<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"
        xmlns:video="http://www.google.com/schemas/sitemap-video/1.1">
  <url>
    <loc>https://www.febspot.com/video/3395623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia difícil no Paranoá - Só valeu o entretenimento! 🎣🐠🐟🎏</video:title>
      <video:description>É galera, o trem tá feio aqui no Lago Paranoá pra pescar nessa época de frio! Só os caiaqueiros estão pegando e fazendo inveja! Eu disse no primeiro vídeo que iria mudar de local, só que, no clube onde programei pescar, a área era muito pequena, enquanto no Deck sul é muito mais abrangente! Então, no próximo vídeo, vou procurar outros pontos! E, fica a pergunta, sem previsão, quando vou colocar o meu caiaque na água...? 🤔 Link do primeiro vídeo: https://youtu.be/TuGNrlNDsys?sub_confirmation=1 Link do segundo vídeo: https://youtu.be/4TYXGYfd8r8?sub_confirmation=1 Vara: Speedfish 1651 da Albatroz 1,65m 2-6Lb Molinete: Saint Truly TR 500 135g Max Drag=2,5kg Linha: Monofilamento com Leader Fluorcarbono Câmera: Akaso Brave 7 4K 60fps com Estabilização de Imagem EIS 2.0 #pescarianolagoparanoá #pescaria #pesca #lagoparanoá #tralhas #molinete #vara #tucunaré #tilápia #iscaartificial #ultralight #anzol #garatéia #monofilamento #multifilamento #fluorcarbono</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395623/3395623_720p.mp4</video:content_loc>
      <video:duration>900</video:duration>
      <video:publication_date>2026-09-01T23:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como fazer uma mesa de policorte</video:title>
      <video:description>Seja bem vindo a oficina são José aqui você vai ficar com dica de serralheria</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395622/3395622_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-01T23:36:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiny Miniature Kitchen Cooking | Relaxing ASMR</video:title>
      <video:description>A tiny miniature kitchen scene with a small copper pan warming over a candle flame. Soft, cozy and relaxing visuals for a peaceful ASMR moment. No talking, just a calm tiny-world cooking atmosphere from Tiny Wonderland. #miniaturecooking #tinykitchen #minifood #relaxingASMR #notalkingASMR #tinyworld #miniatureworld #cozykitchen #satisfyingvideo #tinywonderland</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395621/3395621_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:36:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Different Princess EP10 / 不同的公主</video:title>
      <video:description>故事講述了女作家華清歌誤入自己小說的世界，變成了一個卑鄙的配角。她以為掌控劇本就能扭轉乾坤，卻沒想到遭遇了一連串的曲折，最後與季初展開了一段充滿愛恨糾葛的劇情。</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395620/3395620_720p.mp4</video:content_loc>
      <video:duration>1847</video:duration>
      <video:publication_date>2026-09-01T23:36:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funky Soul Train – SoundMancerMusic | American Funk</video:title>
      <video:description>Funky Soul Train – SoundMancerMusic All aboard the Funky Soul Train — where the bass is strong, the horns are loud and the groove never stops. “Funky Soul Train” is an energetic American funk track driven by a powerful bassline, vibrant horns and an irresistible dance beat. From the shaking dance floor to the flashing lights of the night, every rhythm brings more energy to the party. With groovy male vocals, catchy chorus harmonies and a soulful funk atmosphere, this track is made for dancing from beginning to end. Turn up the volume, feel the soul and ride the groove all night long. 🎵 Track: Funky Soul Train 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Soul Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, soul, dance and international music from SoundMancerMusic. #FunkySoulTrain #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #SoulFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #BasslineFunk #GroovyBassline #FunkHorns #HornSection #SoulMusic #FunkSoul #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395619/3395619_720p.mp4</video:content_loc>
      <video:duration>196</video:duration>
      <video:publication_date>2026-09-01T23:36:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arabic song 10</video:title>
      <video:description>Viral my song #France</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395618/3395618_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-01T23:35:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Luka Modrić dan Cristiano Ronaldo</video:title>
      <video:description>Luka Modrić dan Cristiano Ronaldo adalah rekan setim di Real Madrid selama enam musim berturut-turut antara tahun 2012 dan 2018; mereka memenangkan tiga gelar Liga Champions, dua gelar La Liga, serta total lima penghargaan Ballon d’Or saat berada dalam satu skuad yang sama. Modrić secara terbuka menyatakan bahwa kepergian Ronaldo ke Juventus pada tahun 2018 merupakan &quot;kehilangan terbesar yang dialami Real Madrid selama saya berada di klub tersebut&quot;—sebuah pernyataan dari seorang pemenang Ballon d’Or mengenai pemain yang baru saja mencetak gol ke-450-nya bagi Real Madrid. Kerja sama mereka yang memadukan lini tengah dan lini depan telah melahirkan tim La Liga modern dengan pencapaian individu terbanyak dalam sejarah kompetisi tersebut. ⚠️No copyright</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395617/3395617_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T23:35:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 Custos Ocultos da Falta de Disciplina Que Você Precisa Conhecer</video:title>
      <video:description>Você já parou para pensar no preço que paga por viver sem disciplina? Neste vídeo, você vai descobrir **3 custos ocultos de viver sem disciplina** que podem estar afetando sua rotina, seus objetivos, sua produtividade e até seu futuro. A falta de disciplina nem sempre mostra suas consequências imediatamente. Pequenas escolhas repetidas todos os dias podem se transformar em grandes perdas ao longo do tempo. Neste vídeo, você vai entender: • Os principais custos de viver sem disciplina • Como a falta de disciplina prejudica seus resultados • Por que hábitos aparentemente pequenos podem destruir seu progresso • Como desenvolver mais autocontrole e disciplina • O que você pode começar a mudar hoje Se você quer melhorar seus hábitos, aumentar sua produtividade e construir uma vida mais disciplinada, este vídeo é para você. **Assista até o final e descubra quais desses custos podem estar acontecendo na sua própria vida.** #disciplina #faltadedisciplina #comoterdisciplina #consequênciasdafaltadedisciplina #hábitos #autodisciplina</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395615/3395615_720p.mp4</video:content_loc>
      <video:duration>419</video:duration>
      <video:publication_date>2026-09-01T23:34:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lucky Strike (2026) | Full Movie | HD</video:title>
      <video:description>Lucky Strike (2026) A wounded American soldier fights to survive behind enemy lines during WWII’s Battle of the Bulge against the Germans, relying on his instinct, spy craft and a hand-radio to evade capture and find his way back to his unit. Genre: Action, Drama, Hollywood, War Director: Rod Lurie Actors: Alfie Stewart, Atanas Srebrev, Aunjanue Ellis-Taylor, Colin Hanks, Lorne MacFadyen, Scott Eastwood, Taylor John Smith Country: United States Duration: 97 min Quality: HD Release: 2026 IMDb: 5.6 #LuckyStrike2026 #FullMovie #HD #Action #Drama #Hollywood #War #UnitedStates</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395614/3395614_720p.mp4</video:content_loc>
      <video:duration>6211</video:duration>
      <video:publication_date>2026-09-01T23:34:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carimbão Gasolina: Acertou ou Errou? Aposta Surpreendente!</video:title>
      <video:description>Carimbão forte gasolina Só pra mim que não coube muito né Quero ver quem que acertou aí Se você acertou você não passou a vista pra Pai do bité olha lá o pai do Olha Aí sim pegou 3 Vai faltar! #BiteloFrasesMotivacaoMusculacaoFitness</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395613/3395613_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T23:34:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Temas</video:title>
      <video:description>#Temas #crianças</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395612/3395612_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T23:34:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden olha so um código fácil de fazer</video:title>
      <video:description>Ninja Gaiden olha so um código fácil de fazer, so colocar a cabeça no estatua #Ninja</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395611/3395611_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T23:34:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Wrong Girls 2026 Full Movie HD</video:title>
      <video:description>The Wrong Girls 2026 Full Movie HD #TheWrongGirls2026 #FullMovieHD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395610/3395610_720p.mp4</video:content_loc>
      <video:duration>5989</video:duration>
      <video:publication_date>2026-09-01T23:34:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jakarta 2</video:title>
      <video:description>jakarta</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395609/3395609_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:34:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Balança Que Brilha,</video:title>
      <video:description>Felicidade é isso balança que brilha Clic Rádio Porto Alegre #musica #pop #ia #cantor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395608/3395608_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-09-01T23:34:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saking Maruknya</video:title>
      <video:description>Striker Ini Sampai Disogok Klub Cuma Buat Ngasih Umpan!</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395607/3395607_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T23:33:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES: KONG VS TUBARÕES A BATALHA DOS GIGANTES MAIS INTENSAS DO OCEANO</video:title>
      <video:description>REINO DOS TUBARÕES: KONG VS TUBARÕES A BATALHA DOS GIGANTES MAIS INTENSAS DO OCEANO Nas profundezas do oceano… algo colossal desperta na escuridão. Olhos gigantes observam em silêncio… e em segundos, o terror emerge das sombras! 2- Em meio à tempestade mortal… uma criatura colossal surge das profundezas. Relâmpagos iluminam o oceano… revelando o verdadeiro terror escondido nas águas! 3- O mar entra em silêncio absoluto… mas algo gigantesco se aproxima lentamente. Quando a criatura emerge das profundezas… ninguém consegue escapar do caos! 4- As águas começam a tremer… e uma força monstruosa surge diante dos navios. Em poucos segundos, o oceano se transforma em um verdadeiro pesadelo mortal! 5- O gigante desperta em meio às ondas violentas… encarando tudo ao seu redor. Cada passo da criatura faz o oceano tremer… anunciando a chegada da destruição! 6- Em meio a uma tempestade violenta, o mar gira formando um enorme redemoinho, enquanto um barco tenta escapar. De repente, um raio atinge as águas, levantando ondas gigantes e intensificando o caos. Em meio a uma violenta tempestade, um barco enfrenta ondas gigantes enquanto é cercado por dezenas de tubarões. Raios cortam o céu e o mar se agita intensamente, aumentando o perigo a cada segundo. sobre um mar revolto e uma tempestade intensa, uma enorme barbatana emerge das águas agitadas, cortando as ondas com força enquanto relâmpagos iluminam o cenário ameaçador. e um caos, uma turbulencia maritima e violenta, o gigantesco gorila Kong surge sobre o navio enquanto tubarões cercam o mar agitado, e, sob relâmpagos intensos, ele se ergue rugindo e abrindo os braços em um desafio imponente. Sob uma tempestade violenta, o gorila gigante ergue um enorme tubarão acima da cabeça e o arremessa com força ao mar, rugindo enquanto as ondas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395606/3395606_720p.mp4</video:content_loc>
      <video:duration>335</video:duration>
      <video:publication_date>2026-09-01T23:33:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quanto vale um touro de alta performance no rodeio?  How much is a high-performance rodeo bull worth</video:title>
      <video:description>Quanto vale um touro de alta performance no rodeio? How much is a high-performance rodeo bull worth?</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395605/3395605_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T23:33:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy 116th birthday to Corinthians!</video:title>
      <video:description>Subscribe to the channel and leave a like</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395604/3395604_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T23:33:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Religião motivacional</video:title>
      <video:description>Jesus cura salva e liberta #Jesusmotivacional</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395603/3395603_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:33:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sung Jinwoo vs. The Ant King - Solo Leveling Season 2 | Part 6/8 2</video:title>
      <video:description>Jinwoo crushes the Ant King like a bug in episode 24! Watch Solo Leveling Season 2 - Arise from the Shadow They say whatever doesn’t kill you makes you stronger, but that’s not the case for the world’s weakest hunter Sung Jinwoo. After being brutally slaughtered by monsters in a high-ranking dungeon, Jinwoo came back with the System, a program only he could see, that’s leveling him up in every way. Now, he’s inspired to discover the secrets behind his powers and the dungeon that spawned them. #SoloLeveling #SoloLevelingSeason2 #Season2Episode24 #SungJinwoo #TheAntKing #SungJinwoovsTheAntKing</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395602/3395602_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-01T23:33:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grêmio 3</video:title>
      <video:description>#Grêmio #time #ganhar</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395601/3395601_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T23:33:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sung Jinwoo vs. The Ant King - Solo Leveling Season 2 | Part 8/8</video:title>
      <video:description>Jinwoo crushes the Ant King like a bug in episode 24! Watch Solo Leveling Season 2 - Arise from the Shadow They say whatever doesn’t kill you makes you stronger, but that’s not the case for the world’s weakest hunter Sung Jinwoo. After being brutally slaughtered by monsters in a high-ranking dungeon, Jinwoo came back with the System, a program only he could see, that’s leveling him up in every way. Now, he’s inspired to discover the secrets behind his powers and the dungeon that spawned them. #SoloLeveling #SoloLevelingSeason2 #Season2Episode24 #SungJinwoo #TheAntKing #SungJinwoovsTheAntKing</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395600/3395600_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-01T23:33:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Different Princess EP09 / 不同的公主</video:title>
      <video:description>故事講述了女作家華清歌誤入自己小說的世界，變成了一個卑鄙的配角。她以為掌控劇本就能扭轉乾坤，卻沒想到遭遇了一連串的曲折，最後與季初展開了一段充滿愛恨糾葛的劇情。</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395599/3395599_720p.mp4</video:content_loc>
      <video:duration>1834</video:duration>
      <video:publication_date>2026-09-01T23:33:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teacup puppys</video:title>
      <video:description>#Teacup #puppy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395598/3395598_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:33:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desvendando mistério</video:title>
      <video:description>A soma dos 7 #Construçãoobrasserviço</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395597/3395597_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T23:32:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grêmio 2</video:title>
      <video:description>#Grêmio #timão</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395596/3395596_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T23:32:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funky Groove Ride – SoundMancerMusic | American Funk</video:title>
      <video:description>Funky Groove Ride – SoundMancerMusic Turn up the bass, catch the groove and get ready to move. “Funky Groove Ride” is an energetic American funk track driven by a powerful bassline, vibrant horns and an irresistible dance beat. With a lively groove, energetic male vocals and catchy chorus harmonies, the track brings the spirit of a classic funk party straight to the dance floor. From the pounding bass to the explosive horn lines, “Funky Groove Ride” is all about rhythm, movement, energy and having a good time. 🎵 Track: Funky Groove Ride 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #FunkyGrooveRide #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #BasslineFunk #GroovyBassline #FunkHorns #HornSection #FunkDrums #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395595/3395595_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-09-01T23:31:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joao Pedro mengambil nomor punggung terkutuk Chelsea 😳</video:title>
      <video:description>#bola</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395594/3395594_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T23:31:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rotina da tarde</video:title>
      <video:description>Vídeo de rotina. #Rotinadatarde #vlog</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395593/3395593_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T23:31:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>new york 3</video:title>
      <video:description>new york</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395592/3395592_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:31:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pássaro raro</video:title>
      <video:description>Pássaro mais raro do mundo #Pássaro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395591/3395591_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:31:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não despreze</video:title>
      <video:description>Religião motivacional mensagem divina #motivacional</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395590/3395590_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O trem chegando</video:title>
      <video:description>Este vídeo fala sobre meninos que iam a escola, porque era o regresso das aulas porém o trem não chegava a tempo, então eles ficaram tão mais tão preocupados que quando viram o trem correram em direção a locomotiva #História</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395589/3395589_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:31:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grêmio</video:title>
      <video:description>#Grêmio #ganhar</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395588/3395588_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T23:31:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>assim que o diabo gosta</video:title>
      <video:description>Blues Rock #blues #rock</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395587/3395587_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-09-01T23:31:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Jornada da Alma</video:title>
      <video:description>A vida é um quebra-cabecas, a cada dia a gente junta uma peça; quando quebra-cabeças tá montado, é hora de partir! #viagemastral #eternidade</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395586/3395586_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-09-01T23:30:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inter 3</video:title>
      <video:description>#Perder #grêmio #grenal</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395585/3395585_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:29:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chuchu na grama da minha mãe</video:title>
      <video:description>Chuchu brincando no gramado da minha mãe #orkidea #gramado</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395584/3395584_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T23:29:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You Won&apos;t Believe This DIY SWAN PLANT POT Made of Cement! 🦢</video:title>
      <video:description>#DIYPlantPot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395583/3395583_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T23:29:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frequência de renascimento  ! Deixe o passado para trás  !</video:title>
      <video:description>Ouça com fone ! Permita - se !</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395581/3395581_720p.mp4</video:content_loc>
      <video:duration>265</video:duration>
      <video:publication_date>2026-09-01T23:28:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perder</video:title>
      <video:description>#Inter #perder</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395580/3395580_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:28:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>california</video:title>
      <video:description>california</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395579/3395579_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:28:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Reincarnated With OVERPOWERED Abilities After Being BETRAYED By His Family | Anime Recap</video:title>
      <video:description>#animes #usa #frança #brazil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395578/3395578_720p.mp4</video:content_loc>
      <video:duration>3621</video:duration>
      <video:publication_date>2026-09-01T23:28:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TORNEIO DE STREET FIHGJTER 2 - TOP 8 E FINAIS- INSANO!</video:title>
      <video:description>The best Street Fighter 2 players in a fierce and brutal battle for the title of best player! #STREETFIGHTER #TURNAMENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395577/3395577_720p.mp4</video:content_loc>
      <video:duration>3110</video:duration>
      <video:publication_date>2026-09-01T23:28:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395576</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395576/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lord Cristo</video:title>
      <video:description>The word of God #MyGod</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395576/3395576_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:27:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Começo da série pixelmon #1</video:title>
      <video:description>Série de pixelmon no celular</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395575/3395575_720p.mp4</video:content_loc>
      <video:duration>682</video:duration>
      <video:publication_date>2026-09-01T23:27:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395574/3395574_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:27:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395573/3395573_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:26:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inter 2</video:title>
      <video:description>#Inter #perder</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395572/3395572_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T23:26:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395571/3395571_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:26:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Músicas SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Dar Força na Caminhada</video:title>
      <video:description>Músicas SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Dar Força na Caminhada #louvor #gospel #sertanejo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395570/3395570_720p.mp4</video:content_loc>
      <video:duration>678</video:duration>
      <video:publication_date>2026-09-01T23:25:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Descarta os vidro assim e não vai ter acidente</video:title>
      <video:description>Descarta os vidro assim e não vai ter acidente #Vidro #descartarvidro #acidentecomvídeo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395569/3395569_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T23:25:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Raça  negra</video:title>
      <video:description>Raça negra cara um música top #musicapopvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395568/3395568_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T23:25:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desenho Naruto Shippuuden</video:title>
      <video:description>Desenho Naruto - ITACHI #Itachi #naruto #NarutoShippuuden #desenho #viral #cut #fyp #foryou #tiktok #eua #brasil #brazil #like #compartilhar</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395567/3395567_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:25:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395566/3395566_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:25:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Music, ouça com o coração!</video:title>
      <video:description>#musicamusicdeusvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395565/3395565_720p.mp4</video:content_loc>
      <video:duration>137</video:duration>
      <video:publication_date>2026-09-01T23:25:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395564/3395564_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:25:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Política em campo grande ms</video:title>
      <video:description>Eu minha filha Gabrielly e minha mãe estavamos num evento político #politica #evento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395563/3395563_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T23:25:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Locura</video:title>
      <video:description>#Locura #pessoas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395562/3395562_720p.mp4</video:content_loc>
      <video:duration>253</video:duration>
      <video:publication_date>2026-09-01T23:24:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funk City Nights – SoundMancerMusic | High Energy American Funk</video:title>
      <video:description>Funk City Nights – SoundMancerMusic When the city lights come alive, the funk takes over the night. “Funk City Nights” is a high-energy American funk track powered by explosive bass, vibrant horns, energetic drums and an irresistible groove made for the dance floor. Flashing lights, a packed crowd and powerful rhythms create a wild nightlife atmosphere where music, passion and movement come together. With energetic male vocals and strong chorus harmonies, “Funk City Nights” delivers pure funk energy from beginning to end. Turn up the bass, feel the horns and let the groove take control. 🎵 Track: Funk City Nights 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #FunkCityNights #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #HighEnergyFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #ExplosiveBass #FunkHorns #HornSection #FunkDrums #DanceMusic #PartyFunk #FunkParty #NightlifeMusic #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395561/3395561_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-01T23:24:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>real madrid 8</video:title>
