessi #Futbol #Fútbol #MessiMagic #LaLiga #ChampionsLeague #UCL #FutbolEuropeo #FutbolFans #Football #Soccer #MessiEdit #FutbolShorts #Shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514804/3514804_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T17:34:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>- 2026-09-30T231045.138.mp4</video:title>
      <video:description>https://www.febspot.com/ref/1217291/</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514803/3514803_720p.mp4</video:content_loc>
      <video:duration>455</video:duration>
      <video:publication_date>2026-10-04T17:34:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Succulent terrarium arrangement in concrete pot 4</video:title>
      <video:description>Succulent terrarium arrangement in concrete pot #Succulent #cactus #terrarium #arrangement #florarium #seashell #concrete #pot #growth #gardening #decoration #plants #floristic #bouquet #nursery #pottery #nature #rabbitholecrafts #interior #design</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514802/3514802_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T17:33:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Mistério da Explosão que Abalou a Sibéria</video:title>
      <video:description>Evento de Tunguska foi uma queda de um objeto celeste que aconteceu em uma região da Sibéria, no Império Russo, próxima ao rio Podkamennaya Tunguska em 30 de junho de 1908. A queda provocou uma grande explosão, devastando uma área de milhares de quilômetros quadrados. A ausência de uma cratera e de evidências diretas do objeto que teria causado a explosão levou a uma grande quantidade de teorias especulatórias sobre a causa do evento. Apesar de ainda ser assunto de debate, segundo os estudos mais recentes a destruição provavelmente foi causada pelo deslocamento de ar subsequente a uma explosão de um meteoroide ou fragmento de cometa a uma altitude de 5–10 km na atmosfera, devido ao atrito da reentrada. Diferentes estudos resultaram em estimativas para o tamanho do objeto variando em torno de algumas dezenas de metros. #apocalypse #tunguskaevent #tunguskasound #asteroid #sibéria #tunguska1908 #tunguskaexplosion</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514801/3514801_720p.mp4</video:content_loc>
      <video:duration>573</video:duration>
      <video:publication_date>2026-10-04T17:33:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>i like gym</video:title>
      <video:description>u know i like gym, yeah make me healthy #travel #gym #sport #paris #france #usa #model #fashion #cardio #woman #love #myself #beauty #skin #healthy #cake #milk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514800/3514800_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T17:32:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kerajinan tangan dari limbah sisa</video:title>
      <video:description>Semoga anda menyukainya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514799/3514799_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T17:31:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chhota Bheem BheemVerse Part 03 Last | King Shahapur Tv | Like Comment Share | Follow Me | My Channe</video:title>
      <video:description>Chhota Bheem BheemVerse Part 03 Last | King Shahapur Tv | Like Comment Share | Follow Me | My Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514798/3514798_720p.mp4</video:content_loc>
      <video:duration>2757</video:duration>
      <video:publication_date>2026-10-04T17:30:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Keluarga 3</video:title>
      <video:description>berkumpul bersama dan bercanda bermain dan diskusi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514797/3514797_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T17:30:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viagens do Lami com Baton de Chocolate</video:title>
      <video:description>Batida de chocolate branco #Beer #drinks #whisky #Brand #cerveja #baton #chocolate #top</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514796/3514796_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-10-04T17:29:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514795</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514795/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I said i’m sorry</video:title>
      <video:description>Bobo thought he was just asking Granny a simple question… but Granny had a completely unexpected answer 😂 Watch until the end — you won&apos;t see that coming! 👵 Granny + 👦 Bobo = chaos every time. What would YOU say if your grandma said this? 😂 #funnygranny #funnygrandmavideos #videosgrandma #comedygranny #comedygrandmajokes #funnyfamily</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514795/3514795_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T17:28:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coffe 7</video:title>
      <video:description>Menenangkan pikiran #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514794/3514794_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:28:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>মা হোটেলের রসমালাই</video:title>
      <video:description>মা হোটেলের রসমালাই</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514793/3514793_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-04T17:25:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piadascurtas #humor #comedia #funil #paisagemnatural</video:title>
      <video:description>#Recomendaçõesmédicasseescrevam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514792/3514792_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T17:25:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Scenic Panorama</video:title>
      <video:description>Scenic Panorama Ultra-wide drone capture of sprawling green mountain ranges meeting crystal clear blue lakes. #Scenic #Panorama #crystal #capture #green #mountain</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514791/3514791_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T17:25:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Random 18</video:title>
      <video:description>https://zoyalink.com/ZF4pSdzmRLxq #Usa</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514790/3514790_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-04T17:24:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Granny Is Yapping</video:title>
      <video:description>Bobo thought he was just asking Granny a simple question… but Granny had a completely unexpected answer 😂 Watch until the end — you won&apos;t see that coming! 👵 Granny + 👦 Bobo = chaos every time. What would YOU say if your grandma said this? 😂 #funnygranny #grandmahumor #grandmareaction #funnygrandma</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514789/3514789_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T17:24:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 8 hindi</video:title>
      <video:description>W – Two Worlds Ep 8 hindi #W–TwoWorldsEp8hindikdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514788/3514788_720p.mp4</video:content_loc>
      <video:duration>3495</video:duration>
      <video:publication_date>2026-10-04T17:24:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>swim ill try</video:title>
      <video:description>without u im swim lets crying #travel #swim #aris #forest #swimming #beauty #alone #fashion #woman #pretty #dress #black #colour #love #myself #cake #milk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514786/3514786_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T17:24:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A beach vacation with the family</video:title>
      <video:description>A beach vacation with the family #travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514785/3514785_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-10-04T17:24:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Full Version She saved him in the rain. married him by contract-then love rewrote the deal!</video:title>
      <video:description>Artistic &amp; Safety Disclosuren 0 SIndividuals under 18 are strictly prohibited from viewing 1. Nature of Content The content of this channel mainly consists of original short dramas, and is categorized as &quot;Artistic&quot; undew YouTube&apos;s EDSA policies 2. Child Safety Minor characters appearing in this episode are all played by professional and voluntary actors. All filming scenes were completed under the real-time supervision of their guardians to ensure a safe and compliant environment Please do not imitate any scenes. 3. Production Goal This video explores themes including [e.g., philosophy of life, family affection, workplace] through fictionak storytelling. It does not involve any dangerous, manipulative or inappropriate behaviors Drama Name:Just You, Only You/ 1 2-4R (Yao Guan Yu ) &amp;XBEE ( Dena Lin Shu ) Welcome to subscribe to Drama Fever Hour OIMPORTANT NOTICE &apos;m a creator. All dramas on the channel are officiall icensed, and all edits are done independently by me Please don&apos;t steal my work--these are the fruits of m) labor. If you enjoy the stories I tell, please SUBSCRIBE! #dramacdramachinesesdramaminidramaromancechineseminidramacoupledramachinaloveromanticdramasweet甜宠短剧古装重生逆袭短劇现代爱情言情</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514784/3514784_720p.mp4</video:content_loc>
      <video:duration>7751</video:duration>
      <video:publication_date>2026-10-04T17:23:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bart jadi pro player #kartun #simpsons</video:title>
      <video:description>#cartoon #thesimpson #barthommer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514783/3514783_720p.mp4</video:content_loc>
      <video:duration>165</video:duration>
      <video:publication_date>2026-10-04T17:23:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bagaimana?</video:title>
      <video:description>kita punya keinginan tapu semesta punya kenyataan. #quotes #sad #cry #video #story</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514782/3514782_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T17:23:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514781</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514781/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aaliya Name Meaning in Islam | आलिया नाम का मतलब क्या है? | Beautiful Muslim Girl Name</video:title>
      <video:description>Aaliya Name Meaning in Islam | आलिया नाम का मतलब क्या है? | Beautiful Muslim Girl Name #AaliyaNameMeaninginIslamआलियानामकामतलबक्याहैBeautifulMuslimGirlName</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514781/3514781_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T17:21:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514780</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514780/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inikah Yang di rasa kesepian?</video:title>
      <video:description>Kenapa semua terjadi. #sad #cry #missyou</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514780/3514780_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T17:21:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Isis Fashion Awards 2025 Part 10 Artistic Accesso 2026</video:title>
      <video:description>Isis Fashion Awards 2025 Part 10 Artistic Accesso 2026 #IsisFashionAwards2025Part10ArtisticAccesso2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514779/3514779_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-04T17:21:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Workout at home 3</video:title>
      <video:description>Mr Ind vs wi #Hellosir</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514778/3514778_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T17:21:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AURA OF MR. BEAN PART 10 ☠️🔥 He Made Every Moment Legendary 👑 #mrbean #shorts #trending (1080p60).mp</video:title>
      <video:description>AURA OF MR. BEAN PART 10 ☠️🔥</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514777/3514777_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T17:21:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NOOR JHAAN AND DLEEP KUMAR</video:title>
      <video:description>Interview by Daleep in PUNJABI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514776/3514776_720p.mp4</video:content_loc>
      <video:duration>169</video:duration>
      <video:publication_date>2026-10-04T17:21:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What Happens When a Person Dies in Islam? The Journey of the Soul in Barzakh and Reality of the Grav</video:title>
      <video:description>What Happens When a Person Dies in Islam? The Journey of the Soul in Barzakh and Reality of the Grave In this video, we explore what happens when a person passes away according to Islam, covering the life of Barzakh, the reality of the grave, and the journey of the soul after death. A heartfelt Islamic reminder that reminds us why good deeds matter so much after death. Islam, Death in Islam, Journey of the Soul, Barzakh, Reality of the Grave, Islamic Reminder, Questioning in the Grave, Afterlife in Islam, Good Deeds After Death, Islamic Video #Islam #DeathinIslam #JourneyoftheSoul #Barzakh #RealityoftheGrave #IslamicReminder #QuestioningintheGrave #AfterlifeinIslam #GoodDeedsAfterDeath #IslamicVideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514775/3514775_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-04T17:20:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relaxing nautical footage featuring boats gliding across serene waters</video:title>
      <video:description>Relaxing nautical footage featuring boats gliding across serene waters. #boats #Travel #waters</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514774/3514774_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T17:20:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 7 hindi</video:title>
      <video:description>W – Two Worlds Ep 7 hindi #W–TwoWorldsEp7hindiW–TwoWorldsEp7kdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514773/3514773_720p.mp4</video:content_loc>
      <video:duration>3521</video:duration>
      <video:publication_date>2026-10-04T17:20:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#amen🙏 #diosesbueno🌻❤ #bendiciones🌹❤️🙌🏻🙌🏻🙏 #felizmiercolesparatodos🌼🦋🌺 #dioslosbendiga</video:title>
      <video:description>#amen🙏diosesbueno🌻❤bendiciones🌹❤️🙌🏻🙌🏻🙏felizmiercolesparatodos🌼🦋🌺dioslosbendiga</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514772/3514772_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T17:20:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514771</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514771/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Abida Name Meaning in Islam #abida #abidanamemeaning #namemeaning #namemeaninginislam #name</video:title>
      <video:description>Abida Name Meaning in Islam #abida #abidanamemeaning #namemeaning #namemeaninginislam #name #AbidaNameMeaninginIslamabidaabidanamemeaningnamemeaningnamemeaninginislamname</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514771/3514771_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T17:19:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stunning urban landscapes and futuristic futuristic infrastructure of Qatar City.</video:title>
      <video:description>Stunning urban landscapes and futuristic futuristic infrastructure of Qatar City. traveling on Qatar City- Modern,Clasic #Travel #Qatar #city #urban #futuristic #landscapes #infrastructure #Modern #Clasic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514770/3514770_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T17:19:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This not my packet</video:title>
      <video:description>Wrong tool it is not mine #Cargo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514769/3514769_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-10-04T17:18:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chicken nuggets with beetroot</video:title>
      <video:description>Delicious beetroot salad and nuggets 😊 #foodsaladgoodmeal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514768/3514768_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T17:18:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Charlie has impressive Pistols skills. #charliechaplin (1080p60).mp4</video:title>
      <video:description>Charlie has impressive Pistols skills 🥶☠️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514767/3514767_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T17:18:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chhota Bheem BheemVerse Part 02 | King Shahapur Tv | Like Comment Share | Follow Me | My Channel</video:title>
      <video:description>Chhota Bheem BheemVerse Part 02 | King Shahapur Tv | Like Comment Share | Follow Me | My Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514766/3514766_720p.mp4</video:content_loc>
      <video:duration>2747</video:duration>
      <video:publication_date>2026-10-04T17:18:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful birtd 5</video:title>
      <video:description>#Aividio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514765/3514765_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:18:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hum Duniya ki taraf bhagte hain #duniyadari #duniya #aakhirat #motivation #islam #shorts</video:title>
      <video:description>Hum Duniya ki taraf bhagte hain #duniyadari #duniya #aakhirat #motivation #islam #shorts #HumDuniyakitarafbhagtehainduniyadariduniyaaakhiratmotivationislamshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514764/3514764_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T17:18:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Magnificent contemporary Islamic architectural design of Qatar mosques</video:title>
      <video:description>Magnificent contemporary Islamic architectural design of Qatar mosques. @QatarCity Architektur modern Mosque #City #Qatar #Islamic #architectural #design #mosques #Modern</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514763/3514763_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T17:17:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enasehat pengingat diri dakwah Makelar Kebaikan</video:title>
      <video:description>Jangan terlalu sibuk mengejar dunia sampai lupa kepada Allah. Tetap rendah hati, bersyukur atas apa yang ada, dan percaya bahwa setiap proses punya waktunya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514762/3514762_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T17:16:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toxic (2026) Hindi Dubbed Full Movie | Starring Yash, Kiara Advani, Nayanthara, Huma, Tara Sutaria</video:title>
      <video:description>Toxic (2026) Hindi Dubbed Full Movie | Starring Yash, Kiara Advani, Nayanthara, Huma, Tara Sutaria Presenting New South Indian Movies Dubbed In Hindi 2026 Full, Toxic: A Fairy Tale for Grown-Ups. Directed by: Geetu Mohandas Written by: Geetu Mohandas Yash Starring: Yash Kiara Advani Nayanthara Huma Qureshi Tara Sutaria Rukmini Vasanth Music by: Vishal Mishra Ravi Basrur Tanishk Bagchi #movie #hindimovie #hindi #toxic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514761/3514761_720p.mp4</video:content_loc>
      <video:duration>10987</video:duration>
      <video:publication_date>2026-10-04T17:16:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 6 hindi</video:title>
      <video:description>W – Two Worlds Ep 6 #W–TwoWorldsEp6hindikdrma</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514760/3514760_720p.mp4</video:content_loc>
      <video:duration>3620</video:duration>
      <video:publication_date>2026-10-04T17:16:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The_Ordinary_Jackpot_[Hindi]_720P_S01_E05.mp4</video:title>
      <video:description>K.drama #Series</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514759/3514759_720p.mp4</video:content_loc>
      <video:duration>2800</video:duration>
      <video:publication_date>2026-10-04T17:16:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful woman is fighting against a big swamp crocodile</video:title>
      <video:description>A beautiful woman is dueling against a large swamp crocodile so that residents come to watch. #Swampcrocodile #estuarinecrocodile #rivercrocodile #beautifulwoman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514758/3514758_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:15:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alone 45</video:title>
      <video:description>When Ya Dapat Onty Nya#Fyp #Traveling</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514757/3514757_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T17:15:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalanraya</video:title>
      <video:description>Beli obat #Whaywhatis</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514756/3514756_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T17:15:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My life 45</video:title>
      <video:description>My fortuner #Home</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514755/3514755_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T17:15:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The_Ordinary_Jackpot_[Hindi]_720P_S01_E03.mp4 2</video:title>
      <video:description>K.drama #Series</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514754/3514754_720p.mp4</video:content_loc>
      <video:duration>3054</video:duration>
      <video:publication_date>2026-10-04T17:14:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Peaceful atmosphere and grand architecture around Al-Masjid an-Nabawi</video:title>
      <video:description>Peaceful atmosphere and grand architecture around Al-Masjid an-Nabawi. Madinah - Saudi Arabia #Madinah #SaudiArabia #Masjid #Peaceful #architecture #Nabawi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514753/3514753_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-04T17:14:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Film pendek kisah nyata</video:title>
      <video:description>Film pendek kisah tuyul mencuri uang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514752/3514752_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T17:14:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum se Tum Tak • Episode 452 • 04 October 2026</video:title>
      <video:description>👍Don&apos;t Forget Like and Follow! #TumseTumTak #ZeeTV #zee5 #zeetvserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514751/3514751_720p.mp4</video:content_loc>
      <video:duration>1338</video:duration>
      <video:publication_date>2026-10-04T17:13:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The_Ordinary_Jackpot_[Hindi]_720P_S01_E03.mp4</video:title>
      <video:description>K.drama #Series</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514750/3514750_720p.mp4</video:content_loc>
      <video:duration>2612</video:duration>
      <video:publication_date>2026-10-04T17:13:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fanny video 114</video:title>
      <video:description>Fanny video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514749/3514749_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-10-04T17:12:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>agar aaj akhiri din ho to? #aakhirat #maut #zindagi #islamic #shorts #viral #trending</video:title>
      <video:description>agar aaj akhiri din ho to? #aakhirat #maut #zindagi #islamic #shorts #viral #trending #agaraajakhiridinhotoaakhiratmautzindagiislamicshortsviraltrending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514748/3514748_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:12:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Roti lembut</video:title>
      <video:description>Roti lembut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514746/3514746_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T17:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chhota Bheem BheemVerse Part 01 | King Shahapur Tv | Like Comment Share | Follow Me | My Channel</video:title>
      <video:description>Chhota Bheem BheemVerse Part 01 | King Shahapur Tv | Like Comment Share | Follow Me | My Channel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514745/3514745_720p.mp4</video:content_loc>
      <video:duration>2720</video:duration>
      <video:publication_date>2026-10-04T17:12:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Modern architectural showcase of Dubai skyscrapers and city skyline</video:title>
      <video:description>Modern architectural showcase of Dubai skyscrapers and city skyline. #Dubai #Travel #architectural #Modern #showcase #city</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514744/3514744_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T17:11:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The_Ordinary_Jackpot_[Hindi]_720P_S01_E02.mp4</video:title>
      <video:description>K.drama #Series</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514743/3514743_720p.mp4</video:content_loc>
      <video:duration>2964</video:duration>
      <video:publication_date>2026-10-04T17:11:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>film pendek penguasa gaib keluarlah</video:title>
      <video:description>Penguasa gaib</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514742/3514742_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-10-04T17:11:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata mutiara 32</video:title>
      <video:description>Video ini hanya edukasi #Sampaisinipaham</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514741/3514741_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-04T17:11:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Logo Se Chup Sakte Hain Allah Se Nhi #allah #islam #motivation #viral #shorts</video:title>