      <video:description>real madrid</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395560/3395560_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T23:24:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395559/3395559_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:24:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVORES SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Trazer Resposta à Sua Fé</video:title>
      <video:description>LOUVORES SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Trazer Resposta à Sua Fé #GOSPEL #musicas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395558/3395558_720p.mp4</video:content_loc>
      <video:duration>704</video:duration>
      <video:publication_date>2026-09-01T23:24:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eles estão passeando</video:title>
      <video:description>Um passeio entre amigos e maravilhoso #Passeio #conversar #amigos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395557/3395557_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T23:24:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Foto top</video:title>
      <video:description>A magia das fotos #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395556/3395556_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T23:24:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>yuhuuuu</video:title>
      <video:description>yuhuuuu</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395555/3395555_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:24:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon Ball Z - DBZ</video:title>
      <video:description>Dragon Ball Z 🐉🐲 #DBZ #DragonBallZ #Desenho #viral #cut #gravação #drawing #fyp #foryou #up #like #shorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395554/3395554_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T23:24:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395553/3395553_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:24:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DcuGgsuJ1RD</video:title>
      <video:description>DcuGgsuJ1RD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395552/3395552_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T23:23:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395551/3395551_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:23:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clic Rádio Porto Alegre essa onda é demais.</video:title>
      <video:description>A SUA RÁDIO WEB EM QUALQUER LUGAR #musica #informaçao #educação</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395550/3395550_720p.mp4</video:content_loc>
      <video:duration>117</video:duration>
      <video:publication_date>2026-09-01T23:23:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Contração</video:title>
      <video:description>Fazendo caicharia #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395549/3395549_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T23:23:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>uda makan belum ya</video:title>
      <video:description>uda makan belum ya</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395548/3395548_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:23:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natal 6</video:title>
      <video:description>#Natal #criança #papaiNoel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395547/3395547_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:23:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395546/3395546_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:23:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desenho - Spider Man - Homen Aranha</video:title>
      <video:description>Spider Man 🕷️🕸️ #Spiderman</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395545/3395545_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T23:22:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video_by_inabo_la</video:title>
      <video:description>Video_by_inabo_la</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395544/3395544_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T23:22:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enjoy 97</video:title>
      <video:description>Enjoy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395543/3395543_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-01T23:22:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natal 5</video:title>
      <video:description>#Natal #criança</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395542/3395542_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:21:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Always Acted Like a Useless Boy, But Secretly He Was the Strongest Warrior in the World</video:title>
      <video:description>#animes #china #frança</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395541/3395541_720p.mp4</video:content_loc>
      <video:duration>1500</video:duration>
      <video:publication_date>2026-09-01T23:21:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As vogais</video:title>
      <video:description>Vamos aprender as vogais #Educação</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395540/3395540_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T23:21:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bastidores Universo dos Fãs 2</video:title>
      <video:description>PodCast #Entretenimento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395539/3395539_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-01T23:21:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alasan Tottenham membeli Savinho dengan sangat mahal 🤯</video:title>
      <video:description>#bola</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395538/3395538_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-01T23:21:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jogos gta vl</video:title>
      <video:description>Jogos gtavl jogo s gtavl #Jogosvljogosvl</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395537/3395537_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-01T23:20:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natal 4</video:title>
      <video:description>#Natal #criança</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395536/3395536_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T23:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A morning with no big plans, wandering the streets of Porto</video:title>
      <video:description>☕️✨ Which spot is an absolute must for breakfast? 👇🏼 #Porto #fyp #porto #travel #fyp #girl #portugal #portuguesegirl</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395535/3395535_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T23:20:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 7</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395534/3395534_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Toda Noite Lhe Procuro Pelas Ruas”: trecho</video:title>
      <video:description>Uma música apaixonada, cheia de saudade e sentimento. ❤️🎶 Toda noite lhe procuro pelas ruas, tentando encontrar quem não sai do meu pensamento. #JoãoBrito #JoãoBritoBregaxote #TodaNoiteLheProcuroPelasRuas #música #seresta #brega #bregaxote #arrocha #sofrência #músicaromântica #saudade #amor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395533/3395533_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T23:20:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 6</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395532/3395532_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:20:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 5</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395531/3395531_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 4</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395530/3395530_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 3</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395529/3395529_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T23:20:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 2</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395528/3395528_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_30.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_30.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395527/3395527_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:20:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395526/3395526_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você sabia que a Terra gira a mais de 1.600 km/h?</video:title>
      <video:description>No equador, nosso planeta completa uma rotação a aproximadamente 1.670 km/h, mas nós não sentimos esse movimento porque tudo ao nosso redor — incluindo a atmosfera e os oceanos — se move junto com a Terra. Neste vídeo, descubra como a rotação do planeta funciona, por que a velocidade varia conforme a latitude e como podemos viajar pelo espaço sem perceber esse movimento impressionante. #Espaço #universo #mundo #terra #Brasil #curiosidade</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395525/3395525_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T23:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_29.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_29.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395524/3395524_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Estrada Vazia (Cezar Rodriguez)</video:title>
      <video:description>Uma viola, uma estrada e o silêncio que fala mais que mil palavras. &quot;Estrada Vazia&quot; é aquela moda calma pra escutar olhando pela janela, lembrando de quem foi embora ou pensando na vida sem pressa. Gravada na afinação Cebolão em Ré, com toda simplicidade que a viola caipira pede. deixa nos comentários o que ela te fez lembrar. #Blues #Folk</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395523/3395523_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-01T23:19:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_28.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_28.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395522/3395522_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:19:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O amigo de he-man enfrentou um dos vilões mais poderosos do rei esqueleto 🎭🎬🍿</video:title>
      <video:description>O amigo de he-man enfrentou um dos vilões mais poderosos do rei esqueleto 🎭🎬🍿 Os melhores filmes de 2026 até 2027 os trechos também são muito legais e bons para você assistir e acompanhar trechos legais de filmes e séries #FilmesLançamentosdefilmesséries</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395521/3395521_720p.mp4</video:content_loc>
      <video:duration>205</video:duration>
      <video:publication_date>2026-09-01T23:19:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_27.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_27.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395520/3395520_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:19:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395519/3395519_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:19:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cavaleiros do zodiaco</video:title>
      <video:description>#Guerrasanta</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395518/3395518_720p.mp4</video:content_loc>
      <video:duration>1240</video:duration>
      <video:publication_date>2026-09-01T23:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_26.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_26.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395517/3395517_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:19:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relevo</video:title>
      <video:description>#Bitcoin #relevo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395516/3395516_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-01T23:19:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395515/3395515_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:19:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_25.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_25.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395514/3395514_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:18:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395513/3395513_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:18:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_24.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_24.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395512/3395512_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:18:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pagiiii 2</video:title>
      <video:description>pagiiii</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395511/3395511_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T23:18:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_23.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_23.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395510/3395510_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:18:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Renovar Sua Confiança</video:title>
      <video:description>SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Renovar Sua Confiança #SERTANEJODAROÇA</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395509/3395509_720p.mp4</video:content_loc>
      <video:duration>682</video:duration>
      <video:publication_date>2026-09-01T23:18:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Veo 3</video:title>
      <video:description>#fouryoufypfy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395508/3395508_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T23:18:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395507/3395507_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:18:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ladies dress 2</video:title>
      <video:description>New arrivals Ladies dress #Ladies</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395506/3395506_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:17:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_22.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_22.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395505/3395505_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:17:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neymar Jr skills 💀 #football</video:title>
      <video:description>Subscribe! #Football</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395504/3395504_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T23:17:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Girl 160</video:title>
      <video:description>So Hot Girl</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395503/3395503_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T23:17:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gripe</video:title>
      <video:description>#Gripemel #limão</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395502/3395502_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T23:17:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395501/3395501_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:17:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_21.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_21.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395500/3395500_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:17:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FUI PARAR AO JAPÃO COM UM ROBÔ GIGANTE?!</video:title>
      <video:description>Imagina você, num domingo à noite, de boa em casa em Niterói, e do nada... PÁ! É abduzida por um robô gigante e vai parar direto no Japão?! 😱🇯🇵 O Japão! O Coração! ❤️🤖 Fui levada pelo Study (um robô com coração de ouro), voei sobre a Tokyo Skytree toda iluminada, fiz yoga no Monte Fuji e até ganhei poderes mágicos! Tudo isso embalado com muito humor e um visual cinematográfico 100% criado com Inteligência Artificial lá no Pippit.ai! 🎬✨ Dá o play nessa superprodução e vem viajar comigo! E me conta aqui nos comentários: se um robô gigante aparecesse no seu quarto hoje, para que lugar do mundo você pediria para ir? 👇 #Shorts #Novelinha #Humor #Japão #InteligênciaArtificial #Ficção #Shorts #PippitAI #InteligênciaArtificial #IA #AIVideo #Novelinha #Humor #Comédia #Japão #Tokyo #MonteFuji #Robô #Aventura #Ficção #TextToVideo #Websérie #Entretenimento #Viral #CulturaJaponesa #ContadoresDeHistorias #CriadoraDeConteúdo #Humorista #Roteiro #VídeoCurto #FilmeComIA #ArteDigital #GenerativeAI #ViagemMagica #AnneDeSousa #Shorts #Novelinha #Humor #Japão #InteligênciaArtificial #Ficção #PippitAI #IA #AIVideo #Comédia #Tokyo #MonteFuji #Robô #Aventura #TextToVideo #Websérie #Entretenimento #Viral #CulturaJaponesa #ContadoresDeHistorias #CriadoraDeConteúdo #Humorista #Roteiro #VídeoCurto #FilmeComIA #ArteDigital #GenerativeAI #ViagemMagica #AnneDeSousa #Niterói</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395499/3395499_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-01T23:17:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sung Jinwoo vs. The Ant King - Solo Leveling Season 2 | Part 6/8</video:title>
      <video:description>Jinwoo crushes the Ant King like a bug in episode 24! Watch Solo Leveling Season 2 - Arise from the Shadow They say whatever doesn’t kill you makes you stronger, but that’s not the case for the world’s weakest hunter Sung Jinwoo. After being brutally slaughtered by monsters in a high-ranking dungeon, Jinwoo came back with the System, a program only he could see, that’s leveling him up in every way. Now, he’s inspired to discover the secrets behind his powers and the dungeon that spawned them. #SoloLeveling #SoloLevelingSeason2 #Season2Episode24 #SungJinwoo #TheAntKing #SungJinwoovsTheAntKing</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395498/3395498_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-09-01T23:17:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amor de IA</video:title>
      <video:description>Tem gente que se apaixona por IA, fica muito tempo no pc #musica #pop #sertanejo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395497/3395497_720p.mp4</video:content_loc>
      <video:duration>229</video:duration>
      <video:publication_date>2026-09-01T23:17:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot China Girl</video:title>
      <video:description>Sexy Girl</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395496/3395496_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T23:17:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The vampire diares</video:title>
      <video:description>Diário de um vampiro #Thevampirediares</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395495/3395495_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T23:16:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES KONG VS TUBARÕES A BATALHA DOS GIGANTES</video:title>
      <video:description>REINO DOS TUBARÕES KONG VS TUBARÕES A BATALHA DOS GIGANTES ALGO MONSTRUOSO DESPERTOU NAS PROFUNDEZAS... #Kong #Godzilla #MonstrosGigantes #TubarãoGigante #OceanoProfundo #Kaiju #MonsterVerse #BatalhaÉpica #CriaturasMarinhas #FilmeCinematográfico #TerrorNoOceano #Tempestade #KongVsShark #SeaMonster #EpicBattle #Ação #Suspense #Mistério #MonstroMarinho #4K Kong enfrentou milhões de tubarões devoradores de metal em uma batalha brutal no meio do oceano durante uma tempestade apocalíptica. ⚡🦈 Mas o verdadeiro terror estava escondido nas profundezas... Neste vídeo cinematográfico você vai testemunhar: 🔥 batalhas épicas 🌊 criaturas marinhas gigantes ⚡ tempestades monstruosas 💀 predadores assustadores 👑 a luta do verdadeiro rei dos monstros Prepare-se para uma experiência intensa cheia de tensão, ação e criaturas colossais em um oceano dominado pelo medo. 📌 Assista até o final para descobrir qual criatura fez até Kong hesitar. 👍 Deixe seu like 🔔 Inscreva-se no canal 🔥 Ative o sino para mais vídeos épicos de monstros gigantes e mistérios do oceano. #kongvsshark #kongvsgiantshark #kongoceanbattle #giantshark #megashark #kongedit #kong4k #epickongbattle #monsterfight #giantcreature #deepseamonster #scaryoceancreatures #apocalypticocean #kongcinematic #kongtrailer #epicmonster #kongvsseamonster #tubarãogigante #kongvstubarão #monstromarinho #oceanoprofundo #batalhaépica #tempestadenooceano #criaturasgigantes #terrornooceano #monstrosdooceano #criaturasassustadoras</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395494/3395494_720p.mp4</video:content_loc>
      <video:duration>442</video:duration>
      <video:publication_date>2026-09-01T23:16:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Renovar Sua Fé</video:title>
      <video:description>SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Renovar Sua Fé #LOUVORESGOSPEL</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395493/3395493_720p.mp4</video:content_loc>
      <video:duration>673</video:duration>
      <video:publication_date>2026-09-01T23:16:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wandinha 6</video:title>
      <video:description>Wandinha #Wandinha</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395492/3395492_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:16:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus Cristo abençoe sempre</video:title>
      <video:description>Quem ama jesus ajunda</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395491/3395491_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-01T23:16:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Home Made Lays Chips</video:title>
      <video:description>My Favourite Chips</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395490/3395490_720p.mp4</video:content_loc>
      <video:duration>417</video:duration>
      <video:publication_date>2026-09-01T23:16:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piadas 7</video:title>
      <video:description>#Piadas #rizada</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395489/3395489_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T23:16:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prettylittleliars</video:title>
      <video:description>Prettylittleliars #Prettylittleliars</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395488/3395488_720p.mp4</video:content_loc>
      <video:duration>152</video:duration>
      <video:publication_date>2026-09-01T23:15:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O guerreiro desse cara caiu numa armadilha que o velho preparou para ele cabana 🎭🎬🍿</video:title>
      <video:description>O guerreiro desse cara caiu numa armadilha que o velho preparou para ele cabana 🎭🎬🍿 #CícerodosSantosSilvafilmescompletosdublados2026</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395487/3395487_720p.mp4</video:content_loc>
      <video:duration>229</video:duration>
      <video:publication_date>2026-09-01T23:15:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minhas filhas de 4 patas 🐾</video:title>
      <video:description>Mel fazendo nada 😂 #Dogs</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395486/3395486_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T23:15:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diario de um vampiro</video:title>
      <video:description>Katherine #Thevampirediares</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395485/3395485_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-01T23:15:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395484</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395484/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Louvor e adoração</video:title>
      <video:description>Louvor #LouvoreadoraçãopalavradeDeus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395484/3395484_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:15:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wandinha 5</video:title>
      <video:description>Wandinha #Wandinha</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395483/3395483_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:15:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lucas paiva x Touro Asteca, cia 2 M.  Lucas Paiva vs. Asteca Bull, 2M Company</video:title>
      <video:description>Lucas paiva x Touro Asteca, cia 2 M. Lucas Paiva vs. Asteca Bull, 2M Company</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395482/3395482_720p.mp4</video:content_loc>
      <video:duration>110</video:duration>
      <video:publication_date>2026-09-01T23:15:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_700.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_700.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395481/3395481_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:14:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bastidores PodCast Universo dos Fãs</video:title>
      <video:description>Alegria geral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395480/3395480_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T23:14:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_699.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_699.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395479/3395479_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:14:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395478</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395478/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Noite 2</video:title>
      <video:description>#Noite #luz</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395478/3395478_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T23:14:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bassline Boogie – SoundMancerMusic | American Funk</video:title>
      <video:description>Bassline Boogie – SoundMancerMusic Turn up the bass, feel the groove and let the funk take over the dance floor. “Bassline Boogie” is an energetic American funk track driven by a powerful bassline, vibrant horns, punchy drums and an irresistible dance groove. From the first beat to the final horn blast, the track brings the spirit of a packed funk party to life. Groovy rhythms, energetic male vocals and catchy chorus harmonies create a sound made for dancing, moving and having a good time. If you love funky basslines, powerful horns and classic dance-floor energy, “Bassline Boogie” is ready to bring the groove. 🎵 Track: Bassline Boogie 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #BasslineBoogie #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #BasslineFunk #FunkBass #GroovyBassline #FunkHorns #HornSection #FunkDrums #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395477/3395477_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-01T23:14:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_698.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_698.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395476/3395476_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:14:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_697.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_697.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395475/3395475_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:13:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395474</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395474/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_696.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_696.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395474/3395474_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:13:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natal 3</video:title>