      <video:description>Logo Se Chup Sakte Hain Allah Se Nhi #allah #islam #motivation #viral #shorts #LogoSeChupSakteHainAllahSeNhiallahislammotivationviralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514740/3514740_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:10:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The_Ordinary_Jackpot_[Hindi]_720P_S01_E01.mp4</video:title>
      <video:description>K.drama #Series</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514739/3514739_720p.mp4</video:content_loc>
      <video:duration>2835</video:duration>
      <video:publication_date>2026-10-04T17:10:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Tale of Two Cities - S01 Episode 04</video:title>
      <video:description>#ATaleofTwoCities #ATaleofTwoCitiesdrama #ATaleofTwoCitiesseries #ATaleofTwoCitiesTVseries #ATaleofTwoCitiesepisodes #ATaleofTwoCitiescast #ATaleofTwoCitiesChinesedrama #ATaleofTwoCitiesC-drama #ATaleofTwoCitiesChineseseries #historicaldrama #Chinesehistoricaldrama #romancedrama #perioddrama #Chineseseries #Asiandrama #dramaseries #historicalromance #newC-drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514738/3514738_720p.mp4</video:content_loc>
      <video:duration>4190</video:duration>
      <video:publication_date>2026-10-04T17:10:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 5 hindi</video:title>
      <video:description>W – Two Worlds Ep 5 hindi #W–TwoWorldsEp5hindikdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514737/3514737_720p.mp4</video:content_loc>
      <video:duration>3654</video:duration>
      <video:publication_date>2026-10-04T17:10:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Istambul Cultural Scenery</video:title>
      <video:description>Cultural scenery and gorgeous historical landscape views of Istanbul. Turkey #Turkey #Istambul #Cultural #scenery</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514736/3514736_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T17:09:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qabar Ki Pehli Raat #qabar #kabar #qabrkizindagi #duniyadari 2</video:title>
      <video:description>Qabar Ki Pehli Raat #qabar #kabar #qabrkizindagi #duniyadari #QabarKiPehliRaatqabarkabarqabrkizindagiduniyadari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514735/3514735_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:09:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strong girl bong soon ep 16 Hindi dubbed</video:title>
      <video:description>Strong girl bong soon episode 16 Hindi dubbed K-drama #K-drama #Hindidubbed #stronggirl #bossemployee #serialkiller #happyending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514734/3514734_720p.mp4</video:content_loc>
      <video:duration>4280</video:duration>
      <video:publication_date>2026-10-04T17:09:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎰 1 Ticket Gacha… Gold Lights &amp; Portugal Flag! I Thought It Was Ronaldo 😭</video:title>
      <video:description>#FcMobile</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514733/3514733_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T17:08:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qabar Ki Pehli Raat #qabar #kabar #qabrkizindagi #duniyadari</video:title>
      <video:description>Qabar Ki Pehli Raat #qabar #kabar #qabrkizindagi #duniyadari #QabarKiPehliRaatqabarkabarqabrkizindagiduniyadari</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514732/3514732_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:08:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Succulent terrarium arrangement in porcelain pot</video:title>
      <video:description>Succulent terrarium arrangement in porcelain pot #Succulent #cactus #terrarium #arrangement #florarium #seashell #concrete #pot #growth #gardening #decoration #plants #floristic #bouquet #nursery #pottery #nature #rabbitholecrafts #interior #design</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514731/3514731_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T17:07:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 15</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514730/3514730_720p.mp4</video:content_loc>
      <video:duration>3907</video:duration>
      <video:publication_date>2026-10-04T17:07:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Watermelon 18</video:title>
      <video:description>Panen semangka #Farmwatermelonfyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514729/3514729_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T17:07:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>very Time I Fell, I Came Back Stronger</video:title>
      <video:description>They thought falling would break me. They were wrong. Every stumble, every loss, every mistake — it didn’t stop me. It built me. This is the story of turning setbacks into strength, pain into power, and falls into comebacks. If you’re going through a hard time right now, this is for you. Keep going. 👊 Tell me in the comments: What made YOU stronger after you fell? #Scholic #shorts #shortsfeed #shortsclip #shortsmusic #shortsvideo #music #healingmusic #musiclover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514728/3514728_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-10-04T17:07:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My cat tell me something and i understand🙏🙏❤️</video:title>
      <video:description>My cat tell me something and i understand #My #cat #tell #something #understand</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514727/3514727_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T17:07:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>নবী ﷺ এর ৭টি গুরুত্বপূর্ণ উপদেশ যা প্রত্যেকটি জানা জরুরি</video:title>
      <video:description>নবী ﷺ এর ৭টি গুরুত্বপূর্ণ উপদেশ যা প্রত্যেকটি মানুষের জানা জরুরি #islamic #tranding #shorts নবীজির ৭টি উপদেশ, নবী মুহাম্মদ সাঃ এর উপদেশ, রাসূলের গুরুত্বপূর্ণ উপদেশ, রাসূলের নসিহত, নবীজির নসিহত, মুসলমানের জন্য গুরুত্বপূর্ণ কথা, প্রতিটি মুসলমানের জানা উচিত, ইসলামিক উপদেশ বাংলা, ইসলামিক নসিহত বাংলা, ইসলামিক মোটিভেশন বাংলা, ইসলামিক শিক্ষা, নবীজির শিক্ষা, রাসূলুল্লাহর শিক্ষা, নামাজের গুরুত্ব, মৃত্যুর কথা স্মরণ, দুনিয়া মুসাফিরের জীবন, জ্যোতিষীর কাছে যাওয়া, গণকের কাছে যাওয়া ইসলাম, জাদু টোনা ইসলাম, কবরকে সেজদা, আয়াতুল কুরসি ফজিলত, ফরজ নামাজের পর আয়াতুল কুরসি, হাদিস বাংলা, সহিহ হাদিস বাংলা, ইসলামিক শর্টস, বাংলা ইসলামিক শর্টস, Islamic Shorts Bangla, Islamic Reminder Bangla, Prophet Muhammad Advice, Islamic Motivation Bangla, Hadith Bangla, Muslim Reminder #নবীজির৭টিউপদেশ #নবীমুহাম্মদসাঃএরউপদেশ #রাসূলেরগুরুত্বপূর্ণউপদেশ #রাসূলেরনসিহত #নবীজিরনসিহত #মুসলমানেরজন্যগুরুত্বপূর্ণকথা #প্রতিটিমুসলমানেরজানাউচিত #ইসলামিকউপদেশবাংলা #ইসলামিকনসিহতবাংলা #ইসলামিকমোটিভেশনবাংলা #ইসলামিকশিক্ষা #নবীজিরশিক্ষা #রাসূলুল্লাহরশিক্ষা #নামাজেরগুরুত্ব #মৃত্যুরকথাস্মরণ #দুনিয়ামুসাফিরেরজীবন #জ্যোতিষীরকাছেযাওয়া #গণকেরকাছেযাওয়াইসলাম #জাদুটোনাইসলাম #কবরকেসেজদা #আয়াতুলকুরসিফজিলত #ফরজনামাজেরপরআয়াতুলকুরসি #হাদিসবাংলা #সহিহহাদিসবাংলা #ইসলামিকশর্টস #বাংলাইসলামিকশর্টস #IslamicShortsBangla #IslamicReminderBangla #ProphetMuhammadAdvice #IslamicMotivationBangla #HadithBangla #MuslimReminder</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514726/3514726_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T17:07:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Girls 53</video:title>
      <video:description>Beautiful girls in hijab</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514725/3514725_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:07:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Newly Hatched Goslings Resting Together in Nest</video:title>
      <video:description>Newly hatched goslings resting and huddling together in a natural nest under their mother, showing adorable newborn waterfowl and early family life. #gosling #goslings #goose #geese #newlyhatched #hatchling #babygoose #newborn #waterfowl #bird #birds #nest #nestling #chicks #babybirds #hatching #newlyborn #younggoose #mothergoose #family #wildlife #nature #animal #animals #cute #adorable #fluffy #feathers #natural #countryside #farm #poultry #breeding #offspring #motherhood #parenting #protection #newbornanimals #spring #wildlifefootage #closeup #resting #sleeping #huddling #group #naturalhabitat #avian</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514724/3514724_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T17:07:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514723</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514723/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>华纳万宝路公司开户注册介绍{微 6929855</video:title>
      <video:description>华纳万宝路官网《235283.com》华纳集团创建于2008年，注册资金5.7亿元，产业头部地产、基金、酒店、传媒，集团总部坐落果敢老街，华纳人秉承浙商勤务实的创业精神是老街大型旅游公司、华纳万宝路大酒店欢迎您入住 我们以客户为主 服务第一 正规实体主题酒店 了解更多关于需求生成材料、市场和 Azure Ope 服务案例研究的信息，以激发客户的想象力。 #旅行、法国、酒店、推荐</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514723/3514723_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T17:07:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drone na Agricultura: Como Avaliar Terrenos para Plantio e Reflorestamento</video:title>
      <video:description>#agro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514722/3514722_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T17:06:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I love music 🎶</video:title>
      <video:description>music lover🎶🎵</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514721/3514721_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T17:06:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strong, Beautiful, Unstoppable</video:title>
      <video:description>&quot;With every repetition, her focus never wavers. Dressed in sleek activewear, she powers through her session with infectious energy and effortless poise, turning hard work and discipline into a captivating display of fitness.&quot; #Fitgirl #Fitnesswoman #Fitnessgirl #Gymgirl #Athleticwoman #Workoutgirl #Prettyfitnessgirl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514720/3514720_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:06:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuban Ki Hifazat #zubankihifazat #islamicmotivation #short #trending #viral</video:title>
      <video:description>Zuban Ki Hifazat #zubankihifazat #islamicmotivation #short #trending #viral #ZubanKiHifazatzubankihifazatislamicmotivationshorttrendingviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514719/3514719_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T17:06:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asean work</video:title>
      <video:description>Ice block #work #asean #job #human #black #fish #Indonesia #java #cozy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514718/3514718_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T17:05:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como a Tecnologia Dobrou a Produção de Alimentos no Brasil</video:title>
      <video:description>#ciênciaagro</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514717/3514717_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T17:04:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Fixers - Season 01 Episode 04</video:title>
      <video:description>#TheFixers #TheFixersseries #TheFixersdrama #TheFixersTVseries #TheFixersshow #TheFixersepisodes #TheFixersseason #TheFixerscast #TheFixersstoryline #TheFixersdramaseries #TheFixerslatestepisodes #TheFixersfullepisodes #TheFixersEnglishdrama #TheFixersseries2026 #TheFixersTVshowkeywords</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514715/3514715_720p.mp4</video:content_loc>
      <video:duration>2626</video:duration>
      <video:publication_date>2026-10-04T17:04:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Turning Trash Styrofoam Into A Realistic White Cat - Satisfying Sculpture Art</video:title>
      <video:description>From a simple piece of white styrofoam to an adorable realistic cat! 😍 Watch how this artist cuts, glues, draws, and carves with incredible patience and skill. The final result is unbelievable - the eyes look so alive! This is true definition of creativity. Who else thinks this is pure talent? If you love cats and art, you will love this video until the end! 🐱✨ Follow for more satisfying craft and DIY sculpture videos! Credit: Original artist (DM for credit) #satisfying #sculpture --- Question for you: Do you want to see a dog version next? Let me know in the comments! 👇 #styrofoamart #styrofoamsculpture #catsculpture #howtomakecatsculpture #diycat #styrofoamcraft #satisfyingsculpture #carvingart #foamcarving #realisticcatsculpture #handmadecat #artandcraft #diyart #creativerecycling #catlover #sculptureart #styrofoamrecyclingcraft #satisfyingvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514714/3514714_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T17:04:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strong girl bong soon ep 15 Hindi dubbed</video:title>
      <video:description>Strong girl bong soon episode 15 Hindi dubbed K-drama #K-drama #Hindidubbed #stronggirl #bossemployee #serialkiller #happyending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514713/3514713_720p.mp4</video:content_loc>
      <video:duration>4016</video:duration>
      <video:publication_date>2026-10-04T17:04:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shazi Heroine Surprised Entry On The Shoot 😱 Daal Main Kuch Kalaa Hai Bhai Sab 😄 Rajab Family</video:title>
      <video:description>Rajab Family Vlog #RajabFamily</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514712/3514712_720p.mp4</video:content_loc>
      <video:duration>1967</video:duration>
      <video:publication_date>2026-10-04T17:03:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds EP 4 hindi</video:title>
      <video:description>W – Two Worlds EP 4 hindi #W–TwoWorldsEP4hindiviralvidionewvidiakdram</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514711/3514711_720p.mp4</video:content_loc>
      <video:duration>3605</video:duration>
      <video:publication_date>2026-10-04T17:03:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inside The $8,000,000,000 Mega Yachts 2</video:title>
      <video:description>Inside The $8,000,000,000 Mega Yachts #Luxury #Millionaire #Billionaire #Money #Viral #Expensive #Actors #Watches #Celebrities #Boats #Jets #Yachts #TheRichest #KingLuxury #Top10 #ExpensiveThings #MrLuxury #TopLuxury #LuxuryKing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514710/3514710_720p.mp4</video:content_loc>
      <video:duration>551</video:duration>
      <video:publication_date>2026-10-04T17:02:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514709</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514709/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 16</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514709/3514709_720p.mp4</video:content_loc>
      <video:duration>3862</video:duration>
      <video:publication_date>2026-10-04T17:02:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 14</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514708/3514708_720p.mp4</video:content_loc>
      <video:duration>3904</video:duration>
      <video:publication_date>2026-10-04T17:02:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>motorbike riding  day</video:title>
      <video:description>motorbike riding just an ordinary day</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514707/3514707_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T17:02:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514706</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514706/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 13</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514706/3514706_720p.mp4</video:content_loc>
      <video:duration>3872</video:duration>
      <video:publication_date>2026-10-04T17:01:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 12</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514705/3514705_720p.mp4</video:content_loc>
      <video:duration>3896</video:duration>
      <video:publication_date>2026-10-04T17:01:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 11</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514704/3514704_720p.mp4</video:content_loc>
      <video:duration>3899</video:duration>
      <video:publication_date>2026-10-04T17:01:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 10</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514703/3514703_720p.mp4</video:content_loc>
      <video:duration>3909</video:duration>
      <video:publication_date>2026-10-04T17:01:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 9</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514702/3514702_720p.mp4</video:content_loc>
      <video:duration>3894</video:duration>
      <video:publication_date>2026-10-04T17:01:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 8</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514701/3514701_720p.mp4</video:content_loc>
      <video:duration>3801</video:duration>
      <video:publication_date>2026-10-04T17:01:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 7</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514700/3514700_720p.mp4</video:content_loc>
      <video:duration>4047</video:duration>
      <video:publication_date>2026-10-04T17:01:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>감정이 폭발하는 마지막 후렴 · #열창 #클라이맥스 #슬픈노래 #감성보컬.mp4</video:title>
      <video:description>감정이 폭발하는 마지막 후렴 · #열창 #클라이맥스 #슬픈노래 #감성보컬.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514699/3514699_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T17:01:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>호소력 짙은 감성의 절정 · #가창력 #슬픈노래 #애절한노래 #감성.mp4 2</video:title>
      <video:description>호소력 짙은 감성의 절정 · #가창력 #슬픈노래 #애절한노래 #감성.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514697/3514697_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T17:01:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 56</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514696/3514696_720p.mp4</video:content_loc>
      <video:duration>1217</video:duration>
      <video:publication_date>2026-10-04T17:01:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>호소력 짙은 감성의 절정 · #가창력 #슬픈노래 #애절한노래 #감성.mp4</video:title>
      <video:description>호소력 짙은 감성의 절정 · #가창력 #슬픈노래 #애절한노래 #감성.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514695/3514695_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-04T17:00:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>깊은 그리움을 담은 후렴구 · #보컬 #음악추천 #감성발라드 #슬픈음악.mp4</video:title>
      <video:description>깊은 그리움을 담은 후렴구 · #보컬 #음악추천 #감성발라드 #슬픈음악.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514694/3514694_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-10-04T17:00:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>긴 여운을 남기는 마지막 소절 · #피날레 #여운 #감성곡 #슬픈노래.mp4</video:title>
      <video:description>긴 여운을 남기는 마지막 소절 · #피날레 #여운 #감성곡 #슬픈노래.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514693/3514693_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T17:00:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ozy Nyanyi Malah Dikira Setan · #ozy #simanisjembatanancol #lawakbanyolan #lucu.mp4</video:title>
      <video:description>Ozy Nyanyi Malah Dikira Setan · #ozy #simanisjembatanancol #lawakbanyolan #lucu.mp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514692/3514692_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T16:59:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sweira mehar</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514691/3514691_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T16:59:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>পেট্রোল পাম্প</video:title>
      <video:description>পেট্রোল পাম্প</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514690/3514690_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-04T16:59:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 408</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514688/3514688_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:58:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 3 hindi</video:title>
      <video:description>W – Two Worlds Ep 3 hindi new vidio #W–TwoWorldsEp3hindiW–TwoWorldsEp1viralvidiochanickdrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514687/3514687_720p.mp4</video:content_loc>
      <video:duration>3679</video:duration>
      <video:publication_date>2026-10-04T16:58:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 55</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514685/3514685_720p.mp4</video:content_loc>
      <video:duration>1196</video:duration>
      <video:publication_date>2026-10-04T16:57:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>common palm civet</video:title>
      <video:description>Common palm civet black #Musang #luwak #commonpalmcivet</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514684/3514684_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T16:57:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 407</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514683/3514683_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T16:57:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 406</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514682/3514682_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:57:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 405</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514681/3514681_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T16:57:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 404</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514680/3514680_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T16:56:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inggir bolo</video:title>
      <video:description>Nyore senja dengan motor tua #Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514678/3514678_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T16:56:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 403</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514677/3514677_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T16:56:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piya Aaye Na ❤️ | Romantic Music | Beautiful Girl &amp; Guitar | Cinematic AI Image</video:title>
      <video:description>A beautiful cinematic romantic music video featuring a dreamy AI image, expressive eyes, guitar, roses, and warm golden lights. ❤️🎸🌹 Enjoy the emotional atmosphere and beautiful visuals with Piya Aaye Na. If you enjoy romantic music and cinematic AI visuals, please Like, Share &amp; Follow/Subscribe. ❤️ #PiyaAayeNa #PiyaAayeNasong #Aashiqui2 #romanticsong #Hindiromanticsong #Bollywoodsong #lovesong #emotionalsong #romanticmusic #beautifulgirl #guitarmusic #AIimage #cinematicAI #romanticAIvideo #lovevideo #musicvideo #roses #beautifuleyes #Indiansong #Hindimusic #romanticvideo #sadlovesong #Bollywoodromanticmusic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514676/3514676_720p.mp4</video:content_loc>
      <video:duration>286</video:duration>
      <video:publication_date>2026-10-04T16:56:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 402</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514675/3514675_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T16:56:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 401</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514674/3514674_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:56:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 400</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514673/3514673_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T16:56:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Suami kurang ajar biar gua kasih pelajaran dulu biar mampus</video:title>
      <video:description>Kerjaan suami ngutang warung terus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514672/3514672_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T16:56:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 399</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514671/3514671_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T16:56:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 398</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514670/3514670_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T16:55:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 397</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514669/3514669_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:55:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 396</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514668/3514668_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:55:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514667</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514667/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 395</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514667/3514667_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:55:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 394</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514666/3514666_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:55:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary Jackpot episode 8 Hindi dubbed</video:title>
      <video:description>K drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514665/3514665_720p.mp4</video:content_loc>
      <video:duration>2770</video:duration>
      <video:publication_date>2026-10-04T16:55:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 393</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514664/3514664_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:54:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 54</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514663/3514663_720p.mp4</video:content_loc>
      <video:duration>1227</video:duration>