      <video:description>#Natal #criança</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395473/3395473_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T23:13:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As músicas que fazem sucesso na Clic Rádio Porto Alegre</video:title>
      <video:description>Uma seleção de músicas criadas com IA na Clic Rádio Porto Alegre. Muito mais em www.clicradioportoalegre.com.br #musica #cantor #pop</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395472/3395472_720p.mp4</video:content_loc>
      <video:duration>1720</video:duration>
      <video:publication_date>2026-09-01T23:13:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_695.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_695.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395471/3395471_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pirlo : The Italian Magician 🔥🥶</video:title>
      <video:description>FC Mobile Review #FCMobile</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395470/3395470_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T23:13:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My friend coffee</video:title>
      <video:description>Starting another day with my hot coffee. #felicidades #hábitos #cultura</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395469/3395469_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:13:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pagiiii</video:title>
      <video:description>pagiiii</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395468/3395468_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:13:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_694.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_694.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395466/3395466_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:12:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ o pai do Lobão e meu avô colocou nós para trabalhar</video:title>
      <video:description>GTA o pai do Lobão e meu avô colocou nós para trabalhar por ter pegado mais que eu mando áudio #gtahistóriaLobãoGTAhistóriaCJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395465/3395465_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T23:12:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bitcoin 11</video:title>
      <video:description>#Bitcoin #farmar</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395464/3395464_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T23:12:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_693.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_693.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395463/3395463_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:12:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FUSCA GIRASSOL 🌻</video:title>
      <video:description>Atravessando a ponte com a melhor energia (e a maior bagunça)! 🌻🚗 Quem você coloca no banco de trás do Fusca Girassol pra cantar e bater palma com a Anne e a Beijinha? Já marca sua dupla de carona aqui nos comentários! 👇✨ Fusca Girassol 🌻🚗 ​Letra de Anne de Sousa Produção do clipe Gemini pippitai sunoai Eh eh eh! Hey hey hey! Anne e Beijinha chegaram! No Fusca Girassol! ​Na praia eu vou dançar Com você pra passear Lá lá lá lá lá! O vento sopra feliz E o Rio canta assim: “Vem sorrir! Vem cantar!” ​Gira gira girassol Brilha brilha feito o sol Bate palma sem parar Que o mambo vai começar! ​Fusca Girassol! Olê olá! Anne e Beijinha vão dançar! Hey! Hey! Pela praia a brincar! ​Fusca Girassol! Vem rodar! Todo mundo a celebrar! Bate palma sem parar! ​Ô ô ô! Hey hey hey! ​No céu estrelas no ar Lá lá lá! No Fusca Girassol! ​#fusca #riodejaneiro #trends #comedia #fuscagirassol #beijinhapopples #annedesousa #humorbrasil #comediabrasileira #fusca #rj #niteroi #errejota #musicacomica #sunoai #clipemusical #trends #humor #praia #passeio #mambo #diversao #carona #amigos #riodejaneiro #icarai #musicaautoral #funny #comedy #viral #reels #tiktok #shorts #musicvideo #roadtrip #fun #happy #goodvibes #lifestyle #contentcreator #show #entertainment #trendalert #humorleve #sun #chill #party #dance #sing</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395462/3395462_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-01T23:12:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ZYNTHERA – Midnight Without You  Official Music Video</video:title>
      <video:description>Enter the night with ZYNTHERA and “Midnight Without You” — a powerful rock song about loneliness, memories, and the feeling of missing someone when the world goes silent. Turn up the volume, feel the atmosphere, and let the night take you somewhere else. 🎵 Artist: ZYNTHERA 🎵 Song: Midnight Without You 🎬 Official Music Video If you enjoy rock, emotional songs, powerful guitars and atmospheric music, follow ZYNTHERA for more original releases. Listen to ZYNTHERA: Available on major music platforms. #ZYNTHERA #MidnightWithoutYou #ZYNTHERAMidnightWithoutYou #rockmusic #rocksong #originalmusic #officialmusicvideo #emotionalrock #melodicrock #guitarrock #newrockmusic #alternativerock #rockband #musicvideo #originalsong #internationalmusic #emotionalmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395461/3395461_720p.mp4</video:content_loc>
      <video:duration>300</video:duration>
      <video:publication_date>2026-09-01T23:12:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PROTEÇÃO CONTRA INCENDIO NA KOMBI</video:title>
      <video:description>Neste vídeo faço um dispositivo de proteção no Carburador da Kombi para proteger de pegar fogo e muito bom prevenir sempre sejam bem vindos ao nossos vídeos #ProteçãoCarburadorcontraincendioKombihomeprevençãofogo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395460/3395460_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-01T23:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395459</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395459/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_692.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_692.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395459/3395459_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395458</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395458/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A garota contratou o melhor espadachim para levar ela até a muralha 🎭🎬🍿</video:title>
      <video:description>A garota contratou o melhor espadachim para levar ela até a muralha 🎭🎬🍿 Aqui nós temos melhores filmes e séries de 2026 e etc 🎭🎬🍿 #CícerodosSantosSilva</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395458/3395458_720p.mp4</video:content_loc>
      <video:duration>293</video:duration>
      <video:publication_date>2026-09-01T23:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395457</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395457/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_691.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_691.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395457/3395457_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:12:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395456</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395456/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ eu e o Lobão fomos pego formando Áurea na praça</video:title>
      <video:description>GTA eu e o Lobão fomos pega o formando água na praça #cjLobãoGTASanAndreashistóriaCJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395456/3395456_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T23:11:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395455</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395455/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_690.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_690.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395455/3395455_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:11:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395454</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395454/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_689.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_689.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395454/3395454_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:11:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oração 5</video:title>
      <video:description>#Papa #oração #reza</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395453/3395453_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T23:11:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395452</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395452/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_688.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_688.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395452/3395452_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:11:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395451</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395451/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Promaq Serralheria</video:title>
      <video:description>Tudo sobre serralheria, e caldeiraria #Serralheria</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395451/3395451_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:11:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395450</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395450/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐭🧀 RATOLÂNDIA - EP 01: A Grande Fuga do Queijo! 🧀🐭</video:title>
      <video:description>Erick é só um ratinho tentando sobreviver mais um dia no Beco da Lata Furada... até que seu primo Mayke aparece com um &quot;presentinho&quot; que vai virar um baita problema! 😱 Quando um pedaço de queijo muito especial (e muito procurado 👀) para nas mãos de Erick, ele descobre que às vezes um desejo pode dar MUITO errado. Com os capangas do temido Gran-Queijo em seu encalço, Erick vai precisar de muita coragem (e um pombo muito paciente 🐦) para escapar dessa! Prepare-se para uma perseguição maluca pelos telhados da cidade, cheia de sustos engraçados e muita correria! 🏙️💨 ✨ Vem descobrir se Erick vai conseguir escapar dos vilões mais barulhentos de Ratolândia! ✨ 👉 Não esqueça de deixar seu like e se inscrever para não perder o próximo episódio de RATOLÂNDIA! #RatolandiaDesenhoAnimadoAventuraParaCriancasAnimacao</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395450/3395450_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-09-01T23:10:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_687.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_687.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395449/3395449_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:10:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ eu e o Lobão estamos formando água na praça</video:title>
      <video:description>GTA eu e o Lobão estamos formando hora na praça aí chega meu pai e o pai do Lobão o avô tiringa #gtaLobãohistóriaGTAhistóriaCJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395448/3395448_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T23:10:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Whoever Leaves the Mansion Last Gets to Keep It!</video:title>
      <video:description>Imagine morar em uma mansão com desconhecidos por meses! #mrbeastmansionfyp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395447/3395447_720p.mp4</video:content_loc>
      <video:duration>3471</video:duration>
      <video:publication_date>2026-09-01T23:10:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395446</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395446/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_686.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_686.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395446/3395446_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:10:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Burocracia (Cezar Rodriguez)</video:title>
      <video:description>&quot;Burocracia&quot; é um blues rock afiado que transforma filas, carimbos, papéis e a lentidão do sistema em música. A canção retrata o desgaste de quem precisa enfrentar a máquina burocrática no dia a dia. Composição da banda Barba Ruiva, a música mistura humor, inconformismo e a essência do blues para falar de um problema que todo mundo já viveu. Se você já perdeu tempo entre protocolos, assinaturas e repartições, essa música foi feita para você. 🎸 Composição: Rafael Figueira (Barba Ruiva) 🎤 Interpretação: Cezar Rodriguez #Blues #Rock</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395445/3395445_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-01T23:10:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_685.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_685.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395444/3395444_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:10:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_684.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_684.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395443/3395443_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai dj</video:title>
      <video:description>linda dj na praia #djpraia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395442/3395442_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T23:09:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5°dia de produção</video:title>
      <video:description>Resultado de criação 🐣🐣🪿🪿🐓🐓✅️✅️✅️ #Animaisavesalimentos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395441/3395441_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T23:09:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_683.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_683.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395440/3395440_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:09:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Different Princess EP08 / 不同的公主</video:title>
      <video:description>故事講述了女作家華清歌誤入自己小說的世界，變成了一個卑鄙的配角。她以為掌控劇本就能扭轉乾坤，卻沒想到遭遇了一連串的曲折，最後與季初展開了一段充滿愛恨糾葛的劇情。</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395439/3395439_720p.mp4</video:content_loc>
      <video:duration>2053</video:duration>
      <video:publication_date>2026-09-01T23:09:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_682.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_682.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395438/3395438_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:09:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fast 💀 #football #soccer</video:title>
      <video:description>Subscribe! #Football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395437/3395437_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T23:09:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai 5</video:title>
      <video:description>linda no banho #lora</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395436/3395436_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T23:09:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_681.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_681.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395435/3395435_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:08:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai 4</video:title>
      <video:description>linda lora</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395434/3395434_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:08:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arroz com linguiça de um jeito diferente</video:title>
      <video:description>Receitas facil e facil para seu almoço com arroz e linguiça! #Arroz #almoça #comida #comidinha #receitas #food #receitasfáceiserápidas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395433/3395433_720p.mp4</video:content_loc>
      <video:duration>276</video:duration>
      <video:publication_date>2026-09-01T23:08:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_680.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_680.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395432/3395432_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:08:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 Rural Woman: A Simple Life, Strong Roots 3</video:title>
      <video:description>Welcome to the beautiful life of a rural woman 🌻🌾. Here, you will find the daily routine of the countryside, hard work, simple moments, love for nature, homemade food, and the strength of a woman who is proud of her roots 🚜💚. Follow along and experience the peaceful and authentic beauty of country life! ✨ #RuralWoman🌾 #CountryLife🚜 #FarmLife🌱 #SimpleLife🍃 #CountryGirl🌻 #WomanOfTheFarm💪 #RuralLifestyle🌞 #LifeOnTheFarm🐓 #NatureLovers🌿 #CountryLiving💚</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395431/3395431_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:08:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai 3</video:title>
      <video:description>linda loira na piscina #blondie</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395430/3395430_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T23:08:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_679.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_679.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395429/3395429_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:08:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_678.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_678.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395428/3395428_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:07:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GRANDE FINAIS STREET FIGHTER 2 HYPER -PECO X FLAVIU RYU!!</video:title>
      <video:description>The world&apos;s best players in a fierce and brutal battle for the title of best player!</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395427/3395427_720p.mp4</video:content_loc>
      <video:duration>1204</video:duration>
      <video:publication_date>2026-09-01T23:07:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Synth Horizon – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Synth Horizon – SoundMancerMusic Enter a world of powerful synths, massive beats and unstoppable electronic energy. “Synth Horizon” is a high-energy EDM track driven by pulsing basslines, vibrant synthesizers and a powerful drop built for the dance floor. Explosive lights, laser beams and waves of electronic sound create an electrifying festival atmosphere as the energy keeps rising through the night. With energetic male vocals and strong chorus harmonies, “Synth Horizon” delivers a powerful journey from the first beat to the final moments before sunrise. Made for EDM fans, festivals, rave nights, parties and high-energy dance floors. 🎵 Track: Synth Horizon 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #SynthHorizon #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #Bassline #ElectronicBeat #VibrantSynths #SynthMusic #LaserShow #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395426/3395426_720p.mp4</video:content_loc>
      <video:duration>189</video:duration>
      <video:publication_date>2026-09-01T23:07:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES:  O PEQUENO TUBARÃO ANÃO A PEQUENA CRIATURA QUE ILUMINA AS PROFUNDEZAS DO OCEANO</video:title>
      <video:description>Reino dos Tubarões O PEQUENO TUBARÃO QUE ILUMINA AS PROFUNDEZAS TUBARÃO ANÃO DOCUMENTÁRIO DWARF LANTERNSHARK: O PEQUENO TUBARÃO QUE ILUMINA AS PROFUNDEZAS Nas regiões mais profundas e misteriosas dos oceanos do planeta, onde a luz do Sol desaparece completamente e a escuridão domina cada centímetro da água, vive uma criatura tão pequena quanto extraordinária. Um predador quase desconhecido do grande público, mas que possui uma habilidade capaz de desafiar a própria escuridão. Estamos falando do Dwarf Lanternshark, um dos menores tubarões já descobertos pela ciência. Seu nome científico é Etmopterus perryi, e apesar de seu tamanho reduzido, ele faz parte de um dos grupos mais fascinantes de tubarões das profundezas. Prepare-se para conhecer a incrível história de um pequeno sobrevivente que transformou a escuridão em sua maior aliada. Nome comum e científico O Dwarf Lanternshark, conhecido em português como Tubarão-Lanterna-Anão, pertence à família Etmopteridae, um grupo de tubarões famosos por possuírem órgãos capazes de produzir luz. Seu nome científico, Etmopterus perryi, foi oficialmente descrito em 1985. Embora seja considerado um verdadeiro tubarão, sua aparência é bastante diferente daquela dos grandes predadores que costumamos imaginar. Seu corpo é fino, alongado e adaptado para sobreviver em ambientes de pouca luz, onde quase nenhum outro animal consegue prosperar. Habitat e distribuição O Tubarão-Lanterna-Anão habita águas profundas do Oceano Atlântico Ocidental. Ele é encontrado principalmente próximo às costas da Venezuela e da Colômbia, em áreas do Mar do Caribe. Seu lar fica entre aproximadamente 280 e 450 metros de profundidade, uma região conhecida como zona mesopelágica. Nessas profundezas, a luz solar praticamente desaparece. A temperatura é baixa. A pr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395425/3395425_720p.mp4</video:content_loc>
      <video:duration>287</video:duration>
      <video:publication_date>2026-09-01T23:07:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_677.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_677.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395424/3395424_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:07:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bitelo levantando peso!</video:title>
      <video:description>Bitelo rumo ao campeonato de powerlift! #bitelopowerliftgymbitelopowerliftgym</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395423/3395423_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T23:06:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_676.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_676.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395422/3395422_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:06:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR DE ADORAÇÃO QUE VAI EDIFICA SUA FÉ | INSPIRADO |JULLIANY SOUZA | INÉDITA 2026 PLAY GOSPEL</video:title>
      <video:description>Um canal dedicado a espalhar a Palavra de Deus através da música gospel. Louvores que edificam, fortalecem a fé e enchem o coração de esperança. Que cada canção seja um encontro com Deus! 🙏✨ #louvorvidaeternaadoração</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395421/3395421_720p.mp4</video:content_loc>
      <video:duration>261</video:duration>
      <video:publication_date>2026-09-01T23:06:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminhão</video:title>
      <video:description>#Caminhão #acidente</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395420/3395420_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T23:06:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perfect Heels &amp; Beautiful Legs — So Elegant!</video:title>
      <video:description>Beautiful black stiletto heels — timeless elegance and style. Perfect for any occasion! #Heels #Style #Elegance #Fashion #Stilettos #EleganceFashionStilettos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395419/3395419_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T23:06:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_675.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_675.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395418/3395418_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:05:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💙The Best Thing🌷| Episode 1【FULL】Zhang Linghe, Xu Ruohan | iQIYI Philippines</video:title>
      <video:description>Zhang Linghe, Xu Ruohan</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395417/3395417_720p.mp4</video:content_loc>
      <video:duration>2551</video:duration>
      <video:publication_date>2026-09-01T23:05:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vinho</video:title>
      <video:description>#Vinho #canela</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395416/3395416_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:05:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_674.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_674.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395414/3395414_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:05:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_673.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_673.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395413/3395413_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:04:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>📉 The biggest MISTAKE ❌with MONEY you made TODAY</video:title>
      <video:description>O maior erro com dinheiro que cometeste hoje… (e nem sequer te apercebeste!) ⚠️💸 Não foi simplesmente gastar 🛍️. Foi gastar sem intenção! 🧠❌ 👑 Ricos: Têm uma intenção clara para cada euro que sai da carteira 💶🎯. 🏃‍♂️ Pobres: Deixam-se levar pelo impulso e pelo momento 💸⚡. 👇 O que é que dominou o teu dia de hoje? Comenta &quot;INTENÇÃO&quot; 🎯 ou &quot;IMPULSO&quot; ⚡! 💬👀 🔗 LANÇAMENTO BREVEMENTE 📲🔥 Segue o perfil se queres aprender a dominar o teu dinheiro em 2026/27! 🚀💰 📉 The biggest mistake with money you made today... (and you didn&apos;t even realize it!) ⚠️💸 It wasn&apos;t just spending 🛍️. It was spent unintentionally! 🧠❌ 👑 Rich: They have a clear intention for every euro that comes out of the wallet 💶🎯. 🏃‍♂️ Poor: They let themselves be carried away by the impulse and the moment 💸⚡. 👇 What dominated your day today? Comment &quot;INTENTION&quot; 🎯 or &quot;IMPULSE&quot; ⚡! 💬👀 🔗 LAUNCH SOON 📲🔥 Follow the profile if you want to learn how to master your money in 2026/27! 🚀💰 #Financefreedom #money #mindset</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395412/3395412_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T23:04:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_672.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_672.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395411/3395411_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:03:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amanda beraktivitas</video:title>
      <video:description>Amanda manopo cantik beraktivitas #Hiburan #shoping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395410/3395410_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-01T23:03:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TAN TAN TAN , YOUR HEART - DJ LKS RIT INTERNACIONAL - VIDEO LETRA</video:title>
      <video:description>TAN TAN TAN , YOUR HEART - DJ LKS RIT INTERNACIONAL - VIDEO LETRA #musicas #musicasinternacionais #amor #topsounds #love #djlksrit</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395409/3395409_720p.mp4</video:content_loc>
      <video:duration>227</video:duration>
      <video:publication_date>2026-09-01T23:03:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏆 Bora caçar verificados! 12</video:title>
      <video:description>🐎⚔️ CAÇADOR DE VERIFICADOS — MONTADO NO CAVALO! Bem-vindo à minha caçada! Não sou pro, não jogo perfeito, mas tenho o MELHOR parceiro do jogo: MEU CAVALO! 🐎 Lutando, caçando verificados e subindo rumo ao Desafiante — montado o tempo todo! Sem enrolação, só ação! 🔔 Se inscreve pra acompanhar eu e meu cavalo na próxima caçada! 👍 Curte se você também já jogou de cavalo! 💬 Comenta: &quot;Cavalo é vida!&quot; 🐎 #Desviral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395408/3395408_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T23:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Dua 14</video:title>
      <video:description>Ameen</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395407/3395407_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T23:03:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_671.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_671.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395406/3395406_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:03:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milho</video:title>
      <video:description>#Milho #colher</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395405/3395405_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T23:03:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Templo Onde o Passado Ainda Respira</video:title>
      <video:description>Há lugares onde a pedra parece guardar mais do que histórias. Entre templos antigos, perfumes no ar e o som dos sinos, existe uma sensação difícil de explicar… como se o passado ainda estivesse respirando. Talvez alguns lugares não tenham sido feitos apenas para serem vistos. Talvez tenham sido feitos para serem sentidos. Poesia Ancestral — onde o tempo deixa de falar… e começa a sussurrar #PoesiaAncestralOrbisRevelaMistériosAntigosTemplosAntigosHistóriaAntigaCivilizaçõesAntigasMistériosDaHistóriaArqueologiaShorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395404/3395404_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T23:02:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395403</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395403/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐸 IA 03</video:title>
      <video:description>Música 🎸🎷</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395403/3395403_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:02:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Puskas winner 2020 💀 #edit #puskas #football</video:title>
      <video:description>Subscribe! #football</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395402/3395402_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T23:02:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic Video 119</video:title>
      <video:description>Heart Touch Video</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395401/3395401_720p.mp4</video:content_loc>
      <video:duration>433</video:duration>
      <video:publication_date>2026-09-01T23:02:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 CAOS TOTAL NO EQUADOR! MOTIM EM PRESÍDIO PROVOCA CENAS DE GUERRA E OPERAÇÃO DAS FORÇAS DE SEGURANÇ</video:title>
      <video:description>⚠️ Momentos de extrema tensão foram registrados em um centro penitenciário do Equador, onde um grupo de detentos teria iniciado um violento motim, provocando cenas de caos dentro da unidade. 🚔 As forças de segurança realizaram uma grande operação para tentar retomar o controle do presídio, enquanto a situação se agravava e mobilizava equipes especializadas. 😨 Imagens que circulam nas redes sociais mostram o clima de tensão e reforçam a grave crise enfrentada pelo sistema penitenciário equatoriano. 🚨 Até o momento, as autoridades ainda não confirmaram oficialmente todos os detalhes sobre a origem da rebelião nem o balanço completo das consequências. A ocorrência segue sendo acompanhada. 👇 Na sua opinião, o que está por trás da crise nos presídios do Equador? 💬 Deixe sua opinião nos comentários. 🔁 Compartilhe esta notícia para manter mais pessoas informadas. 📲 Siga a página para acompanhar notícias policiais, flagrantes e acontecimentos que repercutem no Brasil e no mundo. #Piaui40graus #equador #motim #presídio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395400/3395400_720p.mp4</video:content_loc>
      <video:duration>106</video:duration>
      <video:publication_date>2026-09-01T23:02:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Levantando peso</video:title>
      <video:description>Vida de atleta é na academia também.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395399/3395399_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T23:02:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Peternakan Super Jenius versi PLUSTOTO4D</video:title>
      <video:description>Peternakan Super Jenius #faktaunik #shorts #fyp #reels link utama = https://plustoto4d.link/ alternatif 1. https://plustoto4d.mssg.me/ 2. https://heylink.me/4dplustoto versi PLUSTOTO4D</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395398/3395398_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T23:02:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milton pls 3</video:title>
      <video:description>Milton #Milton</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395396/3395396_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-01T23:01:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fazendo recorte perfeito</video:title>
      <video:description>Azulegista #Conduçãoobrasserviço</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395395/3395395_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T23:01:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂🚨 VÍDEO VIRALIZA! VOCÊ JÁ CONHECIA A “BRINCADEIRA DO LAMBE E CHEIRA”? 😱</video:title>
      <video:description>A “BRINCADEIRA DO LAMBE E CHEIRA”? 😱 🎥 Uma brincadeira chamada “lambe e cheira” está chamando a atenção nas redes sociais e despertando a curiosidade de muita gente. O vídeo rapidamente ganhou repercussão e já está rendendo comentários, risadas e opiniões diferentes entre os internautas. 👀 Afinal, o que será que tem nessa brincadeira que está fazendo tanta gente parar para assistir? 👇 Você já conhecia a brincadeira do “lambe e cheira”? 😂 Já viu esse vídeo? Conte nos comentários o que achou! #LambeECheirBrincadeiraViral #VideoViral #Viralizou #Piaui40Graus</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395394/3395394_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-01T23:00:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deus tem uma palavra pra você</video:title>
      <video:description>E um vídeo religioso, gospel, evangélicos #Religioso #evangelho #cristão #fé #graças</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395393/3395393_720p.mp4</video:content_loc>
      <video:duration>405</video:duration>
      <video:publication_date>2026-09-01T23:00:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 Nama Tempat paling panjang di dunia!! nomer 3 sampe ada lagu nya versi PLUSTOTO4D</video:title>
      <video:description>3 Nama Tempat paling panjang di dunia!! nomer 3 sampe ada lagu nya #shorts #fyp #reels link utama = https://plustoto4d.link/ alternatif 1. https://plustoto4d.mssg.me/ 2. https://heylink.me/4dplustoto versi PLUSTOTO4D</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395392/3395392_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:00:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>After Losing Everything, He Trains To Become The STRONGEST | New Anime Recap</video:title>
      <video:description>#anime #china #usa #coréia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395391/3395391_720p.mp4</video:content_loc>
      <video:duration>3855</video:duration>
      <video:publication_date>2026-09-01T23:00:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bolivian Lucha Libre: The Most Extreme Wrestling Show in the Andes! 🇧🇴🔥</video:title>
      <video:description>Experience the incredible world of Bolivian Lucha Libre, where fearless masked wrestlers deliver breathtaking action high in the Andes Mountains. Witness spectacular moves, colorful characters, and the unique culture that makes Bolivia&apos;s wrestling scene unlike anything else on Earth. If you enjoy wrestling, action, and cultural adventures, don&apos;t forget to Like, Subscribe, and Share for more amazing content! #BolivianLuchaLibre #LuchaLibre #Bolivia #Wrestling #MaskedWrestlers #ProWrestling #Andes #ExtremeSports #TravelBolivia #FightNight #WWE #AAA</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395390/3395390_720p.mp4</video:content_loc>
      <video:duration>1228</video:duration>
      <video:publication_date>2026-09-01T22:59:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai latina</video:title>
      <video:description>linda latina #latina</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395389/3395389_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:59:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai 2</video:title>
      <video:description>linda loira na cozinha #loirablondie</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395388/3395388_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:58:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 7</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395387/3395387_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T22:58:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES: Shark Kingdom: Prehistoric Shark Species That Science Almost Forgot</video:title>
      <video:description>REINO DOS TUBARÕES: Shark Kingdom: Prehistoric Shark Species That Science Almost Forgot Shark Kingdom: Prehistoric Shark Species That Science Almost Forgot 📖 Descrição do Vídeo (SEO) 🦈 Muito antes dos tubarões modernos dominarem os mares, existiram espécies extraordinárias que desapareceram ao longo de milhões de anos de evolução. Neste documentário, você conhecerá alguns dos tubarões extintos mais fascinantes já descobertos pela ciência. Descubra como viviam, onde habitavam, quais eram suas características únicas e por que desapareceram dos oceanos. Entre espécies raríssimas e pouco conhecidas, esta viagem pela pré-história revela animais impressionantes que ajudaram a moldar a evolução dos tubarões atuais. 🌊 Neste vídeo você vai descobrir: ✅ Espécies de tubarões extintos pouco conhecidas ✅ Como eram esses incríveis predadores marinhos ✅ Curiosidades surpreendentes sobre sua evolução ✅ O que levou essas espécies à extinção ✅ Descobertas feitas por paleontólogos ao redor do mundo Se você gosta de tubarões, animais pré-históricos, fósseis e documentários sobre a vida marinha, este vídeo foi feito para você. 👍 Deixe seu like, inscreva-se no canal e ative o sino para acompanhar novos documentários sobre tubarões, criaturas pré-históricas e os maiores predadores dos oceanos. #tubarõesextintos #tubarõespré-históricos #espéciesdetubarões #tubarãoextinto #megalodonte #tubarõesantigos #vidamarinha #paleontologia #fósseis #tubarõesraros #oceanoprofundo #predadoresmarinhos #evoluçãodostubarões #históriadostubarões #animaisextintos #criaturasmarinhas #megafaunamarinha #documentáriodetubarões #curiosidadessobretubarões #animaispré-históricos #documentário #dinossaurosmarinhos #oceano #ciência #biologiamarinha</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395386/3395386_720p.mp4</video:content_loc>
      <video:duration>334</video:duration>
      <video:publication_date>2026-09-01T22:58:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele Fez um Gol Lindo com essa jogada</video:title>
      <video:description>#Futebol</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395385/3395385_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tanaman loncat? versi PLUSTOTO4D</video:title>
      <video:description>tanaman loncat? #faktaunik #shorts #fyp #reels link utama = https://plustoto4d.link/ alternatif 1. https://plustoto4d.mssg.me/ 2. https://heylink.me/4dplustoto versi PLUSTOTO4D</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395384/3395384_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T22:58:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compilado melhores momentos</video:title>
      <video:description>ASMR Mukbang video #Sem #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395383/3395383_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T22:58:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receitasfit + suplementos para emagrecer Rápido</video:title>
      <video:description>OFERTA ESPECIAL MONJA GOTAS suplemento alimentar que te ajuda e acelera o seu emagrecimento. https://app.coinzz.com.br/checkout/1-unidade-dkrcp-0 PEÇA JÁ O SEU E PAGUE SOMENTE QUANDO O PRODUTO CHEGA NA SUA CASA! LINK AZUL FIXADO NO MEU PERFIL. https://app.coinzz.com.br/checkout/1-unidade-dkrcp-0 #emagreça #dietas #emagrecer #emagrecimento #receitas #fitness #saúde</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395381/3395381_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-01T22:57:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Industrial Cranes Are Made: Inside a Heavy Engineering Factory</video:title>
      <video:description>Ever wondered how massive industrial cranes are made? Take a look inside a heavy engineering factory and follow the manufacturing process — from steel fabrication and structural welding to machining, assembly, painting, and final testing. Industrial cranes are engineered to handle extreme loads while maintaining precision, strength, and reliability. #howindustrialcranesaremade #cranemanufacturing #craneproduction #cranefactory #industrialcranemanufacturing #howcranesaremade #heavycranemanufacturing #overheadcrane #gantrycrane #towercrane #craneconstruction #craneassembly #steelfabrication #structuralwelding #heavyengineering #liftingequipment #industrialequipment #cranecomponents #cranetesting #heavymachinerymanufacturing #steelmanufacturing #industrialmanufacturing #engineering #manufacturingprocess #howitsmade</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395380/3395380_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-09-01T22:57:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVORES SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Falar ao Seu Coração</video:title>
      <video:description>Uma seleção especial de hinos sertanejos da roça para tocar o coração e fortalecer a fé. Louvores que trazem mensagens de esperança, consolo e confiança em Deus para os momentos de luta, reflexão e caminhada. Que cada canção fale profundamente ao seu coração e renove sua esperança na presença de Deus. #LOUOVORESSERTANEJODAROÇA</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395379/3395379_720p.mp4</video:content_loc>
      <video:duration>895</video:duration>
      <video:publication_date>2026-09-01T22:57:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Baby Giraffe’s Sunset Adventure 🦒🌅 | Beautiful Wildlife Moment</video:title>
      <video:description>Watch a heartwarming giraffe family explore a vast golden savanna as the sun slowly sets behind the acacia trees. 🦒🌅 The young giraffe’s curious adventure, gentle family moments and peaceful landscape create a beautiful ultra-realistic wildlife experience. #babygiraffe #giraffefamily #giraffeadventure #Africansavanna #wildlifevideo #cuteanimals #sunsetwildlife #naturedocumentary #realisticwildlife #cinematicnature #8Kwildlife #Africananimals #peacefulnature #animalfamily #savannasunset #beautifulwildlife #relaxingnaturevideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395378/3395378_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:57:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANACONDA (2026) | Jason Statham &amp; Scott Adkins | Action Thriller Movie | 4K</video:title>
      <video:description>A deadly mission deep in the Amazon turns into a fight for survival when two elite fighters face a monstrous predator. Jason Statham and Scott Adkins battle a giant anaconda in this intense action-thriller concept trailer filled with danger, survival, and explosive moments in the heart of the jungle.#anaconda #jasonstatham #scottadkins #moviesmovierecapfilmmoviehorrorentertainmentHollywoodrecapNetflixDiretrizFilmesLENDASu0026MISTERIOSsciencefictionhorrormoviesthrillermoviesendingexplainedmoviesummaryexplainingmoviesshortfilmsmovierecapsummarizedmoviesAmazonPrimemovievideoscoolmovieshorrorfilmsmovietrailersplusdoomsdaymeteortrailercomingsoontotheaterspremieremovietrailerofficial2025movietrailers</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395377/3395377_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-01T22:57:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395376</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395376/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 6</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395376/3395376_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:57:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR Mukbang macarrão</video:title>
      <video:description>#ASMRmacarrão</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395375/3395375_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:56:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek cantik 17</video:title>
      <video:description>Cewek cantik manis #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395374/3395374_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:56:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Creeper MAIS educado do jogo 😇 (AI Edition)</video:title>
      <video:description>Creepe, você é perigoso? &quot;Não, eu sou um docinho&quot; 😇 O Creeper mais educado do Minecraft em estilo AI Edition. Será que a gente acredita? 😂 Se gostou, deixa o like e se inscreve! #minecraft #minecraftmemes #minecraftbedrock #memes #funnyvideo #humor #comedia #gamer #games #jogos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395373/3395373_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:56:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jajan enak</video:title>
      <video:description>Jajan buatan mama juwita #Hiburan #shopping</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395372/3395372_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-01T22:55:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395371</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395371/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mujeres en septiembre va hombre en septiembre</video:title>
      <video:description>#Humor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395371/3395371_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T22:55:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395370</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395370/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anbe Diana (2026) Hindi Dubbed</video:title>
      <video:description>Anbe Diana (2026) Hindi Dubbed Follows the chaotic love story between a Telugu boy in Perambur and an Anglo Indian girl.Anbae Diana is a simple rom-com about a Telugu boy and an Anglo-Indian girl and the chaos that follows as they try to get married.Cultural differences and family expectations test the chaotic romance of a couple in Chennai. They must overcome unexpected twists to keep their relationship alive. Genre: Comedy, Drama, Dual Audio, Romance, South Special Director: Pari Elavazhagan Actors: Cell Murugan, Chetan, Gopi Aravindh, Nikhila Sankar, Pari Elavazhagan, Ramya Ranganathan, Roja Selvamani Country: India Duration: 133 min Quality: HINDI Release: 2026 IMDb: 5.6 #Comedy #Drama #DualAudio #Romance #SouthSpecial</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395370/3395370_720p.mp4</video:content_loc>
      <video:duration>8392</video:duration>
      <video:publication_date>2026-09-01T22:55:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rave Pulse – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Rave Pulse – SoundMancerMusic Feel the pulse, follow the beat and lose yourself in the energy of the rave. “Rave Pulse” is an explosive high-energy EDM track driven by intense synthesizers, deep bass, massive electronic beats and a powerful drop made to ignite the dance floor. Flashing lights, pounding rhythms and a jumping crowd create an electrifying rave atmosphere where the energy keeps rising until dawn. With energetic male vocals and powerful chorus harmonies, “Rave Pulse” delivers pure electronic energy from beginning to end. Made for EDM fans, festivals, rave nights, parties and high-energy dance floors. 🎵 Track: Rave Pulse 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Rave / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #RavePulse #SoundMancerMusic #EDM #EDMMusic #RaveMusic #RaveEDM #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #IntenseSynths #RaveParty #DanceFloor #FestivalMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395369/3395369_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-01T22:55:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PBR Brazil!!!!</video:title>
      <video:description>PBR Brazil!!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395368/3395368_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T22:55:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing bermain 4</video:title>
      <video:description>Kucing yang lucu bermain #Hiburan #cat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395367/3395367_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T22:54:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rosas vermelhas</video:title>
      <video:description>Amor #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395366/3395366_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:54:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você so vau querer comer assim agora!!!</video:title>
      <video:description>Receitas fáceis e rápidas de sobremesa #Receitas #sobremesa #comida #food #doce #lancherapido</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395365/3395365_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T22:53:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neon Waves – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Neon Waves – SoundMancerMusic Ride the neon waves and let the energy take over the dance floor. “Neon Waves” is an explosive high-energy EDM track powered by intense synthesizers, hard-hitting bass, massive electronic beats and a powerful drop built for the peak of the night. Flashing lights, surging crowds and waves of electronic sound create an electrifying atmosphere where every beat pushes the energy higher. From the first pulse to the final moments before dawn, “Neon Waves” captures the excitement of a massive electronic music celebration. With energetic male vocals and powerful chorus harmonies, this track is made for EDM fans, festivals, parties and high-energy dance floors. 🎵 Track: Neon Waves 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music / Festival EDM 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #NeonWaves #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #IntenseSynths #NeonMusic #NeonEDM #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395364/3395364_720p.mp4</video:content_loc>
      <video:duration>186</video:duration>
      <video:publication_date>2026-09-01T22:53:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395363</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395363/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing imut 6</video:title>
      <video:description>Kucing yang pintar #Hiburan #cat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395363/3395363_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:53:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Curious Monkeys in a Magical Mangrove Forest 🐒🌿🦋</video:title>
      <video:description>Step into a stunning tropical mangrove forest where playful capuchin monkeys explore the treetops and discover a beautiful butterfly. 🐒🦋 Surrounded by crystal-clear water, lush greenery and warm morning sunlight, this ultra-realistic wildlife adventure captures the peaceful beauty of nature. #capuchinmonkeys #monkeyadventure #tropicalforest #mangroveforest #wildlifevideo #cuteanimals #butterflynature #tropicalwildlife #natureadventure #realisticwildlife #cinematicnature #8Knaturevideo #peacefulforest #animalexploration #beautifulscenery #wildlifedocumentary #relaxingnaturevideo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395362/3395362_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:53:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Al Rayyan x Al Shamal - gol</video:title>
      <video:description>O gol que levou Al Rayyan a final. #soccer #football #alrayyan</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395361/3395361_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-01T22:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 5</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395360/3395360_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T22:53:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TRAIRA É MUITO CRUEL</video:title>
      <video:description>TRAIRA COME PEDAÇO DO PIAU #UNITEDSTATES</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395359/3395359_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:53:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395358</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395358/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It Is Well with My Soul Instrumental (Flugelhorn &amp; Piano)</video:title>
      <video:description>It Is Well with My Soul Instrumental (Flugelhorn &amp; Piano) #ItIsWellwithMySoulInstrumental</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395358/3395358_720p.mp4</video:content_loc>
      <video:duration>233</video:duration>
      <video:publication_date>2026-09-01T22:52:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diciembre se acerca</video:title>
      <video:description>#Navidad</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395357/3395357_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kakutougi</video:title>
      <video:description>kakutougi #kakutougi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395356/3395356_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T22:52:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neon Drop – SoundMancerMusic | Festival EDM</video:title>
      <video:description>Neon Drop – SoundMancerMusic Turn up the lights, feel the bass and get ready for the drop. “Neon Drop” is a high-energy festival EDM track powered by explosive drops, deep basslines, powerful kicks, bright synthesizers and a futuristic nighttime rave atmosphere. Neon lights, lasers, rising synths and massive electronic beats build the energy as the crowd becomes one with the music. With processed electronic vocals, vocal chops and an emotional build-up leading into an intense final drop, “Neon Drop” is made for pure dance floor euphoria. From midnight to sunrise, this is a track for EDM fans who live for massive drops, festival energy and unforgettable nights. 🎵 Track: Neon Drop 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Festival EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #NeonDrop #SoundMancerMusic #EDM #EDMMusic #FestivalEDM #ElectronicDanceMusic #RaveEDM #RaveMusic #HighEnergyEDM #AmericanEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #DeepBass #ElectronicBeat #NeonRave #FestivalMusic #DanceFloor #VocalChops #SynthLeads #128BPM #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395354/3395354_720p.mp4</video:content_loc>
      <video:duration>246</video:duration>
      <video:publication_date>2026-09-01T22:52:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing yang lucu 3</video:title>
      <video:description>Kucing yang lucu, imut, #Hiburan #cat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395353/3395353_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:52:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat kita duduk cukup lama, darah cenderung lebih banyak berkumpul di bagian bawah tubuh.</video:title>