      <video:publication_date>2026-10-04T16:54:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 392</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514662/3514662_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:54:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Who&apos;s your favorite explorer?</video:title>
      <video:description>When Bugs says &quot;I know a shortcut&quot; but Daffy is holding the map 😂🗺️ The squad is LOST in the jungle and it&apos;s chaos! Who&apos;s your favorite explorer?</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514661/3514661_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T16:54:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 391</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514660/3514660_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:54:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 390</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514659/3514659_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T16:54:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sweat and Radiance</video:title>
      <video:description>&quot;Drenched in determination and a healthy gym glow. She’s not just working out—she’s defining her own version of strength, style, and beauty.&quot; #Girlworkingout #Femaleweightlifting #Gymsession #Personaltraining #Cardioexercise #Stretchingroutine #Strengthtraining #Pilatesworkout #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514658/3514658_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T16:54:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 389</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514657/3514657_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:54:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Solusi punya mobil tanpa modal</video:title>
      <video:description>Daftar SEWA KEPEMILIKAN sekarang khusus domisili Jabodetabek tanpa biaya awal Rp,0 caranya klik link berikut iyaa 👇 https://mo-vus.com/daftarlangsung?utm_source=agent_ads&amp;utm_medium=offline&amp;utm_content=Mohamad_Ali #sewamilik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514656/3514656_720p.mp4</video:content_loc>
      <video:duration>147</video:duration>
      <video:publication_date>2026-10-04T16:54:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 388</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514655/3514655_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T16:54:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 387</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514654/3514654_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:53:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Future city 034</video:title>
      <video:description>Future city 034</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514653/3514653_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T16:53:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 386</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514652/3514652_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:53:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nigerian market drama: why negotiating price is a hassle</video:title>
      <video:description>Mastering the art of haggling at a Lagos market is practically an extreme sport in 2026. This hilarious standoff shows exactly why bargaining with a stubborn trader requires nerves of steel. You will recognize the classic back-and-forth struggle that happens daily at Nigerian Market stalls. 💸 Rate this trader&apos;s negotiation skills 1-10! 👇 #Market #drama #naijacomedy #marketgist #bloodpressure #Nigeriangist</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514651/3514651_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T16:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak 4th October 2026 Episode 452</video:title>
      <video:description>Tum Se Tum Tak 4th October 2026 Episode 452 #Zee5 #episode #drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514650/3514650_720p.mp4</video:content_loc>
      <video:duration>1338</video:duration>
      <video:publication_date>2026-10-04T16:53:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 385</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514649/3514649_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:53:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 384</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514648/3514648_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:53:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 383</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514647/3514647_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:53:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 53</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514646/3514646_720p.mp4</video:content_loc>
      <video:duration>1174</video:duration>
      <video:publication_date>2026-10-04T16:52:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 382</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514645/3514645_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:52:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 381</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514644/3514644_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:52:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Fixers - Season 01 Episode 03</video:title>
      <video:description>#TheFixers #TheFixersseries #TheFixersdrama #TheFixersTVseries #TheFixersshow #TheFixersepisodes #TheFixersseason #TheFixerscast #TheFixersstoryline #TheFixersdramaseries #TheFixerslatestepisodes #TheFixersfullepisodes #TheFixersEnglishdrama #TheFixersseries2026 #TheFixersTVshowkeywords</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514643/3514643_720p.mp4</video:content_loc>
      <video:duration>2719</video:duration>
      <video:publication_date>2026-10-04T16:52:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sosuke Aizen used a defense called Bakudo 81 against Tessai Tsukabishi</video:title>
      <video:description>bleach episode 212 #Bleach #bleach</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514642/3514642_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-04T16:52:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 380</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514641/3514641_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T16:52:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 379</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514640/3514640_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:52:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imam ali 023</video:title>
      <video:description>Imam ali 023</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514639/3514639_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T16:52:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Solusi punya mobil sendiri tanpa ribet</video:title>
      <video:description>Daftar SEWA KEPEMILIKAN sekarang khusus domisili Jabodetabek tanpa biaya awal Rp,0 caranya klik link berikut iyaa 👇 https://mo-vus.com/daftarlangsung?utm_source=agent_ads&amp;utm_medium=offline&amp;utm_content=Mohamad_Ali #sewamilik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514638/3514638_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T16:52:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Guilty Plea In Scottsdale Red Robin Killing</video:title>
      <video:description>Guilty Plea In Scottsdale Red Robin Killing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514637/3514637_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-10-04T16:51:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher, bonita, sensual 378</video:title>
      <video:description>Mulher, bonita, sensual #Mulher #bonita #sensual</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514636/3514636_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:51:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freeza o destruidor</video:title>
      <video:description>Dragonball Z</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514635/3514635_720p.mp4</video:content_loc>
      <video:duration>139</video:duration>
      <video:publication_date>2026-10-04T16:51:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hasil onbid dapet promax sewa milik gacor</video:title>
      <video:description>Daftar SEWA KEPEMILIKAN sekarang khusus domisili Jabodetabek tanpa biaya awal Rp,0 caranya klik link berikut iyaa 👇 https://mo-vus.com/daftarlangsung?utm_source=agent_ads&amp;utm_medium=offline&amp;utm_content=Mohamad_Ali #sewamilik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514634/3514634_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-04T16:51:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 2 hindi</video:title>
      <video:description>W – Two Worlds Ep 2 hindi febspot new vidio #W–TwoWorldsEp2hindiW–TwoWorldsEp2englishkdramanewvidioW–chanic</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514633/3514633_720p.mp4</video:content_loc>
      <video:duration>3694</video:duration>
      <video:publication_date>2026-10-04T16:50:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TRAIN 2</video:title>
      <video:description>Train on #trainfypforyoupage</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514632/3514632_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T16:50:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Edits Dragonball</video:title>
      <video:description>Dragonball Z</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514631/3514631_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T16:50:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514630</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514630/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ordinary jackpot episode 7 hindi dubbed</video:title>
      <video:description>K drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514630/3514630_720p.mp4</video:content_loc>
      <video:duration>2769</video:duration>
      <video:publication_date>2026-10-04T16:50:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goku contra Colla</video:title>
      <video:description>Dragonball z</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514629/3514629_720p.mp4</video:content_loc>
      <video:duration>155</video:duration>
      <video:publication_date>2026-10-04T16:50:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kereta api lewat 2</video:title>
      <video:description>Kereta api lewat di perlintasan #perjalanan #keretaapi #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514628/3514628_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:50:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivation 675</video:title>
      <video:description>Motivasio #Motivasi #usa #polandia #inggris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514627/3514627_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:49:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Robin Hood Takes Action</video:title>
      <video:description>If you enjoy Robin Hood, medieval battles, sword fights, action movies, and epic movie scenes, make sure to LIKE 👍, COMMENT 💬, and SUBSCRIBE 🔔 for more exciting clips and unforgettable moments!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514626/3514626_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T16:49:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sewa mobil gratis tanpa modal jadi milik</video:title>
      <video:description>Daftar SEWA KEPEMILIKAN sekarang khusus domisili Jabodetabek tanpa biaya awal Rp,0 caranya klik link berikut iyaa 👇 https://mo-vus.com/daftarlangsung?utm_source=agent_ads&amp;utm_medium=offline&amp;utm_content=Mohamad_Ali #Sewamilik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514625/3514625_720p.mp4</video:content_loc>
      <video:duration>117</video:duration>
      <video:publication_date>2026-10-04T16:49:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514624</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514624/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Akaza Vs Tomioka</video:title>
      <video:description>Demonslayer</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514624/3514624_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-04T16:49:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GOKU vs Cell épica batalha</video:title>
      <video:description>Dragonball Z</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514623/3514623_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T16:48:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mistério Anime</video:title>
      <video:description>Anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514622/3514622_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T16:48:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sewa Mobil Jadi Milik Sendiri 3</video:title>
      <video:description>Daftar SEWA KEPEMILIKAN sekarang khusus domisili Jabodetabek tanpa biaya awal Rp,0 caranya klik link berikut iyaa 👇 https://mo-vus.com/daftarlangsung?utm_source=agent_ads&amp;utm_medium=offline&amp;utm_content=Mohamad_Ali #sewamilik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514621/3514621_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-10-04T16:48:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goku da uma surra em Majin Boo no super Saiyajin 3</video:title>
      <video:description>Dragonball Z</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514620/3514620_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-10-04T16:47:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rare Purple-Red Bird — Stunning Beauty in Indonesian Rainforest 🇮🇩🦜</video:title>
      <video:description>Majestic colorful bird spreading its wings in the lush green jungle of Indonesia. Nature&apos;s hidden gem — breathtaking &amp; unforgettable! 🌿💜✨ #bird #rarebird #wildlife #indonesia #rainforest #jungle #nature #colorful #purple #red #exotic #beautiful #forest #tropical #amazing #viral #fyp👉KlikADDVIDEOPublikasikan→Selesai🚀Sudah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514619/3514619_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T16:47:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🟠 Satsman exists to onboard the world to Bitcoin. In a fun educational way!</video:title>
      <video:description>What is Satsman.com? 🦸🏼‍♂️ Think Duolingo meets Bitcoin 🟠 Satsman exists to onboard the world to Bitcoin. In a fun educational way! 🌏 Learn Bitcoin, Stack Sats, Have Fun! #Bitcoin #satsman #exists</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514618/3514618_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-10-04T16:47:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 52</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514617/3514617_720p.mp4</video:content_loc>
      <video:duration>1111</video:duration>
      <video:publication_date>2026-10-04T16:47:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trip malam</video:title>
      <video:description>Orderan di malam hari kita gass keun #ojolbatam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514616/3514616_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T16:47:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Forma insana de Goku</video:title>
      <video:description>Dragonball Super Heroes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514615/3514615_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-10-04T16:47:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tengah laut merak bakaehuni</video:title>
      <video:description>Perjalanan ke sumatera #Travel #kapal #viral #laut #air</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514614/3514614_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T16:46:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Foto Ai</video:title>
      <video:description>Apa kah ini di sebut dengan zaman yang sangat maju . Apa masih belum</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514613/3514613_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T16:46:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Preocupação com vegeta</video:title>
      <video:description>Dragonball Z</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514612/3514612_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T16:46:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rei Cold vs Trunks</video:title>
      <video:description>Dragonball Z</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514611/3514611_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-10-04T16:46:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 51</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514610/3514610_720p.mp4</video:content_loc>
      <video:duration>1237</video:duration>
      <video:publication_date>2026-10-04T16:46:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O ataque de Cell juniores</video:title>
      <video:description>Dragonball Z</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514609/3514609_720p.mp4</video:content_loc>
      <video:duration>301</video:duration>
      <video:publication_date>2026-10-04T16:45:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hero meta mobile legend zilong</video:title>
      <video:description>Vidio pendek #Mobilelegend</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514608/3514608_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T16:45:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivation 674</video:title>
      <video:description>Motivation #Motivation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514607/3514607_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T16:45:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>aping#</video:title>
      <video:description>cantik nya aping@# #april</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514606/3514606_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T16:45:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Guerreiros Z em Apuros</video:title>
      <video:description>Dragonball</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514605/3514605_720p.mp4</video:content_loc>
      <video:duration>136</video:duration>
      <video:publication_date>2026-10-04T16:44:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inggris 2</video:title>
      <video:description>#Travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514604/3514604_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:44:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FREELANCE 5</video:title>
      <video:description>Game penghasil uang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514603/3514603_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T16:44:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FREELANCE 4</video:title>
      <video:description>Game penghasil uang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514602/3514602_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T16:44:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Luxury Living Room with Stunning 3D Gold Bar Epoxy Floor | Ultimate Luxury Interior</video:title>
      <video:description>Experience the ultimate luxury living room featuring a stunning 3D gold bar epoxy floor, glossy reflections, and elegant modern interior design. This breathtaking luxury floor design creates a unique, premium, and futuristic atmosphere. Perfect inspiration for luxury home interiors and creative epoxy flooring ideas. #LuxuryLivingRoom #3DGoldFloor #EpoxyFloor #LuxuryInterior #InteriorDesign #LuxuryHome #GoldFloor #3DFloorDesign #ModernInterior #LuxuryDesign</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514601/3514601_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-04T16:43:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FREELANCE 3</video:title>
      <video:description>Game penghasil uang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514600/3514600_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T16:43:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny cartoon video 16</video:title>
      <video:description>Follow Meeeeeeeeee #Funnyvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514599/3514599_720p.mp4</video:content_loc>
      <video:duration>113</video:duration>
      <video:publication_date>2026-10-04T16:43:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Giant Parrot Can&apos;t Fly... But Its Story Is Incredible!</video:title>
      <video:description>Did you know? 🦜 The Kakapo is the world&apos;s largest flightless parrot and is found only in New Zealand. This rare bird is active at night and is carefully protected through conservation programs to help prevent its extinction. 💚 Protect rare wildlife—every species matters. 👇 Follow for more amazing animal facts! #kakaporareanimalsshortsshortsvideofyptrending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514598/3514598_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-10-04T16:43:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FREELANCE 2</video:title>
      <video:description>Game penghasil uang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514597/3514597_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T16:43:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata 40</video:title>
      <video:description>Emang bener gitu #katakata</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514596/3514596_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T16:43:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FREELANCE</video:title>
      <video:description>Game penghasil uang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514595/3514595_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T16:42:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What happens when an earthquake strikes beneath a coastline? 🌊</video:title>
      <video:description>What happens when an earthquake strikes beneath a coastline? 🌊🌍 A sudden movement along a fault can lift, sink, or shift the land, dramatically changing the shape of the shoreline in seconds. Discover how earthquakes can literally reshape the map beneath our feet. #Ai #earthquake #geography</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514594/3514594_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T16:42:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>syairabunawas I’tiraf sholawat lirik islami status Owner Qalbu</video:title>
      <video:description>“Qalbi tenang ketika mengingat Allah, karena hati yang dekat dengan-Nya tidak mudah kehilangan arah.”</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514593/3514593_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-10-04T16:42:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 50</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514592/3514592_720p.mp4</video:content_loc>
      <video:duration>1219</video:duration>
      <video:publication_date>2026-10-04T16:42:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Golden Hour Promises</video:title>
      <video:description>&quot;Golden light fading into twilight, leaving behind a tranquil sky painted in shades of orange and purple. A quiet moment where time seems to stand still.&quot; #Serene #sunsetPeaceful #dusk #Aesthetic #sunset #Cozyevening #Sunsetaesthetic #Tranquil #sky #Sunsetvibes #Warm #eveninglight</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514591/3514591_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T16:41:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vario 125 ganteng co!</video:title>
      <video:description>Ini vidio Vario terbaru #Vario</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514590/3514590_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T16:41:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Helpppp 2</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514589/3514589_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T16:41:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Help plêiade subscribe</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514588/3514588_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T16:40:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O amor ao próximo, ao estudo e ao trabalho,  Para que façamos de nossa Pátria</video:title>
      <video:description>Ó Deus onipotente, Princípio e fim de todas as coisas, Infundi em nós, brasileiros, O amor ao próximo, ao estudo e ao trabalho, Para que façamos de nossa Pátria Uma terra de paz, ordem e grandeza. Velai, Senhor, Pelos destinos do Brasil. Assim seja. Amém 🙏</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514587/3514587_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T16:40:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ONE LAMPSTAND. SEVEN LAMPS. WHY?</video:title>
      <video:description>🔥 ONE LAMPSTAND. SEVEN LAMPS. WHY? Inside the Tabernacle, God commanded one golden lampstand with seven lamps—and its light was to burn continually. Centuries later, John saw seven golden lampstands, and Jesus revealed: “The seven lampstands are the seven churches.” — Revelation 1:20 Was the Tabernacle lampstand pointing to something greater? 👀 👇 What do you think the seven lamps represent? #Gospel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514586/3514586_720p.mp4</video:content_loc>
      <video:duration>159</video:duration>
      <video:publication_date>2026-10-04T16:40:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A love other than yours episode 5 hindi dubbed</video:title>
      <video:description>K drama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514585/3514585_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T16:39:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 49</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514584/3514584_720p.mp4</video:content_loc>
      <video:duration>1166</video:duration>