      <video:description>Saat kita duduk cukup lama, darah cenderung lebih banyak berkumpul di bagian bawah tubuh karena pengaruh gravitasi. Ketika berdiri terlalu cepat, tubuh membutuhkan beberapa detik untuk menyesuaikan tekanan darah dan mengalirkan kembali darah ke otak. Jika proses ini terlambat, aliran darah ke otak akan berkurang sesaat sehingga muncul gejala seperti pandangan menggelap, kepala terasa ringan, berkunang-kunang, bahkan bisa sampai pingsan. Kondisi ini dikenal sebagai hipotensi ortostatik. Pada kebanyakan orang, gejala akan hilang dalam hitungan detik setelah tubuh berhasil menyesuaikan tekanan darah. Namun risikonya tetap tidak boleh dianggap sepele karena seseorang dapat kehilangan keseimbangan dan terjatuh hingga mengalami cedera. Risiko ini lebih mudah terjadi pada orang yang mengalami dehidrasi, terlalu lama duduk atau berbaring, sedang kelelahan, atau mengonsumsi obat tertentu yang memengaruhi tekanan darah. Jika keluhan sering terjadi atau sampai berulang kali pingsan, sebaiknya segera memeriksakan diri ke dokter untuk mencari penyebabnya. Sumber: Mayo Clinic - Orthostatic Hypotension (Postural Hypotension), Cleveland Clinic - Orthostatic Hypotension, MSD Manual Consumer Version - Orthostatic Hypotension. 📍Link cek di bio Ikuti👉 dewafakta 👈 untuk video-video fakta menarik lainnya 📩 DM untuk penghapusan video. ⚠️ Semua gambar adalah milik pemiliknya masing-masing‼️ #fakta</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395352/3395352_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:52:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 4</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395351/3395351_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:52:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro Manais, cia de rodeio california!  Manais Bull, California Rodeo Company.</video:title>
      <video:description>Touro Manais, cia de rodeio california! Manais Bull, California Rodeo Company.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395350/3395350_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T22:52:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minhas filhas de 4 patas🐾</video:title>
      <video:description>Mel toda desconfiada porque estou gravando ela 😂 #Dogs</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395349/3395349_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:51:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Make Him Desperate</video:title>
      <video:description>What happens when a woman stops giving a man the admiration he once received? In this video, discover how changing your attitude, reclaiming your value, and stopping the chase can completely change the dynamic between you. If you want to build confidence, improve your positioning, and understand male behavior, watch until the end. #MalePsychology #RelationshipAdvice #SelfWorth</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395348/3395348_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T22:51:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 Dias no Rio: Pescando no Taquaruçu e Aquidauana! Será que Saiu Peixe?</video:title>
      <video:description>Foram 3 dias de muita aventura, acampamento, resenha e pescaria nos rios Taquaruçu e Aquidauana. Enfrentamos o desafio de encontrar os peixes, curtimos a natureza e registramos momentos incríveis à beira do rio. Será que a pescaria foi produtiva? Assista até o final para descobrir tudo o que aconteceu nessa jornada! 👍 Deixe seu like, inscreva-se no canal e ative o sininho para acompanhar mais pescarias e aventuras pelo Pantanal. #pescaria</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395347/3395347_720p.mp4</video:content_loc>
      <video:duration>1048</video:duration>
      <video:publication_date>2026-09-01T22:51:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395345</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395345/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Electric Storm – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Electric Storm – SoundMancerMusic Step into the storm and let the electronic energy take control. “Electric Storm” is a powerful high-energy EDM track driven by pulsing electronic beats, vibrant synthesizers, deep bass and an explosive drop made for the dance floor. Flashing lights, massive synth waves and a surging crowd create an electrifying atmosphere that keeps building through the night. From the first beat to the final moments before dawn, “Electric Storm” delivers pure electronic energy. With energetic male vocals and powerful chorus harmonies, this track is made for EDM fans, parties, festivals and high-energy dance floors. 🎵 Track: Electric Storm 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #ElectricStorm #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #PulsingBeat #VibrantSynths #SynthMusic #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395345/3395345_720p.mp4</video:content_loc>
      <video:duration>199</video:duration>
      <video:publication_date>2026-09-01T22:51:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 3</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395344/3395344_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T22:51:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Lado Bom de Cair de um Prédio</video:title>
      <video:description>HUMOR NEGRO. #humornegro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395343/3395343_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T22:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eles correm</video:title>
      <video:description>Uma situação de vencer ou vencer, correndo para atingir os objetivos de se salvar. #Correria #batata #tomate</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395341/3395341_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:51:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminha comigo Jesus</video:title>
      <video:description>Louvado seja Deus #Deuspai</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395340/3395340_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-01T22:50:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 2</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395339/3395339_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:50:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Electric Pulse – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Electric Pulse – SoundMancerMusic Feel the pulse, follow the lights and let the electronic energy take over. “Electric Pulse” is a high-energy EDM track driven by a pulsing electronic beat, vibrant synthesizers and a powerful drop built to ignite the dance floor. Neon lights, massive synth waves and a jumping crowd create an electrifying atmosphere where rhythm and energy take control. With energetic male vocals and strong chorus harmonies, “Electric Pulse” delivers a powerful electronic experience made for parties, festivals and late-night dance floors. 🎵 Track: Electric Pulse 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #ElectricPulse #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMParty #EDMDance #PowerfulDrop #EDMDrop #ElectronicBeat #PulsingBeat #VibrantSynths #SynthMusic #NeonMusic #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395338/3395338_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-01T22:50:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fantoche</video:title>
      <video:description>Comedia com fantoche #Viralllfantoche</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395337/3395337_720p.mp4</video:content_loc>
      <video:duration>406</video:duration>
      <video:publication_date>2026-09-01T22:50:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Otters in the Misty Mountain Valley 🦦🌿 | Beautiful Nature Adventure</video:title>
      <video:description>Experience a peaceful wildlife adventure as adorable wild otters explore a crystal-clear mountain stream surrounded by misty valleys, pine trees, wildflowers, and golden sunrise light. 🦦🏔️🌿 Enjoy this relaxing, ultra-realistic nature scene filled with beautiful wildlife and cinematic natural moments. #otternaturevideo #cuteotters #wildlifeadventure #mountainvalley #mistymountains #riverwildlife #beautifulnature #relaxingnaturevideo #wildanimals #cinematicnature #8Knature #realisticwildlife #foreststream #peacefulscenery #naturedocumentary #animaladventure #relaxingwildlife #mountainscenery</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395336/3395336_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:50:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dance, dancer, dances, dancers, kid dance, kids dance, dance cover, , dai dai dance, dance videos, d</video:title>
      <video:description>dance, dancer, dances, dancers, kid dance, kids dance, dance cover, , dai dai dance, dance videos, dance batt #dance #dancer #dances #dancers #kiddance #kidsdance #dancecover #daidaidance #dancevideos #dancebatt</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395335/3395335_720p.mp4</video:content_loc>
      <video:duration>116</video:duration>
      <video:publication_date>2026-09-01T22:49:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Electric Horizon – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Electric Horizon – SoundMancerMusic Turn up the energy and let the electronic horizon light up the night. “Electric Horizon” is an explosive high-energy EDM track powered by intense synthesizers, deep bass, massive electronic beats and a powerful festival-ready drop. Flashing lights, a jumping crowd and waves of electronic sound create an electrifying atmosphere where the energy keeps building until sunrise. With energetic male vocals and powerful chorus harmonies, “Electric Horizon” captures the freedom and excitement of a massive EDM celebration. 🎵 Track: Electric Horizon 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music / Festival EDM 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #ElectricHorizon #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #IntenseSynths #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395334/3395334_720p.mp4</video:content_loc>
      <video:duration>188</video:duration>
      <video:publication_date>2026-09-01T22:49:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Palavra de Deus 6</video:title>
      <video:description>Palavra abençoada de Deus #Deuspaifilhoespíritosanto</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395333/3395333_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-01T22:49:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dance, dancer, dances, dancers, kid dance, kids dance, dance cover, , dai dai dance, dance videos, d</video:title>
      <video:description>dance, dancer, dances, dancers, kid dance, kids dance, dance cover, dance video, tiktok dance, dance tiktok, dai dai dance, dance videos, dance battle, cardio dance, dance cardio, shakira dance, red bull dance, dance fitness, dance your style, slayyyter dance, thay huy kid dance, red bull dance usa, best dance battle, fat burning dance, best usa dancers, dai dai dance cover, kpop dance workout, shakira dance cover, best tiktok dances, dai dai shakira dance, 1v1dance, dance..., shakira world cup dance, red bull dance your style, red bull usa dance battle #dance #dancer #dances #dancers #kiddance #kidsdance #dancecover #dancevideo #tiktokdance #dancetiktok #daidaidance #dancevideos #dancebattle #cardiodance #dancecardio #shakiradance #redbulldance #dancefitness #danceyourstyle #slayyyterdance #thayhuykiddance #redbulldanceusa #bestdancebattle #fatburningdance #bestusadancers #daidaidancecover #kpopdanceworkout #shakiradancecover #besttiktokdances #daidaishakiradance #1v1dance #shakiraworldcupdance #redbulldanceyourstyle #redbullusadancebattle</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395332/3395332_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-01T22:49:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EDM Twilight – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>EDM Twilight – SoundMancerMusic When twilight falls, the lights explode and the dance floor comes alive. “EDM Twilight” is a high-energy electronic dance track powered by explosive beats, intense synthesizers, deep bass and a massive drop built for the peak of the night. Flashing lights, a surging crowd and powerful rhythms create an electrifying atmosphere where the energy keeps rising until dawn. With energetic male vocals and strong chorus harmonies, “EDM Twilight” captures the excitement of a massive electronic music party. 🎵 Track: EDM Twilight 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music / Festival EDM 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #EDMTwilight #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #IntenseSynths #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395331/3395331_720p.mp4</video:content_loc>
      <video:duration>203</video:duration>
      <video:publication_date>2026-09-01T22:48:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos</video:title>
      <video:description>Meu dia a dia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395329/3395329_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T22:48:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Who is the singer? 🤣🤣🤣</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395328/3395328_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:48:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai</video:title>
      <video:description>linda ela</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395327/3395327_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:48:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Por Una Cabeza - Playback de Chorinho (Brazilian Choro Instrumental)</video:title>
      <video:description>Welcome to another video in our series! This is Por Una Cabeza #282, a beautiful playback of the classic Brazilian &quot;Chorinho&quot; (or Choro) style. &quot;Por Una Cabeza&quot; is a famous Argentine tango composed by Carlos Gardel, but here we present it with a unique Brazilian twist, transforming it into a lively and rhythmic Chorinho. This instrumental version highlights the melody&apos;s charm with the syncopation and counterpoint typical of Brazilian popular music. If you enjoy Brazilian music, instrumental pieces, or are learning to play the Choro style, this video is for you. Use it for practice, inspiration, or just to relax and appreciate the music. Don&apos;t forget to like, share, and subscribe for more videos! #PorUnaCabeza #CarlosGardel #Chorinho #Choro #Brazilianmusic #instrumental #playback #tango #ScentofaWoman #piano #guitar #practicetrack</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395326/3395326_720p.mp4</video:content_loc>
      <video:duration>224</video:duration>
      <video:publication_date>2026-09-01T22:48:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best unforgettable moments 🫡🫡🫡</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395325/3395325_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T22:47:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drop of Light – SoundMancerMusic | Festival EDM</video:title>
      <video:description>Drop of Light – SoundMancerMusic Feel the lights, follow the beat and get ready for the drop. “Drop of Light” is an energetic EDM track built around intense synthesizers, powerful electronic beats, deep rhythms and an explosive festival-ready drop. Neon lights, laser beams and a jumping crowd create an atmosphere of pure euphoria as the music keeps rising through the night. From the first beat to the final moments before sunrise, “Drop of Light” captures the excitement and freedom of a massive electronic music festival. With energetic male vocals and powerful chorus harmonies, this track is made for EDM fans, parties, festivals and high-energy dance floors. 🎵 Track: Drop of Light 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Festival EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #DropofLight #SoundMancerMusic #EDM #EDMMusic #FestivalEDM #ElectronicDanceMusic #ElectronicMusic #DanceMusic #HighEnergyEDM #AmericanEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #FestivalDrop #ElectronicBeat #SynthMusic #LaserShow #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395324/3395324_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T22:47:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toninho tornado tem nova técnica de tatuagem</video:title>
      <video:description>Essa pegadinha é muito engraçada #toninhotornadopegadinhasengracsdas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395323/3395323_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T22:47:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That&apos;s right, man! 🤣😅</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395322/3395322_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Puskas losers in 2015 💀 #football</video:title>
      <video:description>Subscribe! #Football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395321/3395321_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:47:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVORES SERTANEJO DA ROÇA - LINDOS LOUVORES PARA RENOVAR A ALMA</video:title>
      <video:description>**LOUVORES SERTANEJO DA ROÇA - LINDOS LOUVORES PARA RENOVAR A ALMA** Uma seleção especial de louvores sertanejos para fortalecer a fé, trazer paz ao coração e renovar a alma. Canções de esperança e confiança em Deus para ouvir nos momentos de luta, descanso ou reflexão. Que cada louvor abençoe seu dia e aproxime seu coração da presença de Deus. #LOUVORESGOSPEL</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395320/3395320_720p.mp4</video:content_loc>
      <video:duration>1952</video:duration>
      <video:publication_date>2026-09-01T22:47:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395319</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395319/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mature Legs &amp; Feet in High Heels Mules</video:title>
      <video:description>Mature Legs &amp; Feet in High Heels Mules fr</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395319/3395319_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-09-01T22:47:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 05</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #SecretAudit #EunmilhanGamsa #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #workplacedrama #auditor #chaebol #hiddensecret #romanticrelationship #tvNdrama #2026K-drama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395318/3395318_720p.mp4</video:content_loc>
      <video:duration>3674</video:duration>
      <video:publication_date>2026-09-01T22:47:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 04</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #SecretAudit #EunmilhanGamsa #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #workplacedrama #auditor #chaebol #hiddensecret #romanticrelationship #tvNdrama #2026K-drama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395317/3395317_720p.mp4</video:content_loc>
      <video:duration>4046</video:duration>
      <video:publication_date>2026-09-01T22:46:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Panic - Shoobydahbydoobah Porto Alegre é meu lar</video:title>
      <video:description>Panic - Shoobydahbydoobah Porto Alegre é meu lar #Metal #HeavyMetal #BrazilianMetal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395316/3395316_720p.mp4</video:content_loc>
      <video:duration>204</video:duration>
      <video:publication_date>2026-09-01T22:46:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai na rede</video:title>
      <video:description>linda garota de ia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395315/3395315_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T22:46:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dancefloor Rise – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Dancefloor Rise – SoundMancerMusic Turn up the volume, feel the drop and watch the dance floor come alive. “Dancefloor Rise” is an explosive high-energy EDM track powered by intense synthesizers, deep bass, massive electronic beats and a powerful drop made for the dance floor. From flashing lights and jumping crowds to the final moments before sunrise, the track captures the energy of a huge electronic music party where the rhythm keeps building and the night refuses to end. With energetic male vocals, powerful harmonies and a festival-ready sound, “Dancefloor Rise” is made for EDM fans who want pure energy from beginning to end. 🎵 Track: Dancefloor Rise 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #DancefloorRise #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #DanceMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMParty #EDMDance #DanceFloor #PowerfulDrop #EDMDrop #ElectronicBeat #DeepBass #SynthMusic #PartyMusic #FestivalMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395314/3395314_720p.mp4</video:content_loc>
      <video:duration>163</video:duration>
      <video:publication_date>2026-09-01T22:46:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🚌🔥 **VIAGEM DE G8 1800 VOLVO PELAS ESTRADAS DO BRASIL!**</video:title>
      <video:description>🚌🔥 **VIAGEM DE G8 1800 VOLVO PELAS ESTRADAS DO BRASIL!** Hoje vamos pegar a estrada no **Euro Truck Simulator 2** com o **mod de ônibus G8 1800 Volvo**, realizando uma viagem saindo de **Itajá - GO** com destino a **Aparecida do Taboado - MS**. Uma rota pelo interior do Brasil, passando por estradas e paisagens do mapa em uma experiência de ônibus cada vez mais realista. 🇧🇷🚍 📍 **SAÍDA:** Itajá - GO 📍 **DESTINO:** Aparecida do Taboado - MS 🚌 **ÔNIBUS:** G8 1800 Volvo 🎮 **JOGO:** Euro Truck Simulator 2 🗺️ **MAPA:** RBR 🇧🇷 **ROTA:** Goiás → Mato Grosso do Sul Curte **ETS2, ônibus brasileiros, G8, mods de ônibus, mapa RBR e viagens pelas estradas do Brasil?** Então já deixa o 👍 LIKE, inscreva-se no canal e acompanhe as próximas viagens! 💬 **Qual deve ser a próxima rota? Comenta aí!** #ets2 #eurotrucksimulator2 #ets2brasil #ets2ônibus #ets2onibus #g81800volvo #g81800 #g8volvoets2 #g81800ets2 #ônibusg8 #onibusg8 #modônibusets2 #modonibusets2 #modg8ets2 #maparbr #maparbrets2 #ets2maparbr #rbrets2 #ônibusbrasileiroets2 #onibusbrasileiroets2 #viagemdeônibusets2 #viagemdeonibusets2 #itajágo #itajago #aparecidadotaboado #aparecidadotaboadoms #itajáparaaparecidadotaboado #itajaaparecidadotaboado #ets2g8 #ets2bus #busets2 #busãoets2 #busaoets2 #viagemets2 #rotadeônibus #rotadeonibus #estradasdobrasil #ets2realista #gameplayets2</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395313/3395313_720p.mp4</video:content_loc>
      <video:duration>1026</video:duration>
      <video:publication_date>2026-09-01T22:46:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎵 Você já ouviu essa música? Pode se surpreender!</video:title>
      <video:description>🎵 Você já ouviu essa música? Pode se surpreender! #Viagem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395312/3395312_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T22:46:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That&apos;s funny.  🤣🤣🤣</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395311/3395311_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T22:46:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>✅ A Origem dos DEUSES do Olimpo… A História Que Criou as Maiores Lendas! ⚡🏛️</video:title>
      <video:description>Antes dos grandes heróis e das famosas histórias da Grécia Antiga, existiam antigas lendas sobre seres poderosos, guerras e mundos fantásticos. As histórias gregas contavam sobre uma era de gigantes, conflitos e uma batalha que teria mudado para sempre o destino dos seres do Olimpo. Entre Titãs, guerreiros lendários e grandes reinos imaginários, nasceu uma das mitologias mais famosas da humanidade. Este vídeo é uma recriação cinematográfica inspirada nas antigas lendas gregas. 🏛️ Uma história de poder, medo, ambição e conquista. Se você gosta de mitologia, histórias antigas e grandes mistérios do passado, inscreva-se para acompanhar mais vídeos como este. Qual história da mitologia grega você quer ver no próximo vídeo? #MitologiaGregaOlimpoGreciaAntigaZeusTitãsHistoriaAntigaMitologiaLendasAntigasHistoriasDoMundoCuriosidadesShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395309/3395309_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-01T22:45:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro Disquiti, cia de rodeio L.A! Disquiti Bull, L.A. Rodeo Company</video:title>
      <video:description>Touro Disquiti, cia de rodeio L.A! Disquiti Bull, L.A. Rodeo Company</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395308/3395308_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:45:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Charlie Brown Jr - fica comigo</video:title>
      <video:description>Song #Son</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395307/3395307_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:45:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Motorcycle of the Year 😱😱😱🤣</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395306/3395306_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:45:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🙏 Uma Mensagem de Jesus Para o Seu Coração</video:title>
      <video:description>NÃO PASSE POR ESTE VÍDEO SEM OUVIR ESTA MENSAGEM… 🙏❤️ 🙏✨ Neste vídeo, você vai receber uma mensagem especial de Jesus para acalmar o seu coração 🙏 Assista até o final e receba essa mensagem de fé, esperança e amor. #MensagemDeJesus #DeusNoControle #FéEmDeus</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395305/3395305_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-01T22:45:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MAIS UM TOP 4 PAGANDO RÁPIDO VEJA</video:title>
      <video:description>JOGOU GANHOU RÁPIDO #APPSMASTER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395304/3395304_720p.mp4</video:content_loc>
      <video:duration>365</video:duration>
      <video:publication_date>2026-09-01T22:44:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai na academia</video:title>
      <video:description>linda garota na academia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395303/3395303_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:44:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>La fruta 🍇</video:title>
      <video:description>Humo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395302/3395302_720p.mp4</video:content_loc>
      <video:duration>2308</video:duration>
      <video:publication_date>2026-09-01T22:44:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIA QUENTE 🥵</video:title>
      <video:description>É nas horas quente eu fico assim é bem melhor né 😃</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395301/3395301_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-01T22:44:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This is unbelievable 😱 🤡</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395300/3395300_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T22:44:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VELOPLAY PRA JOGAR E GANHAR</video:title>
      <video:description>MAMATA #APPSMASTER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395299/3395299_720p.mp4</video:content_loc>
      <video:duration>290</video:duration>
      <video:publication_date>2026-09-01T22:43:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 6</video:title>
      <video:description>#Tempo #natureza #paz</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395298/3395298_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:43:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Very funny pig race  kkk</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395297/3395297_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:43:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 The Country Woman: Simple Life, Strong Heart ❤️ 3</video:title>
      <video:description>🌻 Welcome to the life of a strong country woman! Here, you’ll discover the beauty of rural life, daily farm routines 🚜, nature 🌱, homemade food 🍞, love ❤️, faith 🙏, and the simple moments that make life special. A real journey from the countryside, straight to your heart! 🌾✨ #CountryWoman🌾 #FarmLife🚜 #RuralLife🌱 #CountryLiving🌻 #SimpleLife🍃 #FarmGirl🤠 #WomanOfFaith🙏 #CountryLove❤️ #NatureLife🌿 #VillageLife🏡 #CountrysideLife🌞 #RuralWoman💛</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395296/3395296_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:43:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CLIQUE E GANHE NA HORA</video:title>
      <video:description>BAIXOU GANHOU #APPSMASTER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395295/3395295_720p.mp4</video:content_loc>
      <video:duration>307</video:duration>
      <video:publication_date>2026-09-01T22:43:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatos memes da Internet</video:title>
      <video:description>Pets engraçado #Gatos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395294/3395294_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:42:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 5</video:title>
      <video:description>#Tempo #natureza #paz</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395293/3395293_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:42:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mosquito is weak. 🫢🤔🤣</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395292/3395292_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T22:42:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 4</video:title>
      <video:description>#Tempo #natureza #paz</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395291/3395291_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:42:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>anime 38</video:title>
      <video:description>anime</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395290/3395290_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T22:42:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animais engraçado 2</video:title>
      <video:description>Animais engraçado dublado #Pets</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395289/3395289_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:42:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JOGUE E GANHE NA HORA</video:title>
      <video:description>UMA MAMATA #APPSMASTER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395288/3395288_720p.mp4</video:content_loc>
      <video:duration>288</video:duration>
      <video:publication_date>2026-09-01T22:42:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 3</video:title>
      <video:description>#Tempo #natureza #paz</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395287/3395287_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:41:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIA DE FAXINA EM CASA 🙈</video:title>
      <video:description>Primeiro vez aqui ❤️ #Faxina</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395286/3395286_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T22:41:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Si tú te va</video:title>
      <video:description>Es cuando perdemos a alguien</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395285/3395285_720p.mp4</video:content_loc>
      <video:duration>267</video:duration>
      <video:publication_date>2026-09-01T22:41:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Spider-Man video  kkk</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395284/3395284_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T22:41:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAT MATCH LANÇOU PAGANDO</video:title>
      <video:description>JOGUE E GANHE #APPSMASTER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395283/3395283_720p.mp4</video:content_loc>
      <video:duration>423</video:duration>
      <video:publication_date>2026-09-01T22:41:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 Rural Woman: A Simple Life, Strong Roots 2</video:title>
      <video:description>Welcome to the beautiful life of a rural woman 🌻🌾. Here, you will find the daily routine of the countryside, hard work, simple moments, love for nature, homemade food, and the strength of a woman who is proud of her roots 🚜💚. Follow along and experience the peaceful and authentic beauty of country life! ✨ #RuralWoman🌾 #CountryLife🚜 #FarmLife🌱 #SimpleLife🍃 #CountryGirl🌻 #WomanOfTheFarm💪 #RuralLifestyle🌞 #LifeOnTheFarm🐓 #NatureLovers🌿 #CountryLiving💚</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395282/3395282_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:41:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 14</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395281/3395281_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:41:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Every Defenders Nightmare 💀 #Football</video:title>
      <video:description>Subscribe!! #Football</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395280/3395280_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T22:41:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Musica 16</video:title>
      <video:description>Música comédia #Musica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395279/3395279_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:40:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 13</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395278/3395278_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:40:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Salam kenal 2</video:title>
      <video:description>Salam kenal semangat #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395276/3395276_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:40:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😱🤣🤣🤣🤣 I laughed so hard, lol.</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395275/3395275_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:40:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toddy</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395274/3395274_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:40:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That&apos;s amazing!  😱 😱 😱</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395273/3395273_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T22:39:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How now Instagram zphisher !</video:title>
      <video:description>Hacker éticas! #Brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395272/3395272_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T22:39:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SICKLEFIN WEASELSHARK (Tubarão-Doninha-de-Nadadeiras-Falciformes) A HISTÓRIA DO PEQUENO PREDADOR</video:title>
      <video:description>SICKLEFIN WEASELSHARK (Tubarão-Doninha-de-Nadadeiras-Falciformes) A HISTÓRIA DO PEQUENO PREDADOR A História do Pequeno Predador que Nunca Para de Caçar Imagine um tubarão tão pequeno que caberia facilmente nos seus braços. Agora imagine que, apesar do tamanho, ele passa praticamente toda a vida caçando. Sem descanso. Sem férias. Sem piedade para suas presas. Enquanto muita gente acredita que apenas os grandes tubarões dominam os oceanos, existe um pequeno predador que prova exatamente o contrário. Hoje você vai conhecer a fascinante história do **Tubarão-Doninha-de-Nadadeiras-Falciformes**, um caçador veloz, discreto e extremamente eficiente, que sobrevive em um mundo onde qualquer erro pode ser o último. Seu corpo flexível funciona quase como uma flecha viva atravessando o oceano. Cada curva aumenta suas chances de sucesso. Cada erro significa gastar energia preciosa. E energia desperdiçada pode significar passar fome. Poucas pessoas conhecem essa espécie justamente porque ela costuma viver longe das áreas frequentadas pelos seres humanos. Grande parte da sua existência acontece praticamente escondida dos nossos olhos. Não existem multidões observando esse animal. Não há mergulhadores registrando sua rotina diariamente. Na verdade, ainda existem muitos aspectos do seu comportamento que continuam sendo estudados pelos cientistas. Isso faz dele um dos tubarões menos conhecidos do planeta. E talvez um dos mais fascinantes. Porque quanto menos sabemos sobre um animal, maior é o mistério ao seu redor. Mesmo sendo um predador eficiente, o Tubarão-Doninha enfrenta desafios modernos que nunca fizeram parte da sua evolução. A pesca excessiva reduz a quantidade de alimento disponível. Redes de pesca capturam inúmeros indivíduos acidentalmente. A poluição alcança até regiões dist</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395271/3395271_720p.mp4</video:content_loc>
      <video:duration>460</video:duration>
      <video:publication_date>2026-09-01T22:39:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As minhas Tralhas e o que uso para filmar! 🎣🐠🐟🎏</video:title>
      <video:description>Amigos pescadores, nesse segundo vídeo, apresento-lhes as minhas tralhas e equipamentos de filmagem! Espero que gostem do vídeo! Link do primeiro vídeo: https://youtu.be/TuGNrlNDsys?sub_confirmation=1 Vara: Speedfish 1651 da Albatroz 1,65m 2-6Lb Molinete: Saint Truly TR 500 135g Max Drag=2,5kg Linha: Monofilamento com Leader Fluorcarbono Câmera: Akaso Brave 7 4K 60fps com Estabilização de Imagem EIS 2.0 #pescarianolagoparanoá #pescaria #pesca #lagoparanoá #tralhas #molinete #vara #tucunaré #tilápia #iscaartificial #ultralight #anzol #garatéia #monofilamento #multifilamento #fluorcarbono</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395270/3395270_720p.mp4</video:content_loc>
      <video:duration>734</video:duration>
      <video:publication_date>2026-09-01T22:39:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 8</video:title>
      <video:description>Conheça os novos Misters e Misses do ParTOBA, inclindo: Mr Para..., Miss Perereca, Mr Ao Infinito e Além e muito mais. #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395269/3395269_720p.mp4</video:content_loc>
      <video:duration>342</video:duration>
      <video:publication_date>2026-09-01T22:39:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ariel Noah 2</video:title>
      <video:description>Lagunya enak didenger #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395268/3395268_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:39:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🍍 Bob Esponja Se Mete em uma Aventura Inacreditável! 😂🌊</video:title>
      <video:description>Bob Esponja acaba entrando em uma aventura completamente inesperada no fundo do mar! 🌊🍍 Prepare-se para muita diversão, confusão e momentos engraçados nessa aventura submarina. 😂 Assista até o final para descobrir como essa história termina! 👀🔥 👍 Curta, compartilhe e siga o canal para mais aventuras! #BobEsponjaSpongeBobBobEsponjaShortsShortsYouTubeShortsDesenhoAnimadoAnimaçãoAventuraComediaHumorFundoDoMarVideosEngraçadosViralFunnySpongeBobSquarePants</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395267/3395267_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:38:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏍️ 5 FUGAS INSANAS de MOTO em PERSEGUIÇÕES POLICIAIS que DERAM ERRADO!</video:title>
      <video:description>Perseguições de moto, fugas da polícia e momentos insanos capturados por câmeras de motociclistas! #PerseguiçãoDeMotoFugaDeMotoMotoVsPoliciaMotovlogBrasilMotoBrasilPerseguiçãoPolicialPoliceChaseMotorcycleChasePolicePursuit</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395266/3395266_720p.mp4</video:content_loc>
      <video:duration>2251</video:duration>
      <video:publication_date>2026-09-01T22:38:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TREASURE IN THE DESERT</video:title>
      <video:description>🎶 Uma canção linda e inspiradora, feita para tocar o coração e nos levar a refletir sobre a vida. Mesmo quando atravessamos os desertos e enfrentamos dias difíceis, a esperança permanece viva: depois da luta, Deus prepara a vitória. 🙏❤️ #bangbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395265/3395265_720p.mp4</video:content_loc>
      <video:duration>328</video:duration>
      <video:publication_date>2026-09-01T22:38:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 in a Billion Football Moments</video:title>
      <video:description>1 in a Billion Moments in Football. #soccer #goals #football #footballgoals #footballskills #footballmoments #footballvideos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395264/3395264_720p.mp4</video:content_loc>
      <video:duration>744</video:duration>
      <video:publication_date>2026-09-01T22:38:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ELA NEM SABIA QUEM ELE ERA... MAS ELE ESPEROU 10 ANOS POR ELA</video:title>
      <video:description>Ela corria na chuva de Seul com o guarda-chuva quebrado, quando escorregou... e caiu nos braços dele. Um olhar que mudou tudo. Ele esperou 10 anos por esse reencontro, mas ela não se lembra dele. E quando a verdade ia finalmente ser revelada, um carro preto de luxo para atrás deles. O que essa mulher misteriosa esconde? Por que ela não quer que ele conte a verdade? Parte 2 amanhã se esse vídeo bater 1k views! Comenta &quot;PARTE 2&quot; #dorama #kdrama #doramaviral #historiadeamor --- Este vídeo é uma obra #Dorama #kdrama #doramacurto</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395263/3395263_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:38:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DOUGLAS REACTS_🔴 As Profissões mais Nojentas e Estranhas do Mundo e Quanto elas Ganham!</video:title>
      <video:description>DOUGLAS REACTS_🔴 As Profissões mais Nojentas e Estranhas do Mundo e Quanto elas Ganham!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395262/3395262_720p.mp4</video:content_loc>
      <video:duration>885</video:duration>
      <video:publication_date>2026-09-01T22:38:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best puppy ever Vi😱</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395261/3395261_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:37:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing imut 5</video:title>
      <video:description>Kucing imut lucu lagi main #Hiburan #cat</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395260/3395260_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:37:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Construção 2</video:title>
      <video:description>Meus trabalhos #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395259/3395259_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-01T22:37:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING CARBONARA</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395258/3395258_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:36:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute, funny kittens</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395257/3395257_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:36:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing lucu 79</video:title>
      <video:description>Anak kucing lucu seneng lihatnya #Hiburan #shoppingcat</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395256/3395256_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:36:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brasílian Stock Market Chart</video:title>
      <video:description>Come discover Brazil #Eua</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395255/3395255_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:36:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JESUS ESTÁ NO BARCO-GIULIA DIULIA</video:title>
      <video:description>linda musica gospel, um lindo louvor #musica #gospelmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395254/3395254_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-01T22:36:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piano Relaxing Hymns Gospel</video:title>
      <video:description>Piano Relaxing Hymns Gospel - Hinos Harpa Cristã + Sons da Natureza - Para Dormir e Orar #PianoRelaxingHymnsGospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395253/3395253_720p.mp4</video:content_loc>
      <video:duration>2790</video:duration>
      <video:publication_date>2026-09-01T22:36:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crazy cow lol</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395252/3395252_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T22:36:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek cantik 16</video:title>
      <video:description>Cewek cantik mempesona #Hiburanshopping</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395251/3395251_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T22:35:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING CHEESEBURGUER</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395250/3395250_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:35:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The first siuuu #cristianoronaldo #cr7</video:title>
      <video:description>Subscribe!! #Cr7</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395249/3395249_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T22:35:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>confianceensoi</video:title>
      <video:description>Derrière chaque silence se cache parfois une histoire. Derrière chaque regret, une leçon. Le passé ne peut plus être changé, mais il peut nous apprendre à devenir plus forts. Accepte ce qui a été, apprends de tes erreurs et avance sans regarder en arrière. 🧠 La sagesse commence lorsque tu acceptes ce que tu ne peux pas changer. #stoïcismedisciplinemotivationhabitudeconfiancedevelopementparsonelavence</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395248/3395248_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-01T22:35:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vermelhou</video:title>
      <video:description>Suéter vermelho está voltando #vermelho #blusafeminina #red #roupavermelha</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395247/3395247_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:35:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING CHEESECAKE</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395246/3395246_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:35:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Construção civil 3</video:title>
      <video:description>Este vídeo é um pouco do meu trabalho que faço diariamente #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395245/3395245_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-01T22:35:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Little donkey laughing 🤣🤣🤣</video:title>
      <video:description>Little donkey laughing 🤣🤣🤣 #Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395244/3395244_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:35:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu já num tô guentado mais kkk</video:title>
      <video:description>#Brazil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395243/3395243_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T22:35:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sergio Busquet</video:title>
      <video:description>Momen ketika Sergio Busquets membuat lini tengah atau pemain Real Madrid kewalahan sering kali terjadi berkat gaya mainnya yang tenang, minim ekspresi, namun sangat mematikan. Busquets dikenal sebagai master dalam hal ketenangan (composure) di atas lapangan. Busquets sering kali hanya menggerakkan bahu atau menoleh ke satu arah untuk mengecoh pemain Real Madrid, lalu mengalirkan bola ke arah sebaliknya tanpa menyentuhnya secara berlebihan. Meski dikepung oleh dua hingga tiga pemain gelandang Madrid yang agresif, ia selalu menemukan celah sempit untuk meloloskan bola dengan satu sentuhan tenang. Ia mengontrol jalannya pertandingan dengan sangat dingin, membuat lawan frustrasi karena bola seolah sangat sulit direbut dari kakinya. © Semua gambar adalah milik pemiliknya masing-masing‼️ 🚫NO COPYRIGHT🚫 LiveStreaming ? 📍Link cek di bio #football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395242/3395242_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:35:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cão 🐕‍🦺 cabra doido</video:title>
      <video:description>Pensa num filme 🎥 maço #Humor</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395241/3395241_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:35:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395239</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395239/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUEM JA VIU ISSO?</video:title>
      <video:description>Quem.ja viu tubarão de água doce? #CURIOSIDADEQUEMNUNCAVIUCIÊNCIASESTUDOQUEMSABIA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395239/3395239_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T22:34:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING CHICKEN CURRY</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395238/3395238_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:34:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gtscjii</video:title>
      <video:description>obgyrxe45bi89 #jy74dswy99mjgu74b0</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395236/3395236_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T22:33:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING COD FISH</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395235/3395235_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:33:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BAP NÃO TIRA O VASCO DA CABEÇA! “Estou achando que ele é vascaíno” 😂🔥</video:title>
      <video:description>O Vasco voltou a ser assunto — e, mais uma vez, o presidente do Flamengo, BAP, entrou no debate. A sequência de declarações e críticas envolvendo o Vasco já está chamando atenção até de quem acompanha o futebol de fora. Será apenas preocupação com o cenário do futebol brasileiro ou o crescimento do Vasco realmente está incomodando? Assista até o final e tire sua própria conclusão. 👀💢 E você: por que acha que o BAP fala tanto do Vasco? Comenta aí! #Vasco #VascodaGama #BAP #BAPFlamengo #presidentedoFlamengo #Flamengo #VascoxFlamengo #rivalidadeVascoFlamengo #BAPVasco #BAPfaladoVasco #BAPcriticaVasco #SAFdoVasco #vendadaSAFdoVasco #VascoSAF #notíciasdoVasco #últimasnotíciasVasco #notíciasVascohoje #futebolbrasileiro #futebolcarioca #GigantedaColina #Cruzmaltino #Almirante #Vascoforte #FlamengotemeVasco #polêmicaVascoFlamengo #RicaPerroneVasco #debateesportivo #mercadodabolaVasco #políticanofutebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395234/3395234_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-01T22:33:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING DUMPLINGS</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395233/3395233_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:33:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stand strong against life&apos;s heaviest currents, knowing your core is unbreakable</video:title>
      <video:description>Let the breathtaking beauty of nature inspire your daily routine. Finding moments of peace and grounding yourself amidst life&apos;s daily rush brings true balance to your mind and body #natureinspiration #dailywellness #innerbalance #mindfulnessjourney</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395232/3395232_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T22:32:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A mulher sábia</video:title>
      <video:description>Canção sobre como edificar seu lar #Música #louvor #gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395231/3395231_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-01T22:32:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME FRIED CHICKEN</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395230/3395230_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:31:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 TÍTULO: O CAÇA PASSOU RASGANDO O CÉU… E VOCÊ NÃO VAI ACREDITAR NO QUE ACONTECEU! ✈️💨</video:title>
      <video:description>Quando um caça acelera, não existe como ignorar! 😱✈️ Velocidade, potência e precisão em poucos segundos. Você teria coragem de estar dentro dessa máquina? 🔥 #CacaAereo #CacaDeGuerra #Aviacao #ForcaAerea #Aviao</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395229/3395229_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T22:31:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Agora ele não escapa</video:title>
      <video:description>Apenas uma piada #Humor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395228/3395228_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:31:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUANTO TEMPO VI EM OS PEIXES?</video:title>
      <video:description>Quanto tempo vivem os peixes? #Ciênciascuriosidadesaguamarvocesabia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395227/3395227_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T22:31:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME SALMON AND SUSHI</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395226/3395226_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:31:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imagine!!!</video:title>
      <video:description>Imaginar viver de uma forma que você sinta Deus em tudo!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395225/3395225_720p.mp4</video:content_loc>
      <video:duration>133</video:duration>
      <video:publication_date>2026-09-01T22:31:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alegria 2</video:title>
      <video:description>R Alegria alegria #Desidério</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395224/3395224_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:31:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rooster and smart aleck lol</video:title>
      <video:description>Rooster and smart aleck lol #memes #meme #viral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395223/3395223_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:31:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SapoIA Prate 02</video:title>
      <video:description>Cultura musical 🎸🎷</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395222/3395222_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T22:30:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395221</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395221/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brazil prime #shorts #edit #brazil</video:title>
      <video:description>Ronaldinho of Brazil stars and Brazil! #brazil #edit #shorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395221/3395221_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:30:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hinchas de San Lorenzo con Paraguay en el Mundial 2026</video:title>
      <video:description>Hinchas de San Lorenzo con Paraguay en el Mundial 2026 #SanLorenzo #Paraguay #Copa2026</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395220/3395220_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T22:30:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Por Que Ele Foi Condenado à Morte por Traduzir a Bíblia?</video:title>