      <video:publication_date>2026-10-04T16:39:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Susbcribe 9</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514583/3514583_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-10-04T16:39:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tapminings</video:title>
      <video:description>Web penghasil uang</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514582/3514582_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:39:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pelos destinos do Brasil.  Assim seja. Amém 🙏</video:title>
      <video:description>Ó Deus onipotente, Princípio e fim de todas as coisas, Infundi em nós, brasileiros, O amor ao próximo, ao estudo e ao trabalho, Para que façamos de nossa Pátria Uma terra de paz, ordem e grandeza. Velai, Senhor, Pelos destinos do Brasil. Assim seja. Amém 🙏</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514581/3514581_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T16:39:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>motorbike riding 2</video:title>
      <video:description>motorbike riding just an ordinary day</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514580/3514580_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T16:39:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Help please 3</video:title>
      <video:description>#Videoviral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514579/3514579_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T16:39:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 6</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514578/3514578_720p.mp4</video:content_loc>
      <video:duration>3943</video:duration>
      <video:publication_date>2026-10-04T16:38:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 5</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514577/3514577_720p.mp4</video:content_loc>
      <video:duration>3867</video:duration>
      <video:publication_date>2026-10-04T16:38:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514576</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514576/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 4</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514576/3514576_720p.mp4</video:content_loc>
      <video:duration>3885</video:duration>
      <video:publication_date>2026-10-04T16:38:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 3</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514575/3514575_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T16:38:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>such a happy morning 🌞 🌄</video:title>
      <video:description>just an ordinary day</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514574/3514574_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:37:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Blackpink 13</video:title>
      <video:description>Blackpink #Blackpink</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514573/3514573_720p.mp4</video:content_loc>
      <video:duration>127</video:duration>
      <video:publication_date>2026-10-04T16:37:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUATU SAAT NANTI KALO KIAMAT SUDAH TERJADI.</video:title>
      <video:description>PERBAYAK SHOLAWAT DAN IBADAH MENGAJI. #MEKAHMADINAHALAQSA</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514572/3514572_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T16:37:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 48</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514571/3514571_720p.mp4</video:content_loc>
      <video:duration>1141</video:duration>
      <video:publication_date>2026-10-04T16:35:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Believers meal 2</video:title>
      <video:description>Enjoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514570/3514570_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T16:35:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Luna Hart Dance 11</video:title>
      <video:description>Indian Girl Luna Hart Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514569/3514569_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T16:35:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Building a safe shelter with fine on ancient tree solo bushcraft</video:title>
      <video:description>#travel</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514568/3514568_720p.mp4</video:content_loc>
      <video:duration>243</video:duration>
      <video:publication_date>2026-10-04T16:34:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love portion</video:title>
      <video:description>Enjoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514567/3514567_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:33:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New model sort video 4</video:title>
      <video:description>New model sort video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514566/3514566_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T16:33:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 47</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514565/3514565_720p.mp4</video:content_loc>
      <video:duration>1098</video:duration>
      <video:publication_date>2026-10-04T16:33:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Religious 6</video:title>
      <video:description>Believers meal</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514564/3514564_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:33:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice and warm</video:title>
      <video:description>In love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514563/3514563_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T16:32:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Janda 3</video:title>
      <video:description>#Cantik #wanitacantik #RX-King #janda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514562/3514562_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T16:32:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kasauti Zindagi ki episode 46</video:title>
      <video:description>Drama Indianserial #DramaIndianserial</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514561/3514561_720p.mp4</video:content_loc>
      <video:duration>1221</video:duration>
      <video:publication_date>2026-10-04T16:32:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Energi, gaya, dan senyum jadi satu. 😍🎶</video:title>
      <video:description>✨ Sekali bergerak, langsung bikin suasana makin hidup! 💃🔥 #DanceVibes #Dancecover #Danceindonesia #Viral #FYP #Trending #Videodance #Joget #HappyVibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514560/3514560_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-04T16:32:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Honey moon enjoy</video:title>
      <video:description>Enjoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514559/3514559_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:31:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yogyakarta 2</video:title>
      <video:description>#Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514558/3514558_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T16:31:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love apology</video:title>
      <video:description>Enjoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514557/3514557_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:31:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It&apos;s Slavery...</video:title>
      <video:description>It&apos;s Slavery... __#114 __ #motivationalquotes__buildyourselfup__bussinessmindset__shortsmp4</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514556/3514556_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T16:30:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lokasi pemancingan</video:title>
      <video:description>#Fishing #alampemancingan #gacor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514555/3514555_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T16:30:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Testing 8</video:title>
      <video:description>The disabled</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514554/3514554_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:30:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hasiyt 3</video:title>
      <video:description>hasiyt 3</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514553/3514553_720p.mp4</video:content_loc>
      <video:duration>8910</video:duration>
      <video:publication_date>2026-10-04T16:30:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time to</video:title>
      <video:description>Pay</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514552/3514552_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:30:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kids puzzle</video:title>
      <video:description>Enjoy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514551/3514551_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:29:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strong girl bong soon ep 14 Hindi dubbed</video:title>
      <video:description>Strong girl bong soon episode 14 Hindi dubbed K-drama #Hindidubbed #K-drama #stronggirlbongsoon #serialkiller #stronggirl #happyending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514550/3514550_720p.mp4</video:content_loc>
      <video:duration>4057</video:duration>
      <video:publication_date>2026-10-04T16:29:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>neshu ali</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514549/3514549_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T16:29:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelas de frutas 12</video:title>
      <video:description>Reencontro dos desconhecidos Parte 5 #Reencontro #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514548/3514548_720p.mp4</video:content_loc>
      <video:duration>134</video:duration>
      <video:publication_date>2026-10-04T16:29:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Radio Romance S1 (K-Drama) HINDI Episode 2</video:title>
      <video:description>Upload By RJ Soumen Official Your Ultimate Destination for K-Dramas &amp; Web Series 🎬 Discover the latest K-Dramas, Korean shows, web series, and much more—all in one place. Stay updated with new releases, ongoing series, upcoming shows, episode information, cast details, genres, and the latest entertainment news. From romantic K-Dramas and thrilling mysteries to action-packed series, comedy, fantasy, and international web series, our platform is designed for entertainment lovers who want everything organized in one place. ✨ What you can discover: - 🇰🇷 Latest K-Dramas &amp; Korean series - 🌍 Web series from around the world - 📅 Upcoming &amp; currently airing shows - 🎭 Cast, characters &amp; genre information - ⭐ Ratings, reviews &amp; recommendations - 🔔 Updates about new episodes and releases - 🎬 Movies, specials &amp; other entertainment content One platform. Endless stories. Your next favorite series starts here.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514547/3514547_720p.mp4</video:content_loc>
      <video:duration>3894</video:duration>
      <video:publication_date>2026-10-04T16:28:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Didn&apos;t Expect To Find Tom Cruise Like This</video:title>
      <video:description>I Didn&apos;t Expect To Find Tom Cruise Like This</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514546/3514546_720p.mp4</video:content_loc>
      <video:duration>172</video:duration>
      <video:publication_date>2026-10-04T16:28:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sweetiewash</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514545/3514545_720p.mp4</video:content_loc>
      <video:duration>265</video:duration>
      <video:publication_date>2026-10-04T16:28:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Discover the beauty of nature and unforgettable travel moments</video:title>
      <video:description>✨ Discover the beauty of nature and unforgettable travel moments! 🌿🏞️ Escape the busy life and explore breathtaking landscapes, peaceful surroundings, and hidden gems waiting to be discovered. Every journey brings a new story, a new adventure, and memories that last forever. 🌅❤️ Would you love to visit this beautiful place? Let us know in the comments! 👇 #TravelTravelVlogNatureBeautifulPlacesTravelAdventureExploreNatureHiddenGemWanderlustVacationTourismNatureLoversScenicViewTravelShortsYouTubeShortsShortsExploreTheWorldIndonesiaTravelWonderfulIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514544/3514544_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-10-04T16:28:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wonders shall never end 2</video:title>
      <video:description>Wonders shall never end #Story #truelifestory #usafespotfebspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514543/3514543_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-10-04T16:28:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fashion model 2</video:title>
      <video:description>fashion and model</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514542/3514542_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:27:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Di godain mongki</video:title>
      <video:description>Video lucu #lucuviralfunny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514541/3514541_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T16:27:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>naturevillagevibe</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514540/3514540_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T16:26:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat &amp; Dog 2</video:title>
      <video:description>When cats have martial arts knowledge #Memekungfucatdogfighter</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514539/3514539_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T16:26:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>modeling 4</video:title>
      <video:description>fashion and model</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514538/3514538_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:26:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strength training 2 2</video:title>
      <video:description>Let&apos;s crush today&apos;s exercises #Viralchinegymwomenglutes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514537/3514537_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:26:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Incredible Mega Factories You’ve Never Seen Before!</video:title>
      <video:description>Witness the perfect harmony of smart teams and cutting-edge modern machines inside the top factories of the US, UK, and Mexico. From high-speed automation to mind-blowing precision, this mega manufacturing process is oddly satisfying to watch. You’ve never seen anything like this before! #MegaFactories #ModernMachines #SatisfyingVideo #Automation #Manufacturing #BehindTheScenes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514536/3514536_720p.mp4</video:content_loc>
      <video:duration>211</video:duration>
      <video:publication_date>2026-10-04T16:25:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>iqbal Mustafa abbasi</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514535/3514535_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T16:25:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>English 12</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514534/3514534_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:25:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cute little hajis in makkah sarif</video:title>
      <video:description>#Macca #cutelittlehajisinmakkahsarif</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514533/3514533_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T16:25:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ryujin powerfull dancing</video:title>
      <video:description>Dancing ryujin #itzy #kpop #dancing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514532/3514532_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T16:24:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Golden Yellow Princess Gown — Pure Sunshine Elegance 💛✨👑</video:title>
      <video:description>Stunning bright yellow dress with matching handbag &amp; shoes — handcrafted beauty from Indonesia 🇮🇩. Luxurious, elegant &amp; unforgettable! 💫 #yellowdress #goldengown #princessstyle #luxurykids #indonesianbeauty #royalfashion #handmade #floralembroidery #elegant #fashiondesign #stylish #premium #viral #trending #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514531/3514531_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:24:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tidurrr</video:title>
      <video:description>#Slepy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514530/3514530_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-10-04T16:24:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goyang an maut Jagan kasih kwndor</video:title>
      <video:description>Expresi goyang Kanan kiri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514529/3514529_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T16:24:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Humor 40</video:title>
      <video:description>Hahahahahaha #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514528/3514528_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T16:23:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>main silat</video:title>
      <video:description>training martial art</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514527/3514527_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T16:22:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senjaa 2</video:title>
      <video:description>#Sunset #senja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514526/3514526_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T16:22:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gadis cantik mulus dan mempesona</video:title>
      <video:description>Gadis cantik idaman para pria</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514525/3514525_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:21:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hero meta mobile legend</video:title>
      <video:description>Vidio pendek #Mobilelegend</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514524/3514524_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T16:21:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cute baby 51</video:title>
      <video:description>#cutebaby</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514523/3514523_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T16:21:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night 17</video:title>
      <video:description>Go to sukabumi #Ride #jalan #motor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514522/3514522_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T16:20:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strange Bird 2</video:title>
      <video:description>#StrangeBird</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514521/3514521_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-10-04T16:20:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sad toy</video:title>
      <video:description>Sad!! #Sad #febspor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514520/3514520_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T16:19:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Real Campfire Crackling Sound | 4K Cozy Fireplace ASMR for Sleep, Study &amp; Relaxation</video:title>
      <video:description>Experience the warmth and tranquility of a cozy campfire with natural crackling wood sounds. Perfect for creating a calming atmosphere wherever you are. Best used for: 🛌 Falling asleep faster &amp; relieving insomnia 📚 Background ambience for studying, reading, or working 🧘 Meditation, stress relief, and deep relaxation 🕯️ Setting a cozy, peaceful mood at home #ASMR #​Campfire #Sounds #​Relaxing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514519/3514519_720p.mp4</video:content_loc>
      <video:duration>312</video:duration>
      <video:publication_date>2026-10-04T16:19:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cekido&apos;</video:title>
      <video:description>#Beautiful #girls #jelita #wanita #gadis #cantik #perempuan #bungadesa #gabut #syakira #ayu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514518/3514518_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T16:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ya rabe E Mustafa Tu mujhe hajj pe bula.</video:title>
      <video:description>#YarabeEMustafaTumujhehajjpebula</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514517/3514517_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T16:18:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bird girl</video:title>
      <video:description>Animal lover</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514516/3514516_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T16:18:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>W – Two Worlds Ep 1 hindi</video:title>
      <video:description>W – Two Worlds Ep 1 hindi febsport #W–TwoWorldsEp1hindiW–TwoWorldsEpW–TwoWorldsEpenglishnewkdrama2026</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514515/3514515_720p.mp4</video:content_loc>
      <video:duration>3667</video:duration>
      <video:publication_date>2026-10-04T16:17:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ya rabe E Mustafa Tu mujhe hajj pe</video:title>
      <video:description>#YarabeEMustafaTumujhehajjpe</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514514/3514514_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T16:17:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny vidio 64</video:title>
      <video:description>Lol #Lol #funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514513/3514513_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T16:16:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Donghua 22</video:title>
      <video:description>Li xingyun #Donghua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514512/3514512_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-04T16:16:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ikan mas ajaib</video:title>
      <video:description>Ikan masa ajaib #Daramakekor</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514511/3514511_720p.mp4</video:content_loc>
      <video:duration>396</video:duration>
      <video:publication_date>2026-10-04T16:16:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiada Daya dan upaya, kecuali dengan kekuatan Allah</video:title>
      <video:description>Tanpa Allah, kita tidak akan punya kekuatan untuk menghadapi hidup. Berserah kepada-Nya bukan berarti lemah, tetapi percaya bahwa Allah selalu memberi jalan di setiap kesulitan.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514510/3514510_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T16:16:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The tension in this conversation</video:title>
      <video:description>#Thetensioninthisconversation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514509/3514509_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:15:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Donghua 21</video:title>
      <video:description>Long haochen #Donghua</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514508/3514508_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T16:15:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hello machinist</video:title>
      <video:description>The booming sound of the locomotive and the train driver greeting the afternoon. #backpakerworld</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514507/3514507_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-10-04T16:15:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Ameesha Dance</video:title>
      <video:description>Indian Girl Ameesha Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514506/3514506_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T16:15:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>afternoon walk</video:title>
      <video:description>girls afternoon walk</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514505/3514505_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:15:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Jab Baat ego pe Aa jaye to#</video:title>
      <video:description>#Jab Baat ego pe Aa jaye to# #JabBaategopeAajayeto</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514504/3514504_720p.mp4</video:content_loc>
      <video:duration>107</video:duration>
      <video:publication_date>2026-10-04T16:15:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Swans Land on Water Like a Mini Airplane</video:title>
      <video:description>#HowSwansLandonWaterLikeaMiniAirplane</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514503/3514503_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T16:15:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>শিবপুর মন্দির</video:title>
      <video:description>শিবপুর মন্দির</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514502/3514502_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T16:14:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FULL HOUSE=풀하우스 EP 13</video:title>
      <video:description>DORAMA 16 EP: EP 13 #dorama #doramas #drama #doramachines #shortdrama #dramacoreano #newdrama #koreandrama #dramahistorico #dramaseries #familydrama #yefikerdrama #dramareview #chinesedrama #bestdramas #dramacurto #emotionaldrama #ethiopiadrama #romanticdrama #dramasasiaticos #dramacurtochines #newamharicdrama #dramaderomance #dramacurtoemocionante #dramacurtoemportugues #ethiopiannewdrama2025</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514501/3514501_720p.mp4</video:content_loc>
      <video:duration>3713</video:duration>
      <video:publication_date>2026-10-04T16:14:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>supporter footboll</video:title>
      <video:description>jakarta indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514500/3514500_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T16:14:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Simpang 4 pasar trem</video:title>
      <video:description>Di jln pasar trem pangkal pinang #pasar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514499/3514499_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T16:13:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>harvesting fruit seedlings</video:title>
      <video:description>choosing the best fruit seedlings to plant in the home garden #gardening</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514498/3514498_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T16:13:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nature&apos;s creatures heal all worries Birds in the wild Wildlife photography Protect birds</video:title>
      <video:description>#NaturescreatureshealallworriesBirdsinthewildWildlifephotographyProtectbirds</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514497/3514497_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T16:12:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>From Dull and Rusty to Fresh Again! 🔥 | Car Body Repair &amp; Paint Process</video:title>
      <video:description>This time, we&apos;re working on the body repair and painting of a pickup truck that was in quite a dull condition and had several areas that needed repair. The process starts with inspecting the body condition, panel repair, sanding, surface leveling, and then painting. Each stage is carried out step by step to ensure a neat and optimal final result. 🔧 Work includes: • Body repair • Body panel repair • Sanding &amp; surface leveling • Pre-painting preparation • Body painting • Finishing &amp; detailing It&apos;s not just painting, but restoring the car&apos;s appearance to a more presentable and fresh look. 🚗✨ #BodyRepairCarPaintCarWorkshopCarBodyRepairCarPaintingCarRestorationCarRepairAutomotiveCarPaintingProcess</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514496/3514496_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T16:12:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fiti judul lelang</video:title>
      <video:description>#Fiti jbolo #Fiti</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514495/3514495_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T16:12:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat is ha a magician 🎩</video:title>
      <video:description>A Magical cat video #funny cat story Cat lover #Catstory</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514494/3514494_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-10-04T16:11:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A human statue</video:title>
      <video:description>A human statue stands beautifully in a public place. It looks like a real person, with detailed features and a strong pose. The statue is made to honor or remember someone. #Statue #human #art</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514493/3514493_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T16:11:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🇺🇲 TROMP THE HIDDEN SIDE</video:title>
      <video:description>😭 La face cachée de TROMP 👍 Like, comment &amp; subscribe for more . 🔔 T’abonner pour plus de vidéos #Amérique #TROMP #Mexique #Amériquedunord #Amériquedusud</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514492/3514492_720p.mp4</video:content_loc>
      <video:duration>146</video:duration>
      <video:publication_date>2026-10-04T16:10:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motorcycle on the way</video:title>
      <video:description>Subrek guys #Travel #ontheway #hollyday #happy #love</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514491/3514491_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T16:10:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dr. Strange is aura farming 2</video:title>
      <video:description>#DrStrange</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514490/3514490_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-10-04T16:09:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesia car</video:title>
      <video:description>RC CAR</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514489/3514489_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:09:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat is a teacher</video:title>
      <video:description>A teacher cat #cat is teaching Funny cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514488/3514488_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-10-04T16:09:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat  goes delivered food but eat himself</video:title>
      <video:description>Cat dilevry boy Ai cat story Funny cat story video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514487/3514487_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-10-04T16:08:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#1vs3 RIOT FF 100 leval ka Banda cylenj #</video:title>
      <video:description>#1vs3 RIOT FF 100 leval ka Banda cylenj # #1vs3RIOTFF100levalkaBandacylenj</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514486/3514486_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T16:08:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat found the trasuer maps</video:title>
      <video:description>#funny cat story Ai cat story video #cat lovers ♥️</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514485/3514485_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-04T16:06:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514484</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514484/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FULL HOUSE=풀하우스 EP 12</video:title>
      <video:description>DORAMA 16 EP: EP 12 #dorama #doramas #drama #doramachines #shortdrama #dramacoreano #newdrama #koreandrama #dramahistorico #dramaseries #familydrama #yefikerdrama #dramareview #chinesedrama #bestdramas #dramacurto #emotionaldrama #ethiopiadrama #romanticdrama #dramasasiaticos #dramacurtochines #newamharicdrama #dramaderomance #dramacurtoemocionante #dramacurtoemportugues #ethiopiannewdrama2025</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514484/3514484_720p.mp4</video:content_loc>
      <video:duration>3683</video:duration>
      <video:publication_date>2026-10-04T16:06:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indonesia 57</video:title>
      <video:description>RC Car</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514483/3514483_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:06:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pakai liftik biar banyak cowok cowok yang tergoda</video:title>
      <video:description>Menarik perhatian seorang pria wanita cantik ini memakai liftik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514482/3514482_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T16:05:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BOCA JR. X VASCO DA GAMA AO VIVO COM IMAGENS - COPA SULAMERICANA 2026 - JOGO DE HOJE - PES 2021</video:title>
      <video:description>📺 🏆SIMULAÇÃO REALISTA ENTRE BOCA JUNIORS X VASCO DA GAMA AO VIVO COM IMAGENS! 🔥 🚨 É JOGÃO PELA COPA SUL-AMERICANA 2026! O BOCA JUNIORS enfrenta o VASCO DA GAMA em um confronto eletrizante, recriado em uma SIMULAÇÃO REALISTA NO PES 2021! 🎮⚽ 🔵🟡 BOCA JUNIORS OU ⚫⚪ VASCO? 👀 QUEM VAI LEVAR A MELHOR NESTE GRANDE DUELO? 👇 ANTES DE ASSISTIR, DEIXE SEU PALPITE! ⚽ Qual será o placar final? 🔥 Quem vai marcar o primeiro gol? 🎯 Teremos virada? 🏆 Quem vai sair com a vitória? 🎮 Acompanhe a partida completa no PES 2021, com gráficos realistas, jogadas incríveis, gols, defesas espetaculares e muita emoção do primeiro ao último minuto! 💬 COMENTE SEU PLACAR! Será que você consegue acertar o resultado da simulação? 👇 👍 CURTIU A SIMULAÇÃO? DEIXE O LIKE! 🔔 INSCREVA-SE NO CANAL! 🚨 ATIVE O SININHO para não perder as próximas simulações! 🎮 Aqui você encontra simulações realistas de futebol no PES 2021, com Copa Sul-Americana, Libertadores, Brasileirão, Série B, Seleções e grandes confrontos do futebol mundial. 📌 IMPORTANTE: Este vídeo é uma SIMULAÇÃO VIRTUAL PRODUZIDA NO PES 2021. Não é uma transmissão oficial e não utiliza imagens reais da partida. 🔥 BOCA JUNIORS X VASCO DA GAMA — FAÇA SEU PALPITE, ASSISTA ATÉ O FINAL E COMENTE QUEM VAI VENCER! 🔥 #BocaJuniors #Vasco #SulAmericana2026 #PES2021 #SimulacaoRealista #BOLEIROSDOPES2021 Boca Juniors x Vasco, Boca Juniors Vasco ao vivo, Boca Juniors x Vasco ao vivo com imagens, Boca Juniors ao vivo, Vasco ao vivo, Boca Juniors hoje, Vasco hoje, jogo do Boca Juniors, jogo do Vasco, Boca Juniors x Vasco Sul-Americana, Copa Sul-Americana 2026, Sul-Americana 2026, Boca Juniors Sul-Americana, Vasco Sul-Americana, Boca Juniors PES 2021, Vasco PES 2021, PES 2021, PES 2021 gameplay, PES 2021 simulação, PES 2021 realista, PES 2021 gráficos realistas, simulação</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514481/3514481_720p.mp4</video:content_loc>
      <video:duration>677</video:duration>
      <video:publication_date>2026-10-04T16:04:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Peaceful Drive Through Beautiful Kuningan Village Road | West Java Indonesia</video:title>
      <video:description>Experience the most peaceful drive through Kuningan Village, West Java, Indonesia. No traffic, blue sky, white clouds, and green nature everywhere. This is real Kuningan Village Life - quiet, beautiful, and relaxing. Perfect for healing and escaping the busy city. 📍 Location: Kuningan, West Java, Indonesia 🎥 Kuningan Village Life - Daily Life in Indonesian Countryside #KuninganVillageLife #ruralIndonesia #peacefulvillageroad #drivinginIndonesia #WestJavavillage #Indonesiancountryside #relaxingdrive #villagelifeIndonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514480/3514480_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T16:03:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The name of the area in Jakarta is inspired by the name of a plant</video:title>
      <video:description>It turns out that the name of the popular area in Jakarta was taken from the name of a plant that was once commonly found there. #Fact #education #plants #unique #Jakarta #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514479/3514479_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T16:03:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514478</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514478/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alpha Gameplay 2</video:title>
      <video:description>#mlbb #mobilelegends</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514478/3514478_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T16:03:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>once sunny day 🌻😎</video:title>
      <video:description>once sunny day . summer time 🌻😎</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514477/3514477_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:03:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>reda queen</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514476/3514476_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T16:02:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jabatika fruit</video:title>
      <video:description>Jabatika good fruit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514475/3514475_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T16:02:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514474</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514474/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Fixers - Season 01 Episode 02</video:title>
      <video:description>#TheFixers #TheFixersseries #TheFixersdrama #TheFixersTVseries #TheFixersshow #TheFixersepisodes #TheFixersseason #TheFixerscast #TheFixersstoryline #TheFixersdramaseries #TheFixerslatestepisodes #TheFixersfullepisodes #TheFixersEnglishdrama #TheFixersseries2026 #TheFixersTVshowkeywords</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514474/3514474_720p.mp4</video:content_loc>
      <video:duration>2661</video:duration>
      <video:publication_date>2026-10-04T16:01:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quando suas forças acabarem, apoie-se naquele que nunca perde as forças</video:title>
      <video:description>“Quando não existir caminho diante dos seus olhos, Deus ainda poderá abrir uma porta.” “Isaías 43:19 diz: ‘Eis que faço uma coisa nova.’” “Não permita que o tamanho do problema seja maior que a sua confiança em Deus.” “Declare hoje: ‘Senhor, guia os meus passos e abre o caminho certo.’” “Pare de alimentar o medo e comece a alimentar a sua fé.” “Deus não disse que você nunca enfrentaria batalhas, mas prometeu estar com você.” (Salmo 23:4) “Você pode atravessar o vale sem permanecer nele para sempre.” “Se você confia que Deus está contigo, escreva: ‘NÃO VOU TEMER!’” #oração #poder #Deus #JesusCristo #Jesus #EspiritoSanto #orar #oraçãodamanhã #oraçãodanoite #oraçãodamadrugada #libertação #recuperação #noite #manhã #Biblia #mensagembiblica #fé #palavradeDeus #Salmo #meditação #prosperidade #ansiedade #adoração #proverbios #pregação #vitória #perdão #paz #OraçãoSalmo91PalavraDeDeusDeusÉFielOraçãoPoderosaFéEmDeusMensagemBiblicaOraçãoDoDia #MensagemBiblicaPalavraDeDeusFéDeusMotivaçãoCristãEsperançaEmDeusJesusFéEmDeus</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514473/3514473_720p.mp4</video:content_loc>
      <video:duration>166</video:duration>
      <video:publication_date>2026-10-04T16:01:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asikin aja 5</video:title>
      <video:description>#Music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514472/3514472_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T16:01:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eka jugs</video:title>
      <video:description>Eka juga. #Ekajugs</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514471/3514471_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T16:01:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nice plano</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514470/3514470_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T16:01:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goodbye CR7</video:title>
      <video:description>Goodbye CR7 portugal #PortugalmadriditaliaamerikaserikatIndiaPerancisjerman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514469/3514469_720p.mp4</video:content_loc>
      <video:duration>151</video:duration>
      <video:publication_date>2026-10-04T16:01:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start Up episode 2 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514468/3514468_720p.mp4</video:content_loc>
      <video:duration>5016</video:duration>
      <video:publication_date>2026-10-04T16:00:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514467</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514467/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>al fatir</video:title>
      <video:description>29-34</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514467/3514467_720p.mp4</video:content_loc>
      <video:duration>126</video:duration>
      <video:publication_date>2026-10-04T16:00:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Odette 2</video:title>
      <video:description>Support me #Mobilelegends #highlight #virals #fyp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514466/3514466_720p.mp4</video:content_loc>
      <video:duration>109</video:duration>
      <video:publication_date>2026-10-04T16:00:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yang penting asik</video:title>
      <video:description>#Music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514465/3514465_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T15:59:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 291</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514464/3514464_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:59:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek sexsi body mohay</video:title>
      <video:description>Cewek sexsi body bohay bikin cowok cowok ngiler</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514463/3514463_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:59:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gulwareeenaa 2</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514462/3514462_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T15:58:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Kritika Thakur Dance 7</video:title>
      <video:description>Indian Girl Kritika Thakur Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514461/3514461_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-04T15:58:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagi Boring</video:title>
      <video:description>#music</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514460/3514460_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T15:58:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514459</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514459/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Moments Madina Sharif Naat #madina #shabebarat #beautiful #love #shorts #naatsharif #trend</video:title>
      <video:description>Beautiful Moments Madina Sharif Naat #madina #shabebarat #beautiful #love #shorts #naatsharif #trend #Madina #islamicvideo #viral #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514459/3514459_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T15:58:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514458</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514458/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pindiaeshehzadi</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514458/3514458_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T15:58:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514457</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514457/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Selamat malam 37</video:title>
      <video:description>Udah malam Masi pada di luar .masih pada kumpul Ama bocil bocil #American</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514457/3514457_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:57:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514456</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514456/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon Ball (1986) Season 1 Episode 23 in Hindi Dubbed | Monster Beast Giran | Goku vs Giran</video:title>
      <video:description>Dragon Ball (1986) Season 1 Episode 23 Full Episode in Hindi Dubbed | Hindi Anime Episode 23 - Monster Beast Giran - At last it&apos;s Goku&apos;s turn! The one facing Goku in the fourth match was the powerful opponent Giran!! The third match between Nam and Ranfan begins. Nam is fighting for prize money to buy water for his village. Nam does not want to hit a girl, he will if he must. By the end of the match, Ranfan has stripped to just her undergarments. Nam gets distracted by this but realizes he needs to win for his village. By closing his eyes, he can&apos;t see her and with a single attack, knocks her unconscious, and wins the match. At last it&apos;s Goku&apos;s turn! The one facing Goku in the fourth match was the powerful opponent Giran!! Goku is knocked around by Giran&apos;s stream of unfair attacks! Giran traps Goku in the rubbery Guru-Guru Gum that he shoots from his mouth!! Seeing this, Giran surrenders!! Nam apni aankhein band karke Ranfan ko hara deta hai! Aur ab Goku ka mukabla shuru, Giran ke Guru-Guru Gum se kaise bachega Goku? Anime: Dragon Ball (1986) Episode: S01 E23 - Monster Beast Giran Language: Hindi Dubbed Quality: Full HD 1080p All Episodes: Dragon Ball S01 Hindi Playlist New Episode Daily 7:30 PM! #dragonballepisode23hindi #dragonballs01e23hindidubbed #dragonball1986episode23hindi #monsterbeastgiranhindi #gokuvsgiranhindi #namvsranfanhindi #ranfanstrippingtechniquehindi #namvillagewaterhindi #gurugurugumhindi #gokutailweaknesshindi #21stworldmartialartstournamenthindi #tournamentsagahindi #dragonballhindidubbed #hindianime #animeinhindi #dailyhindianimeepisode #DragonBallSeason1Episode23HindiMe #DragonBall1986Episode23HindiDubbed #AnimeinHindiDubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514456/3514456_720p.mp4</video:content_loc>
      <video:duration>1482</video:duration>
      <video:publication_date>2026-10-04T15:57:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514455</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514455/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ice cream day</video:title>
      <video:description>girls hang out 🌹🥂🙏</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514455/3514455_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:57:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514454</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514454/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kalimat Tauhid</video:title>
      <video:description>“Lā ilāha illallāh — tiada Tuhan selain Allah. Kepada-Nya kita berserah, dari-Nya kita berharap, dan hanya kepada-Nya kita menyembah.”</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514454/3514454_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T15:56:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>village farmer</video:title>
      <video:description>Sale of all kinds of fruit plant seedlings. #fruitplantseedlings</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514453/3514453_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T15:55:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514452</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514452/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mendem yo mendem</video:title>
      <video:description>#Minuman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514452/3514452_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T15:55:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514451</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514451/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>joyia 2</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514451/3514451_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T15:55:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514450</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514450/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jalan jalan 7</video:title>
      <video:description>jalan jalan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514450/3514450_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T15:54:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful 468</video:title>
      <video:description>#Aividio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514449/3514449_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T15:54:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gulwareeenaa</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514448/3514448_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T15:54:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>572 ) PODA DA LICHIA EM ITARIRI SP</video:title>
      <video:description>LICHIA PODA #sergiosemerdjian #lichia #poda #manejo #viticultura</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514447/3514447_720p.mp4</video:content_loc>
      <video:duration>832</video:duration>
      <video:publication_date>2026-10-04T15:54:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514446</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514446/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ঘুঘু ডাঙ্গা তালতলী</video:title>
      <video:description>ঘুঘু ডাঙ্গা তালতলী</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514446/3514446_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-10-04T15:53:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goyangan Mantul</video:title>
      <video:description>#Musik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514445/3514445_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-04T15:53:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>singing under the moonlight</video:title>
      <video:description>singing under the moonlight is lovely 🌙🌹🌙</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514444/3514444_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:52:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sone se pehlay ki dua _ bright kids learning islamic dua #islamicvideo #islamiccartoon #cartoon</video:title>
      <video:description>Sone se pehlay ki dua _ bright kids learning islamic dua #islamicvideo #islamiccartoon #cartoon #Dua #islamicvideos #viral #trending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514443/3514443_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T15:51:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>avocado seedling</video:title>
      <video:description>avocado seedling transplanting process #avocadoseedling</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514442/3514442_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:51:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon Ball Z : Age of Darkness 720p</video:title>
      <video:description>Dragon Ball Z : Age of Darkness 720p #Action #animation #adventure</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514441/3514441_720p.mp4</video:content_loc>
      <video:duration>2740</video:duration>