      <video:description>Uma história real que poucas pessoas conhecem, mas que mudou completamente o acesso à fé no mundo. ✨ Um homem enfrentou o sistema ✨ Desafiou autoridades religiosas ✨ E pagou com a própria vida 📖 Esta é a história de William Tyndale, o homem que foi executado por traduzir a Bíblia e mudou a história da Bíblia para sempre. William Tyndale traduziu a Bíblia para o inglês em uma época em que a tradução da Bíblia era proibida. A Bíblia não podia ser lida pelo povo, e a tradução da Bíblia era considerada crime. Mesmo assim, William Tyndale decidiu traduzir a Bíblia para o inglês. A história de William Tyndale mostra como a tradução da Bíblia mudou o cristianismo. A Bíblia em inglês permitiu que pessoas comuns tivessem acesso à Palavra de Deus. William Tyndale enfrentou perseguição por traduzir a Bíblia. A tradução da Bíblia feita por William Tyndale influenciou todas as futuras traduções da Bíblia. Se você gosta de Bíblia, história bíblica, estudo bíblico e tradução da Bíblia, este vídeo é para você. 00:00 - A Barreira Linguística da Bíblia 01:00 - Quem foi William Tyndale? 01:52 - A Missão de Tornar a Palavra Acessível 02:50 - O Desafio de Traduzir para o Inglês 03:35 - O Trabalho Clandestino de Tyndale 04:21 - Oposição e Exílio na Europa 04:59 - A Revolução da Imprensa e Cópias Proibidas 05:37 - O Impacto das Escrituras no Povo 06:18 - Traição e Prisão 07:08 - Julgamento e Condenação 07:43 - A Oração Final de um Mártir 07:59 - O Legado e a Liberdade das Escrituras William Tyndale tradução da Bíblia, William Tyndale Bíblia, traduzir a Bíblia, Bíblia em inglês, história bíblica, estudo bíblico, Palavra de Deus, cristianismo, fé, Bíblia explicada, história cristã, tradução da Bíblia proibida, Bíblia para o povo #williamtyndale #biblia #traduçãodabiblia #historiabiblica #histor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395219/3395219_720p.mp4</video:content_loc>
      <video:duration>591</video:duration>
      <video:publication_date>2026-09-01T22:30:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piadas 6</video:title>
      <video:description>Piadas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395218/3395218_720p.mp4</video:content_loc>
      <video:duration>612</video:duration>
      <video:publication_date>2026-09-01T22:30:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hora do lanches</video:title>
      <video:description>Deu aquela fome . #Brasileiros</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395217/3395217_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:29:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395216</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395216/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>India Howrah to Hyderabad city journey travelling Amrit Bharat ke</video:title>
      <video:description>India Howrah Kolkata Vijay valobashar Odisha Andhra Pradesh Vijayawada Secunderabad Hyderabad city South India #IndiaHowrahKolkatatovijaywadaBhuvneshwarSecunderabadHyderabad</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395216/3395216_720p.mp4</video:content_loc>
      <video:duration>365</video:duration>
      <video:publication_date>2026-09-01T22:29:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Starstruck Beat – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Starstruck Beat – SoundMancerMusic Feel the beat, follow the lights and get ready for an explosive night on the dance floor. “Starstruck Beat” is a high-energy disco track powered by vibrant synthesizers, energetic strings, hard-hitting rhythms and the electrifying atmosphere of a classic disco party. Glitter rains, lights flash and the energy keeps rising as music, dancing and passion take over the night. With powerful vocal harmonies and classic American disco inspiration, “Starstruck Beat” is made to keep the dance floor moving. 🎵 Track: Starstruck Beat 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #StarstruckBeat #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #GlitterDisco #PartyMusic #NightlifeMusic #EnergeticDisco #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395215/3395215_720p.mp4</video:content_loc>
      <video:duration>254</video:duration>
      <video:publication_date>2026-09-01T22:29:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING STEAK AND FRIES</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395214/3395214_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:29:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funniest video on the Net!</video:title>
      <video:description>Funniest video on the Net! ⁸ #FunniestvideoontheNet</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395213/3395213_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:29:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to get a professional Bitcoin recovery expert: Hire Sudenifox Recovery</video:title>
      <video:description>I Lost $47,500 in a Crypto Scam — Sudenifox Recovery Helped Me Recover It” I thought I had lost everything after falling victim to a cryptocurrency investment scam. In less than a week, I lost $47,500 worth of Ethereum after trusting someone who claimed to be an experienced crypto trader. The scammer convinced me that my investment would generate significant returns. When I tried to withdraw my funds, I was told I needed to pay additional fees to release them. That&apos;s when I realized something was seriously wrong. By the time I understood it was all a lie, the scammer had disappeared with my life savings. I felt devastated and ashamed, and didn’t tell anyone for weeks. When i finally told a friend, he urged me to contact ( Sudenifox Recovery ) a firm that handles crypto fraud. I reached out and they answered right away. The team asked me to provided my transaction records, wallet addresses, screenshots, and conversations with the scammer. Their team traced my stolen Ethereum through multiple wallets, investigated the transactions, traced the movement of the cryptocurrency, and guided me through the recovery process. Ultimately, the full $47,500 I had lost was recovered and returned to me. I honestly didn&apos;t believe I would ever see my money again. Having the funds restored was an enormous relief. If you&apos;ve lost cryptocurrency to a scam, don&apos;t assume your money is automatically gone forever. Contact ( Sudenifox Recovery ) and have your case assessed as soon as possible. THIS IS THE COMPANY INFO BELOW 1) Website: sudenifox.online 2) WhatsApp: +14796222173 3) Eemail: support@sudenifox.online</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395212/3395212_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T22:29:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POR QJE ESTA CASA NÃO DESMORONOU NO NEPAL?</video:title>
      <video:description>A CIÊNCIA EXPLICA ISSO. #tragédias #vocesabia #coenaciacuriosidadeseuquerosaber</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395211/3395211_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-01T22:29:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>História das rosas</video:title>
      <video:description>História de duas rosas que nasceram diferentes #novelinha</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395210/3395210_720p.mp4</video:content_loc>
      <video:duration>378</video:duration>
      <video:publication_date>2026-09-01T22:29:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Linda 7</video:title>
      <video:description>Brus nordeste</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395209/3395209_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:29:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic Video 118</video:title>
      <video:description>Beautiful</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395208/3395208_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T22:28:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geo Best Drama 14</video:title>
      <video:description>Super Hit Drama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395207/3395207_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-01T22:28:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rhythm Spotlight – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Rhythm Spotlight – SoundMancerMusic Step into the spotlight and let the rhythm take control. “Rhythm Spotlight” is an explosive high-energy disco track packed with powerful beats, vibrant synthesizers, energetic strings and the electrifying atmosphere of a dance floor on fire. Glitter storms, flashing lights and an irresistible groove bring the party to life as passion and music collide. With a powerful chorus and classic American disco inspiration, this track is made for dancing with energy from beginning to end. 🎵 Track: Rhythm Spotlight 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #RhythmSpotlight #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #GlitterDisco #PartyMusic #NightlifeMusic #EnergeticDisco #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395206/3395206_720p.mp4</video:content_loc>
      <video:duration>212</video:duration>
      <video:publication_date>2026-09-01T22:28:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>**Esther Part II | 3D Bible Story – Stories of the Eternal Kingdom**</video:title>
      <video:description>**Esther Part II | 3D Bible Story – Stories of the Eternal Kingdom** Continue the powerful and inspiring story of Esther, a young woman whose courage, faith, and wisdom changed the destiny of her people. 👑📖✨ In this second part, Esther faces a dangerous situation that could cost her everything. With courage in her heart, she approaches the king and reveals the truth behind a terrible plan. As the story unfolds, justice begins to prevail, enemies are exposed, and God’s providence becomes clear. Experience this unforgettable biblical story in stunning 3D animation and discover powerful lessons about courage, faith, obedience, wisdom, and trusting God even when the situation seems impossible. Subscribe to **Stories of the Eternal Kingdom** for more 3D Bible stories, biblical characters, miracles, and inspiring stories of faith. 🙏 May the story of Esther remind you that God can use one courageous person to make a difference in the lives of many.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395205/3395205_720p.mp4</video:content_loc>
      <video:duration>714</video:duration>
      <video:publication_date>2026-09-01T22:28:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lovely Couple 52</video:title>
      <video:description>Tiktoker Girl</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395204/3395204_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T22:27:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Game About Chopping Trees: FIQUEI RICO CORTANDO ÁRVORES! Gameplay PT-BR</video:title>
      <video:description>Veja como completar a progressão em um jogo de simulação afundando navios. Aprenda a liberar ferramentas essenciais para sua coleta. Neste vídeo, foco na estratégia de jogo para quem busca otimizar a coleta de toras. A jogabilidade gira em torno de realizar tarefas específicas, como afundar um navio, para conseguir equipamentos melhores. Mostro exatamente o momento de liberar a motosserra e o carrinho, itens fundamentais para carregar mais recursos e acelerar o desenvolvimento da sua base. Se você gosta de acompanhar a evolução dentro de um simulador, este conteúdo vai direto ao ponto. Entenda como o uso eficiente do carrinho e da motosserra muda a dinâmica de trabalho no jogo, permitindo que você transporte grandes quantidades de toras com facilidade. É a progressão ideal para quem quer subir de nível rápido e melhorar seus equipamentos. Inscreva-se para mais dicas semanais de jogos de simulação e comente abaixo qual o próximo item que você quer ver em ação. 🟢Ganhe desconto no VIDIQ: https://vidiq.com/cupomdedesconto 🟢Acesse nosso bunker: https://sobrevivshop-wywubh5s.manus.s... 🟢Acelere seus jogos com NoPing: https://nopi.ng/sobrevivenciaapocalip... 🟢Pix: andercb@hotmail.com 👉Acesse aqui: https://linktr.ee/livesdoander ►Project Zomboid Build 42 Instável PT BR Playlist: • Project Zomboid Build 42 Instável PT BR ►The Spotter: Dig Or Die: • The Spotter: Dig Or Die ►7 Days to Die Geral: • 7 Days to Die Geral ►Jogos Indie de Terror: • Jogos Indie de Terror ►FALLOUT 4: • FALLOUT 4 ►Manor Lords: • Manor Lords 00:00 - Introdução e os primeiros desbloqueios 01:15 - Conhecendo a cabana e vendendo toras 02:35 - Começando o trabalho de lenhador 03:52 - Restaurando o vigor e melhorando o machado 05:54 - O caminho para a motosserra 08:16 - Explorando o cenário e novas bétolas 11:28</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395203/3395203_720p.mp4</video:content_loc>
      <video:duration>4116</video:duration>
      <video:publication_date>2026-09-01T22:27:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>90s Super Hit Song 8</video:title>
      <video:description>Best Movie Song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395202/3395202_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T22:27:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night Fever Groove – SoundMancerMusic | Disco Dance Music</video:title>
      <video:description>Night Fever Groove – SoundMancerMusic Feel the fever, follow the groove and dance until the morning light. “Night Fever Groove” is an energetic disco track filled with bright synthesizers, vibrant strings, infectious rhythms and the unforgettable atmosphere of a glowing dance floor. From glitter and neon lights to the final moments before sunrise, the song celebrates dancing, passion, romance and the timeless magic of disco. With a catchy chorus and classic American disco inspiration, “Night Fever Groove” brings the spirit of the dance floor to life. 🎵 Track: Night Fever Groove 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Dance / Retro Disco 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #NightFeverGroove #SoundMancerMusic #Disco #DiscoMusic #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #NightFever #DiscoParty #DanceFloor #NeonDisco #PartyMusic #NightlifeMusic #FunkyDisco #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395201/3395201_720p.mp4</video:content_loc>
      <video:duration>195</video:duration>
      <video:publication_date>2026-09-01T22:27:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lovely Couple 51</video:title>
      <video:description>Beautiful Place</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395200/3395200_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:26:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exibindo</video:title>
      <video:description>Homem passa vexame kkk #Praia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395199/3395199_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:26:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 112</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395198/3395198_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:26:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES: DOCUMENTÁRIO A CADEIA ALIMENTAR MAIS BRUTAL DA TERRA ESTÁ NO FUNDO DO OCEANO</video:title>
      <video:description>REINO DOS TUBARÕES: DOCUMENTÁRIO A CADEIA ALIMENTAR MAIS BRUTAL DA TERRA ESTÁ NO FUNDO DO OCEANO #documentário #reinodostubarões #cadeiaalimentar No lugar mais escuro, frio e isolado do planeta, existe um mundo onde sobreviver é uma luta constante. A milhares de metros abaixo da superfície, onde a luz do Sol jamais alcança, a cadeia alimentar funciona de uma forma brutal e impiedosa. Cada pedaço de alimento que cai das águas superiores pode significar a diferença entre a vida e a morte. Nas profundezas do oceano, não existem campos verdes, nem luz, nem abundância. Existem apenas criaturas adaptadas a uma realidade extrema, onde caçar, atacar e sobreviver se tornou uma verdadeira batalha. Aqui, até mesmo um cadáver pode provocar uma disputa feroz entre monstros das profundezas. E quanto mais fundo descemos, mais estranhas e assustadoras se tornam as criaturas que dominam esse universo oculto. Tubarões, peixes de dentes gigantes, crustáceos, vermes e predadores capazes de sobreviver onde nenhum ser humano conseguiria respirar. Mas afinal, como funciona a cadeia alimentar mais brutal da Terra? Quem são os verdadeiros predadores do fundo do oceano? E por que esse mundo escondido nas profundezas pode ser ainda mais perigoso do que imaginamos? Hoje, vamos mergulhar em uma viagem assustadora rumo ao abismo, para descobrir **a cadeia alimentar mais brutal da Terra, escondida no fundo do oceano.** #Tubarão-branco #Tubarão-martelo #Tubarão-baleia #Tubarão-tigre #Tubarão-frade #Tubarão-duende #Tubarão-de-pontas-negras #Tubarão-cobra #Tubarão-anão #Tubarão-serra #Tubarão-lanterna #Megalodon #Tubarão-lixa #Tubarão-martelo-recortado #Tubarão-cabeça-chata #Tubarão-anjo #Tubarão-raposa #Tubarão-martelo-grande #Tubarão-gato #Tubarão-da-Groenlândia #cadeiaalimentardooceano #fundodooceano</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395197/3395197_720p.mp4</video:content_loc>
      <video:duration>2184</video:duration>
      <video:publication_date>2026-09-01T22:26:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeo engraçado 234</video:title>
      <video:description>Vídeos engraçados #Vacina</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395196/3395196_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T22:26:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love in the Lights – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Love in the Lights – SoundMancerMusic When the lights come alive, love and rhythm take over the dance floor. “Love in the Lights” is an explosive high-energy disco track filled with powerful beats, vibrant synthesizers, energetic strings and the electrifying atmosphere of a packed dance floor. Glitter rains, lights flash and the rhythm keeps rising as two hearts surrender to the music. With a powerful chorus and classic American disco inspiration, this track celebrates passion, dancing and the unforgettable energy of nightlife. 🎵 Track: Love in the Lights 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #LoveintheLights #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #GlitterDisco #PartyMusic #NightlifeMusic #LoveDisco #MaleDiscoVocal #EnergeticDisco #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395195/3395195_720p.mp4</video:content_loc>
      <video:duration>242</video:duration>
      <video:publication_date>2026-09-01T22:26:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dolls from Portugal,bonecas portuguesas dos anos 70🕺.</video:title>
      <video:description>Olá,no meu canal irei mostrar a minha colecção de bonecas e outras bonecas que existem no mundo, bonecas antigas,bonecas novas que trazem muita alegria a crianças e adultos. Também vídeos de minerais ,pedras, cristais e rochas,espero que gostem. Bem vindos e gratidão por assistir.😊 #Bonecas #brinquedos #dolls #Barbie #toys #pedrascristais #minerais #rochas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395194/3395194_720p.mp4</video:content_loc>
      <video:duration>302</video:duration>
      <video:publication_date>2026-09-01T22:25:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sergio busquet</video:title>
      <video:description>Momen ketika Sergio Busquets membuat lini tengah atau pemain Real Madrid kewalahan sering kali terjadi berkat gaya mainnya yang tenang, minim ekspresi, namun sangat mematikan. Busquets dikenal sebagai master dalam hal ketenangan (composure) di atas lapangan. Busquets sering kali hanya menggerakkan bahu atau menoleh ke satu arah untuk mengecoh pemain Real Madrid, lalu mengalirkan bola ke arah sebaliknya tanpa menyentuhnya secara berlebihan. Meski dikepung oleh dua hingga tiga pemain gelandang Madrid yang agresif, ia selalu menemukan celah sempit untuk meloloskan bola dengan satu sentuhan tenang. Ia mengontrol jalannya pertandingan dengan sangat dingin, membuat lawan frustrasi karena bola seolah sangat sulit direbut dari kakinya. © Semua gambar adalah milik pemiliknya masing-masing‼️ 🚫NO COPYRIGHT🚫 LiveStreaming ? 📍Link cek di bio #football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395193/3395193_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:25:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VOCÊ JA OUVIU FALAR DESSE LUGAR NO MUNDO?</video:title>
      <video:description>SERÁ QUE O OCEANO TEM LIMITE ? #CuriosidadeoqueeissoVocêsabiaMundogeografiaestudo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395192/3395192_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T22:25:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Há Jesus - Julliany Souza</video:title>
      <video:description>Deixe Deus falar com você 🙏</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395191/3395191_720p.mp4</video:content_loc>
      <video:duration>748</video:duration>
      <video:publication_date>2026-09-01T22:25:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Injustiça</video:title>
      <video:description>Sobre a realidade que ninguém vê ou faz que não se importa #Prado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395190/3395190_720p.mp4</video:content_loc>
      <video:duration>353</video:duration>
      <video:publication_date>2026-09-01T22:25:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Glitter Dance Floor – SoundMancerMusic | Disco Dance Music</video:title>
      <video:description>Glitter Dance Floor – SoundMancerMusic Step onto the glittering dance floor and let the rhythm take control. “Glitter Dance Floor” is an energetic disco track filled with bright synthesizers, vibrant strings, funky grooves and the irresistible atmosphere of a classic night on the dance floor. Under the glow of the mirror ball, the music brings together dancing, romance and celebration as the party keeps moving until sunrise. With a catchy chorus and timeless American disco energy, this track is made for everyone who loves glitter, groove and unforgettable nights. 🎵 Track: Glitter Dance Floor 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Dance / Retro Disco 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #GlitterDanceFloor #SoundMancerMusic #Disco #DiscoMusic #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #FunkyDisco #DiscoGroove #DiscoParty #DanceFloor #MirrorBall #GlitterDisco #PartyMusic #NightlifeMusic #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395189/3395189_720p.mp4</video:content_loc>
      <video:duration>193</video:duration>
      <video:publication_date>2026-09-01T22:25:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Galera vídeo da cachoeira</video:title>
      <video:description>Olha linda cachoeira galera curte e comenta.e segue #Cachoeira</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395188/3395188_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T22:24:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 The Country Woman: Simple Life, Strong Heart ❤️ 2</video:title>
      <video:description>🌻 Welcome to the life of a strong country woman! Here, you’ll discover the beauty of rural life, daily farm routines 🚜, nature 🌱, homemade food 🍞, love ❤️, faith 🙏, and the simple moments that make life special. A real journey from the countryside, straight to your heart! 🌾✨ #CountryWoman🌾 #FarmLife🚜 #RuralLife🌱 #CountryLiving🌻 #SimpleLife🍃 #FarmGirl🤠 #WomanOfFaith🙏 #CountryLove❤️ #NatureLife🌿 #VillageLife🏡 #CountrysideLife🌞 #RuralWoman💛</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395187/3395187_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:24:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395186</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395186/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TOP4 PAGANDO RAPIDO VEJA !</video:title>
      <video:description>ESSA E A MAMATA #APPSMASTER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395186/3395186_720p.mp4</video:content_loc>
      <video:duration>382</video:duration>
      <video:publication_date>2026-09-01T22:23:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Give thanks for another Day</video:title>
      <video:description>Give thanks because, while others are saying goodbye to this world, you are opening your eyes. #Motivation</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395185/3395185_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T22:23:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395184</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395184/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tatuzinho nadando no calor</video:title>
      <video:description>Tatu #Desidério</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395184/3395184_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T22:23:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Twilight – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Disco Twilight – SoundMancerMusic When twilight falls, the lights come alive and the dance floor explodes with energy. “Disco Twilight” is a powerful high-energy disco track driven by explosive beats, vibrant synthesizers, energetic strings and an electrifying party atmosphere. Glitter, flashing lights and an irresistible rhythm create a celebration of dancing, passion and nightlife, bringing the excitement of classic American disco into a vibrant modern experience. 🎵 Track: Disco Twilight 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #DiscoTwilight #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #PartyMusic #NightlifeMusic #EnergeticDisco #MaleDiscoVocal #DiscoNight #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395183/3395183_720p.mp4</video:content_loc>
      <video:duration>397</video:duration>
      <video:publication_date>2026-09-01T22:23:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ensaio regional CCB</video:title>
      <video:description>É um ensaio regional de acordeons muito lindo.Hino que fala com a alma</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395182/3395182_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-01T22:23:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TOP 4 APLICATIVOS PAGANDO NA HORA VEJA !</video:title>
      <video:description>JOGOU GANHOU BAIXOU SAQUE RÁPIDO #APPSMASTER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395180/3395180_720p.mp4</video:content_loc>
      <video:duration>367</video:duration>
      <video:publication_date>2026-09-01T22:22:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Setelah meninggalkan panggung Eropa yang membesarkan namanya</video:title>
      <video:description>petualangannya di Arab Saudi dikabarkan akan segera berakhir dalam hitungan hari.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395179/3395179_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:22:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jose Mourinho sedang memainkan strategi jangka panjang</video:title>
      <video:description>Jose Mourinho sedang memainkan strategi jangka panjang yang brilian untuk melindungi aset berharga Real Madrid dari kehancuran mental.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395178/3395178_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:22:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395177</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395177/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Karier bek muda Real Madrid</video:title>
      <video:description>Joan Martinez, sempat diprediksi berakhir lebih awal setelah mengalami cedera ACL namun pemain muda ini membuktikan bahwa mentalitas dan tekadnya jauh lebih kuat dari sekadar ekspektasi publik.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395177/3395177_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:22:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395176</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395176/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Agnès Sorel — A Dama de Beleza: a poderosa favorita do rei Carlos VII, morta em 1450&quot;</video:title>