      <video:publication_date>2026-10-04T15:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Start up episode 1 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514440/3514440_720p.mp4</video:content_loc>
      <video:duration>5094</video:duration>
      <video:publication_date>2026-10-04T15:51:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hath k style</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514439/3514439_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:50:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JO1 Kicks off North American Animal Tour</video:title>
      <video:description>JO1 Kicks off North American Animal Tour</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514438/3514438_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-10-04T15:50:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strong girl bong soon ep 12 Hindi dubbed K-drama</video:title>
      <video:description>Strong girl bong soon episode 12 Hindi dubbed K-drama #Hindidubbed #K-drama #stronggirlbongsoon #serialkiller #stronggirl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514437/3514437_720p.mp4</video:content_loc>
      <video:duration>3924</video:duration>
      <video:publication_date>2026-10-04T15:50:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bangladeshi garments factory In Dhaka 🇧🇩👕</video:title>
      <video:description>Dhaka is the heart of the world&apos;s garment industry! 🇧🇩👕 The world&apos;s biggest brands - H&amp;M, Zara, Nike, Adidas - their clothes are made right here in Dhaka! In this video, I will show you how a piece of fabric becomes an international standard garment. In this video, you will see: ✅ The full process from fabric cutting to sewing ✅ The perfect work of skilled workers ✅ Quality check and packaging ✅ How &quot;Made in Bangladesh&quot; conquered the world The Garments Industry is our pride, the driving force of our economy. Share this video and show the world the capability of Bangladesh! 📍 Location: Dhaka, Bangladesh 👕 Industry: RMG (Ready-Made Garments) *If you like the video, don&apos;t forget to Like, Comment and Subscribe!* #dhakagarmentsfactory #bangladeshgarments #madeinbangladesh #clothingfactorybangladesh #garmentsproductionprocess #rmgindustrybangladesh #howclothesaremade #dhakafactorytour</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514436/3514436_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-04T15:50:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JESDUS ESTA VOLTANDO</video:title>
      <video:description>A verdade todos dias mostram mas os seres humanos não conseguem enxergar #FIMPRÓXIMO</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514435/3514435_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-10-04T15:49:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iqbal Mustafa abbasi 16</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514434/3514434_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T15:48:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shehzadi House Episode 3 [ENG CC] Nawal Saeed - Omer Shahzad - 2nd October 2024</video:title>
      <video:description>Shehzadi House Episode 3 [ENG CC] Nawal Saeed - Omer Shahzad - 2nd October 2024 #ShehzadiHouseEpisode3ENGCCNawalSaeed-OmerShahzad-2ndOctober2024</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514433/3514433_720p.mp4</video:content_loc>
      <video:duration>2174</video:duration>
      <video:publication_date>2026-10-04T15:48:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Salah pegang mau masukin kantong dalam mobil</video:title>
      <video:description>Mau masukin kantong malah salah pegang cewek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514432/3514432_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T15:48:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hire style</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514431/3514431_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T15:48:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>wahaj Ali</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514430/3514430_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T15:47:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hujan 2</video:title>
      <video:description>rainy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514429/3514429_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T15:47:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautifull lady</video:title>
      <video:description>Beautiful Lady mature #Sexy #beauty #lingeri</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514428/3514428_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T15:47:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>zainab</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514427/3514427_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T15:47:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shadow Punisher (2026) Ep 10 - Eng Sub</video:title>
      <video:description>Sʜᴀᴅᴏᴡ Pᴜɴɪsʜᴇʀ _ Eᴘɪsᴏᴅᴇ 10 - Eɴɢ sᴜʙ -</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514426/3514426_720p.mp4</video:content_loc>
      <video:duration>2606</video:duration>
      <video:publication_date>2026-10-04T15:47:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Adorable cat antics</video:title>
      <video:description>The unique and amusing antics of some cats that make us laugh. #viral #funnycat #funnycat #cutecat #viralcat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514425/3514425_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T15:46:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nature 364</video:title>
      <video:description>Girl in nature #Sexy #bikini #nature #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514424/3514424_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-10-04T15:46:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nice vedio 69</video:title>
      <video:description>Nice vedio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514423/3514423_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T15:46:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>girls and flowers</video:title>
      <video:description>women loves flowers</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514422/3514422_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T15:46:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chicken feed 2</video:title>
      <video:description>#Farm #Chicken #Poultry</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514421/3514421_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T15:44:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vitamin sea 🌊</video:title>
      <video:description>Good vibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514420/3514420_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T15:44:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shadow Punisher (2026) Ep 9 - Eng Sub</video:title>
      <video:description>Sʜᴀᴅᴏᴡ Pᴜɴɪsʜᴇʀ _ Eᴘɪsᴏᴅᴇ 9 - Eɴɢ sᴜʙ</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514419/3514419_720p.mp4</video:content_loc>
      <video:duration>2610</video:duration>
      <video:publication_date>2026-10-04T15:44:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hujan sebentar</video:title>
      <video:description>#Rain #vibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514418/3514418_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T15:44:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shower 5</video:title>
      <video:description>Girl taking a bath #Sexy #girl #underware #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514417/3514417_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-10-04T15:43:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NASCAR Rumble (PS1) - PARTE 10</video:title>
      <video:description>#Games #Cars #Racing #NASCAR</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514416/3514416_720p.mp4</video:content_loc>
      <video:duration>1473</video:duration>
      <video:publication_date>2026-10-04T15:43:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514415</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514415/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Halaman rumah</video:title>
      <video:description>Creative haalaamm #Alamrumah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514415/3514415_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T15:42:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coking 3</video:title>
      <video:description>#Memasak #coking</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514414/3514414_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T15:41:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dracula&apos;s coffin</video:title>
      <video:description>Finishing dracula before dark coming #Thecoffin</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514413/3514413_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T15:41:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Missing Piece (2026) Ep 10 - Eng Sub</video:title>
      <video:description>[2026] 𝙏𝙝𝙚 𝙈𝙞𝙨𝙨𝙞𝙣𝙜 𝙋𝙞𝙚𝙘𝙚 _ 𝙀𝙥𝙞𝙨𝙤𝙙𝙚 10</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514412/3514412_720p.mp4</video:content_loc>
      <video:duration>2276</video:duration>
      <video:publication_date>2026-10-04T15:41:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby funny 25</video:title>
      <video:description>#Babycute</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514411/3514411_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:41:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hey girl 2</video:title>
      <video:description>Hey girl #Heygirl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514410/3514410_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-10-04T15:41:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zoya grace</video:title>
      <video:description>Zoya grace #Zoyagrace</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514409/3514409_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T15:40:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hope and hope</video:title>
      <video:description>#God</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514408/3514408_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-10-04T15:40:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daily routine 4</video:title>
      <video:description>Daily routine girl #Sexy #Underware #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514407/3514407_720p.mp4</video:content_loc>
      <video:duration>183</video:duration>
      <video:publication_date>2026-10-04T15:39:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bermain Sepatu Roda 2</video:title>
      <video:description>#Sepaturoda</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514406/3514406_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-04T15:39:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Falling into your smile episode 3</video:title>
      <video:description>Chinese drama #English</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514405/3514405_720p.mp4</video:content_loc>
      <video:duration>2730</video:duration>
      <video:publication_date>2026-10-04T15:38:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naturally herbal</video:title>
      <video:description>#Fruit</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514404/3514404_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T15:37:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514403</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514403/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Amazing Process of Making Mattel Oil Cans!</video:title>
      <video:description>Ever wondered how classic metal cans are formed? From cutting and shaping to printing, see the incredible machinery behind Mattel&apos;s oil can production! #FactoryProcess #HowItsMade #Manufacturing #OilCan #SatisfyingVideo #IndustrialAutomation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514403/3514403_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-10-04T15:37:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sunset 107</video:title>
      <video:description>Indah seperti dirimu #Sunset #alamindah</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514402/3514402_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T15:36:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bergoyang 5</video:title>
      <video:description>fyp gk sihh</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514401/3514401_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T15:36:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GAME ANAK SEKOLAH</video:title>
      <video:description>Game anak anak sekolah #Gameanakanak</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514400/3514400_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T15:36:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love it 13</video:title>
      <video:description>Sexy girl with underware #Sexy #Underware #beauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514399/3514399_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-04T15:36:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 44</video:title>
      <video:description>Vidio lucu #Unitedstates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514398/3514398_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T15:35:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514397</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514397/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Fixers - Season 01 Episode 01</video:title>
      <video:description>#TheFixers #TheFixersseries #TheFixersdrama #TheFixersTVseries #TheFixersshow #TheFixersepisodes #TheFixersseason #TheFixerscast #TheFixersstoryline #TheFixersdramaseries #TheFixerslatestepisodes #TheFixersfullepisodes #TheFixersEnglishdrama #TheFixersseries2026 #TheFixersTVshowkeywords</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514397/3514397_720p.mp4</video:content_loc>
      <video:duration>2694</video:duration>
      <video:publication_date>2026-10-04T15:35:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bermain Sepatu Roda</video:title>
      <video:description>#Inlineskate</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514396/3514396_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T15:35:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata kata Motivasi 3</video:title>
      <video:description>Kata kata seorang anak yang ingin membalas dendam sakit hati ibu ya #Fyp #treding</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514395/3514395_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T15:34:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUGBANG JAMUR SAMPE MUAL</video:title>
      <video:description>Jamur adalah makanan paporitku.kalo kamu apa makanan paporit nya.? #Mugbang #jamur #Enoki #enek #lezat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514394/3514394_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T15:34:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oh, my.</video:title>
      <video:description>Just for fun with prizes #heavyequipment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514393/3514393_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T15:34:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beatiful girls</video:title>
      <video:description>a collection of beautiful women with her charm #Dance #viral #trend #girlsjepang #girls #beatifulgirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514392/3514392_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T15:34:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doa untuk Ibu</video:title>
      <video:description>Berdoalah untuk Ibumu, niscaya Tuhan akan mengabulkan segala hajatmu. #Pry</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514391/3514391_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T15:33:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>healing time</video:title>
      <video:description>indonesia, east java #traveller</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514390/3514390_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T15:33:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inspirasi model cover jok mobil</video:title>
      <video:description>Berikut ini adalah inspirasi untuk model cover jok mobil hiace #Jokmobil #inspirasimodelsarungjokmobil #rekomendasimodelcoverjokmobil #modifikasijokmobil</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514389/3514389_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T15:32:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>coconut cutting skills ASMR 5</video:title>
      <video:description>coconut cutting skills ASMR #asmr</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514388/3514388_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T15:32:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>princes 2</video:title>
      <video:description>this woman is dirty with tempting eyes #Trend #dance #viral #prodance #girl</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514387/3514387_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T15:31:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FREE FIRE 9</video:title>
      <video:description>Tentang geme freee fire</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514386/3514386_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-10-04T15:30:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Krina Joshi Dance 10</video:title>
      <video:description>Indian Girl Krina Joshi Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514385/3514385_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T15:30:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to sound?</video:title>
      <video:description>Event sound car #Supra #jdm #toyota</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514384/3514384_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T15:30:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jalan Pagi</video:title>
      <video:description>#Inlineskate</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514383/3514383_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T15:29:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514382</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514382/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Little Savior of the Giant</video:title>
      <video:description>Watch the heartwarming story of a tiny creature&apos;s bravery in saving a giant. Sometimes, size isn&apos;t everything. Watch until the end to see how friendship and courage change everything! #giantelephant #mammoth #wildlife #rocks #giantcreature #tinycreature #epicrescue #viralvideo #shortfilm #CGI</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514382/3514382_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:29:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chamber&apos;s Headhunter is broken</video:title>
      <video:description>Chamber&apos;s Headhunter is broken in valorant #Headhunter #valorant #chamber #chamberheadhunter</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514381/3514381_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-04T15:28:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strong girl bong soon ep 11 Hindi dubbed</video:title>
      <video:description>Strong girl bong soon episode 11 Hindi dubbed K-drama #K-drama #Hindidubbed #supernatural #stronggirl #bossemployee #serialkiller #happyending</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514380/3514380_720p.mp4</video:content_loc>
      <video:duration>4096</video:duration>
      <video:publication_date>2026-10-04T15:28:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Green Lantern First Flight</video:title>
      <video:description>#GreenLantern #EnglishMovie #HindiDubbed</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514379/3514379_720p.mp4</video:content_loc>
      <video:duration>4491</video:duration>
      <video:publication_date>2026-10-04T15:27:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 43</video:title>
      <video:description>Vidio lucu #Unitedstates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514378/3514378_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T15:27:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pizza really is unrivaled.the best</video:title>
      <video:description>Pizza really is unrivaled.</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514377/3514377_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T15:26:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514376</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514376/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Legends with Aura in2021rai star#</video:title>
      <video:description>#Legends with Aura in2021rai star# #LegendswithAurain2021raistar</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514376/3514376_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-10-04T15:25:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 740</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE SWIMMINGPOOL PART 740 #HOSTAMERIKABEAUTIFULSEXY #SWIMMINGPOOL #PART740</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514375/3514375_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-04T15:25:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hari batik Nasional</video:title>
      <video:description>Anak TK part 1</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514374/3514374_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-10-04T15:24:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ayangacu</video:title>
      <video:description>#Cantik #wanitaku</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514373/3514373_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T15:23:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vana29 project</video:title>
      <video:description>Vana29 project bikin motor meticmu JD lebih sempurna #Paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514372/3514372_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T15:22:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514371</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514371/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Megan Finally Breaks Silence &apos;Abrupt&apos; Klay Thompson</video:title>
      <video:description>Megan Finally Breaks Silence &apos;Abrupt&apos; Klay Thompson</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514371/3514371_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-10-04T15:21:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514370</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514370/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hmmn,iya</video:title>
      <video:description>#Vibes #editcapcut</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514370/3514370_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T15:21:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Beauty of Africa | Landscapes and Wildlife</video:title>
      <video:description>Follow me and subscribe to my channel ❤︎ Thanks for watching ❤︎ Subscribe and follow me to enjoy advanced 4K upscaling and HDR-10 technology in upcoming promotional videos. Stay tuned for more. #Africanwildlife #Africawildlifedocumentary #safarianimals #Africananimals #wildanimalsofAfrica #wildlifephotography #beautifulAfrica #Africansafari #naturedocumentary #savannaanimals #wildlifeofAfrica #bigfiveAfrica #Africannature #wildlifevideos #beautifulwildlife #exploreAfrica #Africanwilderness</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514369/3514369_720p.mp4</video:content_loc>
      <video:duration>384</video:duration>
      <video:publication_date>2026-10-04T15:21:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Love Other Than Yours (Hindi) - S01 Ep 05</video:title>
      <video:description>#ALoveOtherThanYours #ALoveOtherThanYoursdrama #ALoveOtherThanYoursK-drama #ALoveOtherThanYoursseries #ALoveOtherThanYoursKoreandrama #ALoveOtherThanYoursromance #ALoveOtherThanYoursstory #ALoveOtherThanYourscast #ALoveOtherThanYoursepisode #Koreandrama #K-drama #romancedrama #romanticseries #lovestory #Koreanromance #emotionaldrama</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514368/3514368_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-10-04T15:20:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kidss 3</video:title>
      <video:description>😭😭😭😭😭😭😭 #Travel #prance #paris</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514367/3514367_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T15:19:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clubmalam</video:title>
      <video:description>#Clubmalam #duniamalam #party</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514366/3514366_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T15:18:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bahkan cinta yang katanya</video:title>
      <video:description>#indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514365/3514365_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T15:18:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny</video:title>
      <video:description>Kya baat hai #Shorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514364/3514364_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T15:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514363</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514363/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Part11 2</video:title>
      <video:description>Sepak bola antar desa #Footballdesaafypppppppppppp</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514363/3514363_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-10-04T15:17:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>These Goals Should Be ILLEGAL! Even The Goalkeepers Couldn&apos;t Believe It! 😱⚽️</video:title>
      <video:description>These are the most UNBELIEVABLE goals in football history! 😱 From Quaresma&apos;s outside trivela to Cristiano Ronaldo&apos;s insane bicycle kick! Which one is your favorite? 1️⃣ Quaresma Trivela Magic 2️⃣ Ronaldo&apos;s Iconic Header 3️⃣ The Unstoppable Volley 4️⃣ El Clasico Masterpiece Who is the GOAT? Ronaldo or Messi? Comment below! 👇 Follow SHOCK ZONE US for more insane football moments every day! #sportssocceerfotball</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514362/3514362_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-10-04T15:17:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Running from Gaint gorilla!</video:title>
      <video:description>Running from Gaint gorilla!</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514361/3514361_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-10-04T15:17:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 739</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL EXY IN THE SWIMMINGPOOL PART 739 #HOSTAMERIKASEXYBEAURTIFUL #SWIMMINGPOOL #PART739</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514360/3514360_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T15:16:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clay Art #6</video:title>
      <video:description>This video shows the process of creating artwork from clay. The clay is carefully shaped and crafted into unique, detailed, and interesting forms and characters. #ClayArt</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514359/3514359_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:16:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514358</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514358/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Banjir 9</video:title>
      <video:description>#Banjir #kerjakeras #musimkemarau</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514358/3514358_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T15:16:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Liverpool   Arsenal</video:title>
      <video:description>Best match to show #Sport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514357/3514357_720p.mp4</video:content_loc>
      <video:duration>162</video:duration>
      <video:publication_date>2026-10-04T15:16:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤐💔</video:title>
      <video:description>#Sadlifelonve</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514356/3514356_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T15:15:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514355</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514355/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 738</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY IN THE SWIMMINGPOOL PART 738 #HOST #AMERIKA #BEAUTIFUL #SEXY #SWIMMINGPOOLPART738</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514355/3514355_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-04T15:14:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imran khan 183</video:title>
      <video:description>Imran Khan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514354/3514354_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T15:14:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Santai 19</video:title>
      <video:description>#Gg</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514353/3514353_720p.mp4</video:content_loc>
      <video:duration>207</video:duration>
      <video:publication_date>2026-10-04T15:14:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yang waras</video:title>
      <video:description>#Musik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514352/3514352_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T15:13:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mute Handsome Cultivator Sings at Sunset - His Voice Made Millions Cry | Emotional Chinese Drama</video:title>
      <video:description>A mute cultivator who cannot speak a single word, but his singing at sunset in the rice field is more powerful than words. He cannot express his true feelings, but he understands the truth of this world better than anyone. A passionate life, a lonely soul, and a voice that touches the heart. This AI-generated Chinese cultivation drama is going viral. His story is sad but beautiful. Watch until the end - you will cry. Subscribe for more emotional cultivation stories! Keywords: cultivation drama, chinese drama, sad story, mute singer, emotional, viral video, AI drama, xianxia #cultivationdrama #chinesedramaenglish #emotionalstory #mutecultivator #sadchinesesong #viralAIvideo #xianxiadrama #handsomechineseactor #sunsetsinging #touchingstory</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514351/3514351_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T15:13:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Top funny video 😅😅😅 in Bangladesh 😄</video:title>
      <video:description>Funny trend viral shorts 🩳🩳 #Funny #trend #viralshorts</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514350/3514350_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:13:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 42</video:title>
      <video:description>Vidio lucu #unitedstates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514349/3514349_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-10-04T15:13:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Karishma Shahi Dance 9</video:title>
      <video:description>Indian Girl Karishma Shahi Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514348/3514348_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-10-04T15:13:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kaget 5</video:title>
      <video:description>#ORANG KAGET #Indonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514347/3514347_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-10-04T15:12:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514346</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514346/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Si gadis cantik ini kaget melihat kuntilanak didinding</video:title>
      <video:description>Bikin aku ketakutan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514346/3514346_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T15:11:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514345</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514345/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Still Wants to Fight in the Next Life (Hindi) - S01 Ep 10</video:title>
      <video:description>#StillWantstoFightintheNextLife #StillWantstoFightintheNextLifeK-drama #StillWantstoFightintheNextLifedrama #StillWantstoFightintheNextLifeKoreandrama #StillWantstoFightintheNextLifeseries #StillWantstoFightintheNextLifeepisodes #Koreandrama #K-drama #romance #comedy #Koreanromancedrama #newK-drama #Asiandrama #Koreanseries #dramaseries</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514345/3514345_720p.mp4</video:content_loc>
      <video:duration>1440</video:duration>
      <video:publication_date>2026-10-04T15:11:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata-kata mbak manis</video:title>
      <video:description>#Vibes #cantik</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514344/3514344_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-10-04T15:10:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Prime b2k 2020 part#</video:title>
      <video:description>#Prime b2k 2020 part# #Primeb2k2020part</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514343/3514343_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T15:10:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514342</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514342/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anthem of Indonesia Raya</video:title>
      <video:description>The citizen sing Anthem indonesia raya in the ceremony 17 August 2026. This some place village in Sleman Yogyakarta Indonesia #CeremonyAnthemindonesiaraya</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514342/3514342_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T15:10:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Not okay</video:title>
      <video:description>#Sadloove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514341/3514341_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-10-04T15:09:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kereennn</video:title>
      <video:description>#Vibes</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514340/3514340_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-10-04T15:09:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Broken 18</video:title>
      <video:description>#Sadbrokenlove</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514339/3514339_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-10-04T15:08:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A great feeling in my heart Alisha Live Show</video:title>
      <video:description>A great feeling in my heart Alisha Live Show মনের মাঝে দারুণ একটা অনুভূতি আলিশা লাইভ শু A great feeling in my heart Alisha Live Show</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514338/3514338_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-10-04T15:08:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jogging at afternoon</video:title>
      <video:description>Jogging at afternoon #Jogging #afternoon</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514337/3514337_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T15:07:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rainbow 7</video:title>
      <video:description>#Rain #hujan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514336/3514336_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T15:07:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Will Always ❤️ | Nenje Nenje | Romantic Love Song | Cinematic AI Video</video:title>
      <video:description>A beautiful cinematic AI love video featuring a romantic sunset by the ocean. ❤️🌅 Enjoy the emotional atmosphere, beautiful scenery, and the “Nenje Nenje” soundtrack. 🎵 Song: Nenje Nenje 🎬 Cinematic AI visuals ❤️ Romantic love story atmosphere 🌊 Ocean sunset scenery #NenjeNenje #IWillAlways #romanticsong #lovesong #Tamilsong #Tamilromanticsong #cinematicAIvideo #AIlovevideo #sunsetlove #oceanromance #beautifulgirl #reddress #emotionalsong #romanticvideo #lovestatus #Tamilmusic #cinematicscenery #AIgeneratedvideo</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514335/3514335_720p.mp4</video:content_loc>
      <video:duration>324</video:duration>
      <video:publication_date>2026-10-04T15:07:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Free Fire Secret Place Trick! Santino Teleport Secret Room 😱🔥</video:title>
      <video:description>Watch how to use Santino&apos;s ability inside the revival structure to discover the hidden secret place! Wait until the end to see the Naruto &amp; Kurama room reveal. Don&apos;t forget to like, subscribe, and share for more Free Fire tricks! #FreeFireFFShortsFreeFireTrickSantinoFFFreeFireSecretPlace</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514334/3514334_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T15:06:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mogu Mogu Monkey on Studio Music</video:title>
      <video:description>#Musicindonesi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514333/3514333_720p.mp4</video:content_loc>
      <video:duration>145</video:duration>
      <video:publication_date>2026-10-04T15:06:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gancorrr</video:title>
      <video:description>#Kerjakeras</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514332/3514332_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T15:05:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Langit peteng 🌘</video:title>
      <video:description>#Ontheway</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514331/3514331_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-10-04T15:05:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514330</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514330/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ranma (Hindi) - Season 03 Episode 01</video:title>
      <video:description>#Ranma #Ranmaanime #Ranma½ #Ranma12anime #Ranmaseries #Ranmaepisodes #Ranmacharacters #RanmaSaotome #AkaneTendo #Ranmaanimeseries #Japaneseanime #martialartsanime #romanticcomedyanime #comedyanime #actionanime #fantasyanime #classicanime #animeseries #Ranma½episodes #Ranma½latestepisode</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514330/3514330_720p.mp4</video:content_loc>
      <video:duration>1436</video:duration>
      <video:publication_date>2026-10-04T15:04:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A floor lamp</video:title>
      <video:description>Creating a floor lamp from wood with a rusted-iron finish. #Travel #paris #france</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514329/3514329_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T15:04:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 41</video:title>
      <video:description>Vidio lucu #UnitedStates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514328/3514328_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T15:04:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>story 13</video:title>
      <video:description>upin ipin #film</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514327/3514327_720p.mp4</video:content_loc>
      <video:duration>981</video:duration>
      <video:publication_date>2026-10-04T15:03:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orlando Pride 2026 Announces Drag Headliners</video:title>
      <video:description>Orlando Pride 2026 Announces Drag Headliners</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514326/3514326_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-10-04T15:03:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nasi Padang Experience 🇮🇩 | Trying Indonesia’s Most Famous Food</video:title>
      <video:description>Experience the taste of Indonesia 🇮🇩 Join this cinematic food journey as we visit a traditional Padang restaurant and discover Nasi Padang — from arriving and sitting down to seeing the amazing selection of dishes, tasting the food, and enjoying the Indonesian restaurant atmosphere. Featuring delicious Indonesian favorites like rendang, curry, sambal, vegetables, and fragrant rice. 🍛 Nasi Padang 🇮🇩 Indonesian Food 🎥 Cinematic POV ⏱️ 48 Seconds Would you try Nasi Padang? #nasipadang #indonesianfood #indonesiafood #indonesiancuisine #nasipadangexperience #tryingnasipadang #rendang #indonesianrestaurant #padangrestaurant #traditionalindonesianfood #authenticindonesianfood #foodexperience #foodpov #cinematicfood #indonesiatravel #travelindonesia #asianfood #famousindonesianfood #spicyfood #deliciousfood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514325/3514325_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-04T15:03:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Slicing a Hyper-Realistic Crystal Apple! 🔪💎</video:title>
      <video:description>Slicing a Hyper-Realistic Crystal Apple! #fyp #ai #asmrsounds #fruit #satisfy</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514324/3514324_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T15:03:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Visiting borobudur temple in magelang city.</video:title>
      <video:description>The beautifull view will you get here It is Wonderfull place you have to visit. Make your memorable moment here in Borobudur temple, magelang city. #Traveling #borobudurtemple #magelangcity</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514323/3514323_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T15:03:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Parfum 3</video:title>
      <video:description>Beautiful day with good parfume 😂 #Parfume</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514322/3514322_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T15:01:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The 5 Most Beautiful Birds on Earth  Wildlife</video:title>
      <video:description>Follow me and subscribe to my channel ❤︎ Thanks for watching ❤︎ Subscribe and follow me to enjoy advanced 4K upscaling and HDR-10 technology in upcoming promotional videos. Stay tuned for more. #beautifulbirds #birdsoftheearth #exoticbirds #stunningbirds #rarebirds #colorfulbirds #birdspecies #wildlife #naturedocumentaries #beautifulwildlife #birdsofparadise #cutebirds #amazingbirds #wildanimals #birdwatching #beautifulnature #birdsounds #planetearthbirds</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514321/3514321_720p.mp4</video:content_loc>
      <video:duration>424</video:duration>
      <video:publication_date>2026-10-04T15:01:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing 365</video:title>
      <video:description>Amazing #Amazing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514320/3514320_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T15:01:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514319</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514319/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pole dancing 8</video:title>
      <video:description>Pole dancing #Poledancing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514319/3514319_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-10-04T15:01:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sometimes, We Realize the Moment Was Precious Only After It Becomes a Memory. ✨ Emotional Story</video:title>
      <video:description>Some of the most precious moments feel ordinary while we&apos;re living them. ❤️ A simple cup of tea, a warm smile, a quiet conversation with someone we love… We often don&apos;t realize how special those moments are until they become memories. 🍂 Years later, we may wish we could return to just one ordinary evening and experience it again. ✨ Cherish the little moments. Someday, they may become your favorite memories. 🏡❤️ #emotionalstory #nostalgicstory #preciousmoments #beautifulmemories #lifememories #emotionalshortfilm #hearttouchingstory #touchingstory #sentimentalstory #familystory #motherdaughter #motherdaughterlove #unforgettablememories #childhoodmemories #memoriesofhome #nostalgicvideo #emotionalvideo #cinematicshort #cinematicstory #shortfilm #storytelling #heartwarmingstory #peacefulmoments #emotionalanimation #animatedshortfilm #AIstory #AIvideo #AIanimation #villagelife #rurallife #sunsetstory #familymemories #meaningfulmoments #lifelesson #inspirationalstory #DreamleafShorts #Febspot #shortvideo #emotionalreels #touchingmemories</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514318/3514318_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-10-04T15:01:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ruang tamu 2</video:title>
      <video:description>Santai di ruang tamu #santairuang #tamu</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514317/3514317_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T15:00:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Apology That Never Came 💔</video:title>
      <video:description>The Apology That Never Came 💔 #🧠Psychology #💔UnsaidApologies #🥀EmotionalPain #💭UnresolvedFeelings</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514316/3514316_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-04T14:59:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Daemons of the Shadow Realm (Hindi) - S01 Ep 23</video:title>
      <video:description>#DaemonsoftheShadowRealm #DaemonsoftheShadowRealmanime #DaemonsoftheShadowRealmseries #DaemonsoftheShadowRealmepisodes #DaemonsoftheShadowRealmcharacters #DaemonsoftheShadowRealmJapaneseanime #YominoTsugai #YominoTsugaianime #ShadowRealmanime #supernaturalanime #fantasyanime #actionanime #Japaneseanime #newanime #animeseries #fantasyactionanime #mangaadaptation #DaemonsoftheShadowRealmEnglish #DaemonsoftheShadowRealmlatestepisode</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514315/3514315_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-10-04T14:58:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goyang Remix Garam cina</video:title>
      <video:description>Goyang Remix garam cina asek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514314/3514314_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-10-04T14:58:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece (Dublado) Temporada 19 - Episódio 820</video:title>
      <video:description>anime #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514313/3514313_720p.mp4</video:content_loc>
      <video:duration>1424</video:duration>
      <video:publication_date>2026-10-04T14:57:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Manfaat sirih merah</video:title>
      <video:description>Sirih merah mempunyai manfaat untuk membantu sirkulasi darah #Sirihmerah #herbal #obat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514312/3514312_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T14:57:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The golden spoon episode 26 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514311/3514311_720p.mp4</video:content_loc>
      <video:duration>1576</video:duration>
      <video:publication_date>2026-10-04T14:57:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514310</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514310/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>4K aerial photography of nature and landscapes</video:title>
      <video:description>Follow me and subscribe to my channel ❤︎ Thanks for watching ❤︎ Subscribe and follow me to enjoy advanced 4K upscaling and HDR-10 technology in upcoming promotional videos. Stay tuned for more. #aerialphotography #naturephotography #landscapephotography #dronephotography #droneshots #aerialnature #sceniclandscapes #dronelandscape #cinematicdrone #naturedronevideo #aerialviews #beautifulnature #earthfromabove #naturelandscapes #dronevideography #landscapevideo #highresolutionnature</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514310/3514310_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-10-04T14:56:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 737</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY WATERFALL PART 737 #HOST #AMERIKA #BEAUTIFUL #SEXY #WATERFALL #PART737</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514309/3514309_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-10-04T14:56:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece (Dublado) Temporada 19 - Episódio 819</video:title>
      <video:description>anime #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514308/3514308_720p.mp4</video:content_loc>
      <video:duration>1422</video:duration>
      <video:publication_date>2026-10-04T14:56:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relax sound</video:title>
      <video:description>First uplod my video #Travel #vilage #sound #ambient #ambientsound</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514307/3514307_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-10-04T14:56:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece (Dublado) Temporada 19 - Episódio 818</video:title>
      <video:description>anime #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514306/3514306_720p.mp4</video:content_loc>
      <video:duration>1424</video:duration>
      <video:publication_date>2026-10-04T14:55:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The golden spoon episode 25 in hindi dubbed</video:title>
      <video:description>Enjoy guys</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514305/3514305_720p.mp4</video:content_loc>
      <video:duration>1512</video:duration>
      <video:publication_date>2026-10-04T14:55:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pescadores em alto mar</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514304/3514304_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T14:54:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 736</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ON THE BEACH HAWAII PART 736 #HOST #AMERIKA #BEAUTIFUL #SEXYBEACH #HAWAII #PART746</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514303/3514303_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-10-04T14:54:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sometimes 4</video:title>
      <video:description>Some wounds stay Sometimes we say “It’s okay” #video</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514302/3514302_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T14:54:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tubarão 2</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514301/3514301_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T14:54:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um mergulho entre os peixes</video:title>
      <video:description>#Dedi</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514300/3514300_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T14:53:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece (Dublado) Temporada 19 - Episódio 817</video:title>
      <video:description>anime #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514299/3514299_720p.mp4</video:content_loc>
      <video:duration>1422</video:duration>
      <video:publication_date>2026-10-04T14:52:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 735</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ON THE BEACH MIAMI PART 735 #HOST #AMERIKA #BEAURTIFUL #SEXYBEACH #MIAMI #PART735</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514298/3514298_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-10-04T14:51:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bakmi jawa</video:title>
      <video:description>food #streatfood</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514297/3514297_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T14:51:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stunningly colorful rainforest birds - (4K)</video:title>
      <video:description>Follow me and subscribe to my channel ❤︎ Thanks for watching ❤︎ Subscribe and follow me to enjoy advanced 4K upscaling and HDR-10 technology in upcoming promotional videos. Stay tuned for more. #rainforestbirds #colorfulbirds #exoticbirds #stunningbirds #tropicalbirds #birdwatching #birdspecies #colorfulwildlife #amazonrainforest #rainforestwildlife #beautifulbirds #birdphotography #naturedocumentary #tropicalrainforest #colorfulbirdspecies #rarebirds #birdsounds #wildlifeoftheamazon</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514296/3514296_720p.mp4</video:content_loc>
      <video:duration>323</video:duration>
      <video:publication_date>2026-10-04T14:50:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny</video:title>
      <video:description>Funyy #Funny</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514295/3514295_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T14:50:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pole dancing 7</video:title>
      <video:description>Pole dancing #Poledancing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514294/3514294_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-10-04T14:50:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece (Dublado) Temporada 19 - Episódio 816</video:title>
      <video:description>anime #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514293/3514293_720p.mp4</video:content_loc>
      <video:duration>1424</video:duration>
      <video:publication_date>2026-10-04T14:49:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hyper</video:title>
      <video:description>#hot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514292/3514292_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-10-04T14:49:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asmr satisfying</video:title>
      <video:description>Can your nervous system handle this? From ultra-crisp tactile triggers to flawlessly satisfying visual loops, this ASMR session is designed to give you instant chills. Drop a comment on which trigger gave you the strongest tingles—or if it just made you impatient! Let&apos;s debate: are visual triggers better than audio-only ASMR? #ASMR #SatisfyingASMR #Tingles #ASMRCommunity #OddlySatisfying #Relaxation #ASMRTriggers #VisualASMR</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514290/3514290_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T14:48:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#rai Bhai ka aura#</video:title>
      <video:description>#rai Bhai ka aura# #raiBhaikaaura</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514289/3514289_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-10-04T14:48:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Portugal were about to lose… until Cristiano Ronaldo did the impossible! 🤯🐐</video:title>
      <video:description>🔥 **ONE FREE KICK. ONE LEGEND. ONE UNFORGETTABLE MOMENT! 🐐⚽** Portugal were on the edge of defeat… and then Cristiano Ronaldo stepped up! Cristiano Ronaldo free kick vs Spain With the pressure rising and time running out, CR7 delivered a stunning free kick against Spain at the 2018 FIFA World Cup. The ball flew past David de Gea and into the net, completing Ronaldo&apos;s incredible hat trick and securing a dramatic 3-3 draw for Portugal. 🔥 Three goals. One legendary performance. A free kick that shocked the world. Ronaldo didn&apos;t just score a goal that night. He showed the world why millions of fans consider him one of the greatest football players of all time. Was this one of the greatest free kicks in World Cup history? And was this the moment that proved Cristiano Ronaldo could carry an entire nation on his shoulders? Watch this unforgettable moment and relive the magic of CR7! 👇 **COMMENT BELOW:** Is Cristiano Ronaldo the GOAT? 🐐 👍 Like, subscribe, and turn on notifications for more incredible football moments, legendary goals, and unforgettable stories from the beautiful game. #CristianoRonaldofreekick #RonaldofreekickvsSpain #CristianoRonaldoPortugal #PortugalvsSpain2018 #RonaldohattrickvsSpain #CR7incrediblefreekick #CristianoRonaldoWorldCup2018 #Ronaldolastminutefreekick #PortugalvsSpainhighlights #CristianoRonaldolegendarygoals #Ronaldobestfreekicks #CristianoRonaldoclutchmoments #Portugalnationalteam #Ronaldofootballhighlights #Greatestfootballmoments #CristianoRonaldofreekickagainstSpain2018 #CristianoRonaldosaves #PortugalagainstSpain #RonaldohattrickPortugalvsSpainWorldCup #CristianoRonaldolastminutefreekickgoal #OneofthegreatestfreekicksinWorldCuphistory #CristianoRonaldoiconicWorldCupmoment</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514288/3514288_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T14:48:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Podcast Adam and hawa</video:title>
      <video:description>Podcast about Adam and hawa created #Podcast</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514287/3514287_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-10-04T14:48:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Advice 28</video:title>
      <video:description>Parental advice #Advice</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514286/3514286_720p.mp4</video:content_loc>
      <video:duration>203</video:duration>
      <video:publication_date>2026-10-04T14:47:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece (Dublado) Temporada 19 - Episódio 815</video:title>
      <video:description>anime #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514285/3514285_720p.mp4</video:content_loc>
      <video:duration>1424</video:duration>
      <video:publication_date>2026-10-04T14:46:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pak tani disawah</video:title>
      <video:description>Pak tani di sawah sedang beraktifitas #love #desa #video #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514284/3514284_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T14:46:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Adventure Time Side Quests - S02 Episode 10</video:title>
      <video:description>#AdventureTimeSideQuests #AdventureTimeSideQuestskeywords #AdventureTime #SideQuests #AdventureTimespinoff #AdventureTimeseries #FinnandJake #FinntheHuman #JaketheDog #Oooadventures #CartoonNetwork #animatedseries #fantasyadventure #comedyanimation #cartoonseries #animatedcomedy #magicaladventures #Ooocharacters #FinnandJakeadventures #AdventureTimenewseries #SideQuestsepisodes #AdventureTimefans #fantasycartoon #animatedfantasy #kidsanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514283/3514283_720p.mp4</video:content_loc>
      <video:duration>687</video:duration>
      <video:publication_date>2026-10-04T14:46:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nature and Wildlife | High Quality</video:title>
      <video:description>Follow me and subscribe to my channel ❤︎ Thanks for watching ❤︎ Subscribe and follow me to enjoy advanced 4K upscaling and HDR-10 technology in upcoming promotional videos. Stay tuned for more. #natureandwildlife #wildlifedocumentary #wildlifephotography #naturesounds #animalsinthewild #beautifulnature #wildanimals #naturerelaxation #wildlifevideos #safarianimals #naturalworld #wildlifesafari #naturescenes #forestwildlife #wildlifeconservation #naturefootage #beautifulearth #wildernessexplore</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514281/3514281_720p.mp4</video:content_loc>
      <video:duration>298</video:duration>
      <video:publication_date>2026-10-04T14:46:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Adventure Time Side Quests - S02 Episode 09</video:title>
      <video:description>#AdventureTimeSideQuests #AdventureTimeSideQuestskeywords #AdventureTime #SideQuests #AdventureTimespinoff #AdventureTimeseries #FinnandJake #FinntheHuman #JaketheDog #Oooadventures #CartoonNetwork #animatedseries #fantasyadventure #comedyanimation #cartoonseries #animatedcomedy #magicaladventures #Ooocharacters #FinnandJakeadventures #AdventureTimenewseries #SideQuestsepisodes #AdventureTimefans #fantasycartoon #animatedfantasy #kidsanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514280/3514280_720p.mp4</video:content_loc>
      <video:duration>690</video:duration>
      <video:publication_date>2026-10-04T14:45:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece (Dublado) Temporada 19 - Episódio 814</video:title>
      <video:description>anime #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514279/3514279_720p.mp4</video:content_loc>
      <video:duration>1426</video:duration>
      <video:publication_date>2026-10-04T14:43:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akan kah terjadi!!</video:title>
      <video:description>#boxing</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514278/3514278_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T14:43:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514277</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514277/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Adventure Time Side Quests - S02 Episode 08</video:title>
      <video:description>#AdventureTimeSideQuests #AdventureTimeSideQuestskeywords #AdventureTime #SideQuests #AdventureTimespinoff #AdventureTimeseries #FinnandJake #FinntheHuman #JaketheDog #Oooadventures #CartoonNetwork #animatedseries #fantasyadventure #comedyanimation #cartoonseries #animatedcomedy #magicaladventures #Ooocharacters #FinnandJakeadventures #AdventureTimenewseries #SideQuestsepisodes #AdventureTimefans #fantasycartoon #animatedfantasy #kidsanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514277/3514277_720p.mp4</video:content_loc>
      <video:duration>650</video:duration>
      <video:publication_date>2026-10-04T14:42:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Adventure Time Side Quests - S02 Episode 07</video:title>
      <video:description>#AdventureTimeSideQuests #AdventureTimeSideQuestskeywords #AdventureTime #SideQuests #AdventureTimespinoff #AdventureTimeseries #FinnandJake #FinntheHuman #JaketheDog #Oooadventures #CartoonNetwork #animatedseries #fantasyadventure #comedyanimation #cartoonseries #animatedcomedy #magicaladventures #Ooocharacters #FinnandJakeadventures #AdventureTimenewseries #SideQuestsepisodes #AdventureTimefans #fantasycartoon #animatedfantasy #kidsanimation</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514276/3514276_720p.mp4</video:content_loc>
      <video:duration>705</video:duration>
      <video:publication_date>2026-10-04T14:42:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Simple trigger mechanism for wooden slingshot</video:title>
      <video:description>Simple trigger mechanism for wooden slingshot, DIY slingshot, Wood craft, homemade slingshot #DIY #slingshot #survival #craft #bamboo #crossbow</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514275/3514275_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-10-04T14:42:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cashier cat 😂</video:title>
      <video:description>Cashier cat 😺 #Cashier #cat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514274/3514274_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T14:41:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video Klip | Mogu Mogu Monkey - Harapan</video:title>
      <video:description>🔥🔥🔥Mogu Mogu Monkey - Harapan ( video klip ) #Musikindonesia</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514273/3514273_720p.mp4</video:content_loc>
      <video:duration>137</video:duration>
      <video:publication_date>2026-10-04T14:39:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌿 Amazing Plant Ideas You’ll Love!</video:title>
      <video:description>Beautiful plants, creative ideas, and a touch of nature. 🌱✨ #inspiration #houseplants #amazingplants #viralvideo #trending #greenliving #Febspot</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514272/3514272_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-10-04T14:39:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagi di pante</video:title>
      <video:description>Sedang berjalan sante di pante #jakarta</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514271/3514271_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T14:38:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tennessee Inmate on Ventilator After Failed Execution</video:title>
      <video:description>Tennessee Inmate on Ventilator After Failed Execution</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514269/3514269_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-10-04T14:37:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nature and wildlife will amazed you 🐾🌿</video:title>
      <video:description>Follow me and subscribe to my channel ❤︎ Thanks for watching ❤︎ Subscribe and follow me to enjoy advanced 4K upscaling and HDR-10 technology in upcoming promotional videos. Stay tuned for more. #nature #wildlifedocumentary #wildernessexploration #icevalleysandglaciers #nationalgeographicwildlife #americanlandscapes #mountainpeaksandvalleys #redwoodforests #wildlifephotography #volcanoesanderuptions #hiddenlakesandwaterbodies #desertecosystems #mountainranges #wildlifeconservation #naturalwonders #ecotourism</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514268/3514268_720p.mp4</video:content_loc>
      <video:duration>293</video:duration>
      <video:publication_date>2026-10-04T14:37:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Nanotechnology sut Toni stark #</video:title>
      <video:description>#Nanotechnology sut Toni stark # #NanotechnologysutTonistark</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514267/3514267_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T14:37:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Met istirahat</video:title>
      <video:description>Met istirahat</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514266/3514266_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T14:36:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Easy Beef &amp; Broccoli Stir-Fry | Restaurant-Style Asian Recipe at Home</video:title>
      <video:description>Easy Beef &amp; Broccoli Stir-Fry | Restaurant-Style Asian Recipe at Home Learn how to make delicious Beef &amp; Broccoli Stir-Fry at home! 🥩🥦 This easy Asian-inspired recipe combines tender, flavorful beef with fresh broccoli, garlic, ginger, and a rich savory sauce. In this step-by-step cooking tutorial, you&apos;ll learn how to prepare the beef, cook the broccoli, make the flavorful sauce, and bring everything together in a hot wok for that delicious restaurant-style taste. 🍽️ Perfect for: • Easy weeknight dinners • Quick homemade meals • Asian food lovers • Beginners learning to cook 🔥 Authentic Flavors. Simple Recipes. Subscribe to Asian Food Studio for more delicious Asian recipes, easy cooking tutorials, and homemade food inspiration! #beefandbroccoli #beefandbroccolirecipe #beefandbroccolistirfry #beefstirfry #broccolistirfry #easybeefrecipe #easybeefandbroccoli #asianbeefrecipe #asianbeefstirfry #chinesebeefandbroccoli #chinesebeefrecipe #chinesestirfry #restaurantstylebeef #restaurantstylestirfry #betterthantakeout #easyasianrecipes #asianrecipes #asianfood #asiancooking #asiancuisine #homemadeasianfood #easydinnerrecipe #quickdinnerrecipe #beefdinner #beefrecipes #broccolirecipes #stirfryrecipe #wokcooking #homemadestirfry #cookingtutorial #stepbystepcooking #easycooking #dinnerideas #quickrecipes #AsianFoodStudio</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514265/3514265_720p.mp4</video:content_loc>
      <video:duration>144</video:duration>
      <video:publication_date>2026-10-04T14:36:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sjuush cluct 1v2 so cool</video:title>
      <video:description>csgo game #game</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514264/3514264_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-10-04T14:35:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Début concert</video:title>
      <video:description>Le concert d&apos;une légende #Légende #concert #fun</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514263/3514263_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-10-04T14:35:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mybestfriend</video:title>
      <video:description>Anak gadis bareng temannya #Berteman</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514262/3514262_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T14:35:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece (Dublado) Temporada 19 - Episódio 813</video:title>
      <video:description>anime #anime</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514261/3514261_720p.mp4</video:content_loc>
      <video:duration>1424</video:duration>
      <video:publication_date>2026-10-04T14:35:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dash! Yonkuro is Dead: Why Modern Tamiya Needs to Drop the Anime Vibe</video:title>
      <video:description>Younger generations in Papua are treating Mini 4WD purely as a high-stakes engineering sport, ignoring the classic anime roots entirely. Should we embrace the hardcore sportification, or keep the nostalgic anime spirit alive? #DashYonkuro #Mini4WDHistory #TamiyaCulture #PapuaYouth #AnimeVsSport</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514260/3514260_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T14:35:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Firework 16</video:title>
      <video:description>All about Firework</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514259/3514259_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T14:34:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kata-kata motivasi islami</video:title>
      <video:description>​﷽ ​﴿ ٱلسَّلَامُ عَلَيْكُمْ وَرَحْمَةُ ٱللَّهِ وَبَرَكَٰتُهُ ﴾ ​&quot;Jika Kamu Tidak Tahu Apa Yang Harus Kamu Minta Hari Ini Kepada Allah, ​Cukup Katakan, ​&apos;Ya Allah, perbaikilah apa yang tidak dapat kuperbaiki, sembuhkanlah apa yang tidak dapat kusembuhkan, lindungilah aku dari apa yang tidak dapat kulihat... ​Jagalah hal-hal diluar kendaliku, ringankanlah beban di hatiku, dan bimbinglah aku menuju yang terbaik untukku&apos;&quot; Kadang kita merasa bingung dan bingung harus berdoa apa saat hati terasa penuh. Serahkan segalanya kepada Allah—Dialah sebaik-baiknya tempat bergantung dan penentu takdir kita. ​ #QuranRecitation #QuranDaily #MorningZikr #SurahAlWaqiah #SurahAlMulk #SurahKahf #SurahYasin #IslamicReminders #MuslimCommunity #HijratulIslam #MoeslemofAmerica #QuranForEveryOne #MurrotalQuran #TafsirQuran #DoaHarian #KajianIslam #BelajarIslam #MuslimQuotes #MotivasiHijrah #IslamRahmatanLilAlamin #AlQuran #Sunnah #Istiqamah #NasihatIslami #CeramahPendek</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514258/3514258_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-10-04T14:34:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mencari yang setia itu memang sulit</video:title>
      <video:description>Kata kata motivasi kehidupan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514257/3514257_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-10-04T14:33:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Firework 15</video:title>
      <video:description>All about Firework</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514256/3514256_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T14:33:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Firework 14</video:title>
      <video:description>All about Firework</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514255/3514255_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-10-04T14:33:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Firework 13</video:title>
      <video:description>All about Firework</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514254/3514254_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-10-04T14:32:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Japanese 6</video:title>
      <video:description>#jav</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514253/3514253_720p.mp4</video:content_loc>
      <video:duration>1103</video:duration>
      <video:publication_date>2026-10-04T14:32:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Around the World Tour | Drone Footage | Breathtaking Nature Shots</video:title>
      <video:description>Follow me and subscribe to my channel ❤︎ Thanks for watching ❤︎ Subscribe and follow me to enjoy advanced 4K upscaling and HDR-10 technology in upcoming promotional videos. Stay tuned for more. #natureshorts #natureshort #amazingnatureshort #4knatureshort #shorts #short #nature #cinematicshots #youtubeshorts #droneshots #trendingshort #ytshorts #youtubeshort #ytshort #travelshorts #shortsvideos #virelshort #shortvideos #youtubeshortsvideo #viralshorts2023 #breathtakingbeauty #breathtakingviews #amazingnature #naturestatus #stunningnature #naturefootage #naturein4k #mothernature #naturesbeauty #unrealnature #naturescenery #naturesounds #naturerelaxation #nature4k #4knature #beautifulnature #naturebeauty</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514252/3514252_720p.mp4</video:content_loc>
      <video:duration>314</video:duration>
      <video:publication_date>2026-10-04T14:31:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rx king 4</video:title>
      <video:description>Angin malam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514251/3514251_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-10-04T14:31:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hiburan 🤣🤣 40</video:title>
      <video:description>Vidio lucu #unitedstates</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514250/3514250_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-10-04T14:30:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inter-Religious challenge</video:title>
      <video:description>Who is right please #Religiouschallenge</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514249/3514249_720p.mp4</video:content_loc>
      <video:duration>224</video:duration>
      <video:publication_date>2026-10-04T14:30:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kakek joged</video:title>
      <video:description>Asikin aja</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514248/3514248_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-10-04T14:30:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Heavy-Duty Yellow Excavator in Industrial Warehouse</video:title>
      <video:description>A large, bright yellow crawler-type hydraulic excavator stands prominently inside a spacious, well-lit industrial facility or warehouse. The machine features a robust body, wide steel tracks for stability, a tall curved boom arm, and an enclosed operator cabin with large clear windows and protective metal framing. Bright overhead natural light streams through tall rectangular windows along the back wall, illuminating the concrete floor and neutral-toned interior walls. The excavator appears clean and well-maintained, suggesting it is either new, recently serviced, or stored indoors when not in use. Faint nonsensical text overlays appear at the bottom of the frame, along with video playback controls, indicating this is a still frame captured from a short video clip. #Industrialwarehouse #excavator</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514247/3514247_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-10-04T14:30:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILM SENA TERIKAT JANJI</video:title>
      <video:description>Cuplikan film terikat janji #Sena</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514246/3514246_720p.mp4</video:content_loc>
      <video:duration>108</video:duration>
      <video:publication_date>2026-10-04T14:29:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tentang masa depan</video:title>
      <video:description>Tentang kehidupan</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514245/3514245_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-10-04T14:29:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sicewek catik ini kagen sama kk na nang</video:title>
      <video:description>Mengucapkan kata-kata rasa kagen nya dalam hati yang paling dalam</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514244/3514244_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-10-04T14:29:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂 Funny Cartoon Family ফলের পরিবারের ছোট্ট সদস্যদের নিয়ে আজকের</video:title>
      <video:description>😂 Funny Cartoon Family ফলের পরিবারের ছোট্ট সদস্যদের নিয়ে আজকের মজার অভিযান! কীভাবে একটি সাধারণ দিন হয়ে উঠল হাসি-আনন্দে ভরা—দেখুন পুরো গল্পটি। 🍎🍓🥕🎬 #😂FunnyCartoonFamilyফলেরপরিবারেরছোট্টসদস্যদেরনিয়েআজকের</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514243/3514243_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-10-04T14:28:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quotes 143</video:title>
      <video:description>#Quote #quotes #quotesoftheday</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514242/3514242_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-10-04T14:27:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3514241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3510000/3514241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Amazing Pipe Joining Trick! 😱🔥”</video:title>
      <video:description>“Amazing Pipe Joining Trick! 😱🔥” #Tipsandtricks #viral</video:description>
      <video:content_loc>https://st30.febspot.com/videos/3510000/3514241/3514241_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-10-04T14:26:50+02:00</video:publication_date>
    </video:video>
  </url>
</urlset>