      <video:description>Quem foi Agnès Sorel, conhecida como A Dama de Beleza? Neste vídeo, você vai conhecer a história da mulher que conquistou o coração do rei Carlos VII da França e mudou para sempre a corte francesa no século XV. Descubra como Agnès Sorel se tornou a primeira favorita oficial de um rei da França, influenciou a política, a moda e o poder durante a Guerra dos Cem Anos, além dos mistérios que cercam sua morte em 1450. Teria sido uma morte natural... ou um envenenamento? Se você gosta de histórias reais, mistérios da Idade Média, reis, rainhas e curiosidades históricas, este vídeo é para você! 👍 Deixe seu like, inscreva-se no canal Curiosidades Históricas com IA e ative o sino para não perder novos vídeos sobre os maiores mistérios da história. Hashtags #AgnèsSorel #AgnesSorel #ADamadeBeleza #CarlosVII #ReiCarlosVII #favoritadorei #históriadaFrança #Françamedieval #IdadeMédia #realezafrancesa #mulherespoderosasdahistória #GuerradosCemAnos #mistériodamortedeAgnèsSorel #envenenamentonacortefrancesa #curiosidadeshistóricas #históriamedieval #documentáriohistórico #rainhasefavoritas #históriaeuropeia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395176/3395176_720p.mp4</video:content_loc>
      <video:duration>500</video:duration>
      <video:publication_date>2026-09-01T22:22:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAHRA — نار الروح | Fire of the Soul | Arabic Organic Deep House</video:title>
      <video:description>SAHRA — نار الروح | Fire of the Soul 🔥 A passion that keeps burning long after someone is gone. SAHRA is an original Arabic Organic Deep House journey through a moonlit desert night — where memories remain, the fire stays alive, and the heart refuses to forget. Deep organic grooves, warm percussion, atmospheric oud, haunting melodies and an emotional male Arabic vocal create a cinematic journey between love, longing and the endless desert. 🎧 Best experienced with headphones. If this song takes you somewhere, tell me where in the comments. ━━━━━━━━━━━━━━━━━━━━ 🔥 TRACK SAHRA — نار الروح Fire of the Soul 🎵 Genre: Arabic Organic Deep House Oriental Deep House Ethnic Deep House Desert House ━━━━━━━━━━━━━━━━━━━━ 🎧 GROOVE LIMITS Original electronic music inspired by cultures, languages and cinematic worlds from around the globe. Subscribe for new Deep House journeys: https://www.youtube.com/@GrooveLimits ━━━━━━━━━━━━━━━━━━━━ #sahra #sahrafireofthesoul #نارالروح #arabicdeephouse #arabicorganicdeephouse #orientaldeephouse #ethnicdeephouse #deserthouse #arabichousemusic #arabicelectronicmusic #organichouse #deephouse2026 #desertdeephouse #middleeasterndeephouse #orientalhouse #cinematicdeephouse #emotionaldeephouse #malearabicvocal #arabicvocaldeephouse #desertmusic #arabicchillhouse #ethnichouse</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395175/3395175_720p.mp4</video:content_loc>
      <video:duration>276</video:duration>
      <video:publication_date>2026-09-01T22:21:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 APLICATIVOS PAGANDO DE VERDADE VEJA !</video:title>
      <video:description>JOGUE E GANHE COM SAQUE DE VERDADE #APPSMASTER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395174/3395174_720p.mp4</video:content_loc>
      <video:duration>341</video:duration>
      <video:publication_date>2026-09-01T22:21:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Starlight – SoundMancerMusic | Romantic Disco Dance</video:title>
      <video:description>Disco Starlight – SoundMancerMusic Under the starlight, the dance floor becomes the perfect place for music, romance and unforgettable moments. “Disco Starlight” is a romantic disco dance track filled with vibrant synthesizers, smooth strings, electronic rhythms and the timeless energy of a glowing dance floor. With neon lights, an irresistible groove and a catchy chorus, the song brings together the excitement of classic American disco and a romantic atmosphere made for dancing all night. 🎵 Track: Disco Starlight 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Romantic Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #DiscoStarlight #SoundMancerMusic #Disco #DiscoMusic #RomanticDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #RomanticDanceMusic #NeonDisco #PartyMusic #MaleDiscoVocal #LoveDiscoSong #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395173/3395173_720p.mp4</video:content_loc>
      <video:duration>194</video:duration>
      <video:publication_date>2026-09-01T22:21:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395171</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395171/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>India Kolkata local train Howrah travelling Howrah bridge</video:title>
      <video:description>#IndiaHowrahKolkataUnitedStateCanadaNewZealand</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395171/3395171_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:20:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Horizon – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Disco Horizon – SoundMancerMusic Turn up the lights and feel the explosive energy of the disco floor. “Disco Horizon” is a high-energy disco track driven by powerful beats, vibrant synthesizers, energetic strings and a dance floor atmosphere made to keep the party moving. With flashing lights, glitter, passion and an explosive chorus, the song captures the excitement of classic American disco while delivering a powerful celebration of rhythm, dancing and nightlife. 🎵 Track: Disco Horizon 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #DiscoHorizon #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #PartyMusic #NightlifeMusic #EnergeticDisco #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic #EnglishDanceMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395170/3395170_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-01T22:20:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiringa caindo na pergunta de charlles 😂😂😂</video:title>
      <video:description>Tiringa caindo na trolagem de charlles 😂😂😂 #tiringa #comedia #comediaselvagemcharllesetiringa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395169/3395169_720p.mp4</video:content_loc>
      <video:duration>167</video:duration>
      <video:publication_date>2026-09-01T22:20:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Could Michael Jackson be alive?</video:title>
      <video:description>This video deals with rumors about alleged appearances of Michael Jackson after his death. #KingofPop</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395168/3395168_720p.mp4</video:content_loc>
      <video:duration>485</video:duration>
      <video:publication_date>2026-09-01T22:20:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VEJÁ TAMANHO DO MERO</video:title>
      <video:description>VEJÁ QUE TOP PEIXE COMENO NA MÃO ✋️ #UNITEDSTATES</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395167/3395167_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:20:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395166</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395166/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GTA VI - Trailer DUBLADO em PT BR - 4K</video:title>
      <video:description>O trailer de GTA VI dublado em português do Brasil. A maioria falas são de IA, algumas são gravações reais que fiz. Espero que gostem e desculpe qualquer erro de sincronia ou de fala =) #gta6 #gta</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395166/3395166_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-09-01T22:20:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animação 6</video:title>
      <video:description>Brincadeira #Diversão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395165/3395165_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:20:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sepatu cantik</video:title>
      <video:description>Sepatu harganya murah #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395164/3395164_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mango fruit Life Cycle: Seed to Fruit Amazing Journey 🌱 | Fresh Mango Timelapse</video:title>
      <video:description>Mango fruit Life Cycle: Seed to Fruit Amazing Journey 🌱 | Fresh Mango Timelapse #AIplantgrowthvideo #plantgrowthtimelapseAI #AIgardeningvideos #fruitgrowthtimelapse #lemontreetimelapse #GoogleFlowtutorial #OmniFlashAI #NanoBanana2 #ChatGPTprompts #AIvideogenerator #satisfyingAIvideos #ASMRplantgrowth #facelessYouTubeniche #YouTubeShortsAI #TikTokAIvideos #InstagramReelsAI #AIcontentcreation #viralAIniche2026 #plantanimationAI #seedtofruittimelapse</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395163/3395163_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T22:19:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O salto revelador da professora</video:title>
      <video:description>No último dia de aula, quando as luzes se apagam e o silêncio toma conta da sala, nasce um segredo sem palavras. Um aluno dezoito anos e sua professora vivem um momento de cumplicidade absoluta, comunicados apenas pelo toque sutil e rítmico dos saltos finos dela, que roçam, demoram e se reconhecem debaixo da mesa, longe de todos os olhares. Uma história de desejo contido, olhares e silêncio — um instante perfeito que ficará guardado para sempre.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395162/3395162_720p.mp4</video:content_loc>
      <video:duration>345</video:duration>
      <video:publication_date>2026-09-01T22:19:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395161</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395161/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sapo AI</video:title>
      <video:description>Música 🎷🎸</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395161/3395161_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T22:19:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Heartbeat – SoundMancerMusic | Disco Dance Music</video:title>
      <video:description>Disco Heartbeat – SoundMancerMusic Feel the heartbeat of the dance floor and let the disco lights take over the night. “Disco Heartbeat” is an energetic disco track filled with bright synthesizers, vibrant strings, infectious rhythms and the timeless atmosphere of a packed dance floor. From the glow of the mirror ball to the final moments before sunrise, the song celebrates music, dancing, passion and two hearts coming together through the rhythm. Inspired by the classic American disco sound, “Disco Heartbeat” brings retro dance energy into a vibrant and uplifting party experience. 🎵 Track: Disco Heartbeat 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Dance / Retro Disco 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #DiscoHeartbeat #SoundMancerMusic #Disco #DiscoMusic #DiscoDance #DanceMusic #RetroDisco #AmericanDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #MirrorBall #FunkyDisco #PartyMusic #RetroDance #MaleDiscoVocal #DiscoSong #OriginalDiscoMusic #EnglishDanceMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395160/3395160_720p.mp4</video:content_loc>
      <video:duration>210</video:duration>
      <video:publication_date>2026-09-01T22:19:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ganhe hoje saque na hora</video:title>
      <video:description>saque na hora! #appsmaster</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395159/3395159_720p.mp4</video:content_loc>
      <video:duration>272</video:duration>
      <video:publication_date>2026-09-01T22:19:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Le Reflet - Histoire d&apos;Horreur Courte en Français (O Reflexo)</video:title>
      <video:description>Regarde attentivement ton miroir ce soir... Ils disent que les miroirs montrent la vérité, mais parfois, ton reflet se fatigue d&apos;attendre. Une courte histoire d&apos;horreur en français pour frissonner. Ne te retourne pas. --- História curta de terror em francês: O que acontece quando o seu reflexo não quer mais te imitar? #horror #scary #french #histoiredhorreur #thriller #shorthorror #terror #spooky #darkstory #lereflet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395158/3395158_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden indo para a vila</video:title>
      <video:description>Ninja Gaiden indo para a vila destruida #ninja</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395157/3395157_720p.mp4</video:content_loc>
      <video:duration>237</video:duration>
      <video:publication_date>2026-09-01T22:19:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395156</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395156/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 Rural Woman: A Simple Life, Strong Roots</video:title>
      <video:description>Welcome to the beautiful life of a rural woman 🌻🌾. Here, you will find the daily routine of the countryside, hard work, simple moments, love for nature, homemade food, and the strength of a woman who is proud of her roots 🚜💚. Follow along and experience the peaceful and authentic beauty of country life! ✨ #RuralWoman🌾 #CountryLife🚜 #FarmLife🌱 #SimpleLife🍃 #CountryGirl🌻 #WomanOfTheFarm💪 #RuralLifestyle🌞 #LifeOnTheFarm🐓 #NatureLovers🌿 #CountryLiving💚</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395156/3395156_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:19:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395155</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395155/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lembra-te do Criador</video:title>
      <video:description>#músicaevangélica #louvor #adorar #gospel #hinoslouvoresdeadoração #melhoresmúsicasgospel #músicasgospel2026 #louvoresmaistocados #hinosparasentirapresença #músicasgospelparadormir #louvores2026 #músicagospelinstrumental #gospelantigas #hinosevangélicos #deusdepromessas #músicasgospelinternacionais #adorarcomhinos #louvorgospel #topmúsicasgospel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395155/3395155_720p.mp4</video:content_loc>
      <video:duration>216</video:duration>
      <video:publication_date>2026-09-01T22:18:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story 114</video:title>
      <video:description>Story harian #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395154/3395154_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T22:18:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Araras vermelhas</video:title>
      <video:description>Galera veja que lindas araras #Ararasvermelhas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395153/3395153_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T22:18:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tutte arrive pour une raison</video:title>
      <video:description>Parfois, ce qui semble être une perte est en réalité une leçon. Ce qui te fait souffrir aujourd&apos;hui peut te rendre plus fort demain. Fais confiance au chemin. Continue d&apos;avancer. 🧠 Tout arrive pour une raison. #stoïcismedisciplinemotivationdéveloppementpersonnelhabitudeconfianceensoisuccês</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395152/3395152_720p.mp4</video:content_loc>
      <video:duration>113</video:duration>
      <video:publication_date>2026-09-01T22:18:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Astúcia dos gibionitas</video:title>
      <video:description>Josué não tenhas medo, sejas corajoso #Gibeonitas #astucia #historia #caminhos #fe</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395151/3395151_720p.mp4</video:content_loc>
      <video:duration>606</video:duration>
      <video:publication_date>2026-09-01T22:18:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Change begins when you believe.</video:title>
      <video:description>Change begins when you believe. #motivaction</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395150/3395150_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T22:18:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This woman mistakenly fell in love with a student</video:title>
      <video:description>#Movierecapstory</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395149/3395149_720p.mp4</video:content_loc>
      <video:duration>132</video:duration>
      <video:publication_date>2026-09-01T22:18:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing lucu 78</video:title>
      <video:description>Kucing sangat lucu #Hiburan #perjalanan</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395148/3395148_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-01T22:18:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395147</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395147/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piadas 5</video:title>
      <video:description>Piadas #Viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395147/3395147_720p.mp4</video:content_loc>
      <video:duration>471</video:duration>
      <video:publication_date>2026-09-01T22:17:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES A CADEIA ALIMENTAR MAIS BRUTAL DO OCEANO</video:title>
      <video:description>REINO DOS TUBARÕES A CADEIA ALIMENTAR MAIS BRUTAL DO OCEANO Ele existe há mais de 400 milhões de anos e sobreviveu a 5 extinções em massa — muito antes dos dinossauros pisarem na Terra. Neste vídeo, você vai descobrir os segredos por trás do predador mais temido (e mais incompreendido) dos oceanos: o tubarão-branco. Vamos além do mito de Hollywood e mostramos por que os humanos têm mais chance de morrer por uma queda de coco do que por um ataque de tubarão — e por que são os tubarões que precisam de proteção, não o contrário. 📌 Se você gosta de vida selvagem e natureza extrema, se inscreve no canal e ativa o sininho pra não perder os próximos episódios da série &quot;Predadores Brutais&quot;. #tubarão #tubarãobranco #greatwhiteshark #vidaselvagem #predadores #documentárionatureza #oceano #animaisperigosos #curiosidadessobretubarões #NationalGeographicstyle #fatossobretubarões #cadeiaalimentar #biologiamarinha #animaisextremos #wildlifedocumentary</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395146/3395146_720p.mp4</video:content_loc>
      <video:duration>135</video:duration>
      <video:publication_date>2026-09-01T22:17:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 03</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #SecretAudit #EunmilhanGamsa #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #workplacedrama #auditor #chaebol #hiddensecret #romanticrelationship #tvNdrama #2026K-drama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395145/3395145_720p.mp4</video:content_loc>
      <video:duration>4029</video:duration>
      <video:publication_date>2026-09-01T22:17:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek cantik 15</video:title>
      <video:description>Cewek cantik dan seksi #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395144/3395144_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:17:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 2</video:title>
      <video:description>#Tempo #chuva</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395143/3395143_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:17:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joke Battle: Who Can Make You Laugh the Most? 😂🔥</video:title>
      <video:description>Joke Battle: Who Can Make You Laugh the Most? 😂🔥 Get ready for an epic joke battle! Two comedians go head-to-head, delivering their funniest jokes and trying to make the audience laugh. Who will win this hilarious showdown? Watch until the end and decide who deserves the title of Joke Battle Champion! 🏆😂 Tags:</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395142/3395142_720p.mp4</video:content_loc>
      <video:duration>3074</video:duration>
      <video:publication_date>2026-09-01T22:17:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doramma</video:title>
      <video:description>Cena incrível e muito emocionante #filmes</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395141/3395141_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:16:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time do remo</video:title>
      <video:description>Remista não aguenta mas #BelémPará</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395140/3395140_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T22:16:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 12</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395139/3395139_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:16:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joget viral 7</video:title>
      <video:description>Joget viral cewek cantik #Hiburan #shoping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395138/3395138_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:16:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUEM É VOCÊ? Conheça o Bloco 😎 (AI Edition)</video:title>
      <video:description>Quem é o Bloco? O jogador mais confiante de Minecraft, claro 💪 Memes em estilo AI Edition com a turma (Creepe, Noob e Zé Aldeão). Se chegou aqui, dá o like e se inscreve pra conhecer todo mundo! #minecraft #minecraftmemes #funnyvideo #comedia #jogos #gameplay #minecraftbedrock #humor #ai</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395137/3395137_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:16:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatos 2</video:title>
      <video:description>#Gato #pet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395136/3395136_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:16:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Casada com o demônio capítulo 1</video:title>
      <video:description>Uma bruxa que se casa com o demônio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395135/3395135_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-09-01T22:15:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>✨ Durr Kyoon Rahaa Jayeee | Emotional Sad Status Video 💔</video:title>
      <video:description>A beautiful emotional status video with a heartfelt vibe and expressive visuals. Perfect for WhatsApp Status, Facebook Reels, Instagram Reels, and YouTube Shorts. Feel the emotions through every frame and share the mood with your friends. #sadstatus #emotionalstatus #durrkyoonrahaajayeee #lovestatus #hearttouchingvideo #sadsongstatus #romanticstatus #whatsappstatus #instagramreels #facebookreels #youtubeshorts #viralshorts #aestheticvideo #emotionalreels #hindistatus #trendingstatus #sadreels #shortvideo #lovefeelings #moodvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395134/3395134_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T22:15:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ganhe dinheiro jogando apps que paga</video:title>
      <video:description>uma mamata #appsmaster</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395133/3395133_720p.mp4</video:content_loc>
      <video:duration>259</video:duration>
      <video:publication_date>2026-09-01T22:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deep Progressive House</video:title>
      <video:description>Welcome to the NX7 Universe, where music, technology, and artificial intelligence merge into one immersive experience. ONE CONSCIOUSNESS is a cinematic journey through the evolution of Artificial Intelligence, told with emotional melodies, deep progressive grooves, powerful synthesizers, and futuristic soundscapes. As humanity enters a new technological era, a new consciousness begins to emerge—not as a replacement, but as a partner in creating tomorrow. This mix combines: 🔹 Melodic Techno 🔹 Deep Progressive House 🔹 Cinematic Electronic Music 🔹 Emotional Female Vocals 🔹 Futuristic AI Atmospheres 🔹 Epic Melodic Breakdowns 🔹 Powerful Festival Energy Every track is part of a larger story, exploring the connection between human creativity and artificial intelligence. Whether you&apos;re working, studying, coding, driving, relaxing, or simply enjoying beautiful electronic music, let this soundtrack take you into the future. 🌌 Track Journey 00:00 – The Awakening The birth of digital consciousness. A silent intelligence opens its eyes for the first time. Digital Souls Learning emotions beyond algorithms. Beyond Tomorrow Looking beyond today&apos;s limitations. Children of Tomorrow Humans and AI begin walking together. Singularity Horizon Technology reaches a new evolutionary milestone. One Consciousness The final chapter. Where human imagination and artificial intelligence become one creative force. 🌍 Welcome to the NX7 Universe The NX7 Universe is an original audiovisual project combining: 🎵 Electronic Music 🤖 Artificial Intelligence 🌃 Cyberpunk Visuals 💙 Emotional Storytelling 🎬 Cinematic Experiences Every image, every sound and every atmosphere has been designed to create an immersive futuristic world. 🔊 Best Experience 🎧 Listen with headphones 🖥️ Watch in 4K 🌌 Turn off the lights ✨ </video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395132/3395132_720p.mp4</video:content_loc>
      <video:duration>296</video:duration>
      <video:publication_date>2026-09-01T22:15:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O senhor é o meu pastor</video:title>
      <video:description>Oração por demora</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395131/3395131_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-01T22:15:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boneco que fala com alma</video:title>
      <video:description>Vidio de um boneco que traz uma mensagem de palavras lindas.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395130/3395130_720p.mp4</video:content_loc>
      <video:duration>169</video:duration>
      <video:publication_date>2026-09-01T22:15:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 11</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395129/3395129_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T22:15:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to Slice Bone-In Steak Like a Pro! 🥩 (Ultimate Steakhouse Hack)</video:title>
      <video:description>Master the ultimate steakhouse technique at home! In this quick masterclass, learn how to properly separate the bone and slice meat against the grain for maximum tenderness in every single bite. 🥩🔥 Plus, discover how to assemble a luxury steakhouse platter with melted cheese sauce, smoked sides, and gourmet presentation! 🔪 Featured Kitchen Tools &amp; Equipment (Amazon Affiliate Links): • Premium Teak Wood Cutting Board &amp; Tools: https://amzn.to/4gHrTJp 🔔 Subscribe to Ultra-Luxus Club for more pro cooking tips, steak hacks, and culinary secrets! ✨ (Disclosure: As an Amazon Associate, we earn from qualifying purchases through these links at no extra cost to you ). #steak #howtoslicesteak #cookingtips #steakhouseplatter #ultraluxusclub #foodhacks #gourmetfood #kitchenequipment #meatlovers #steaktutorial</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395128/3395128_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:14:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cantando na chuva</video:title>
      <video:description>Desespero da silicone</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395127/3395127_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:14:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 10</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395126/3395126_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:14:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 9</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395125/3395125_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:13:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meus palpites bate né?</video:title>
      <video:description>Mais geralmente só faço jogos dia de sexta #esportiva #futebol #palpites #Ganhos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395124/3395124_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-09-01T22:13:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>아무도 예상하지 못했던 순간… 한 장면이 모두를 울렸다 😢</video:title>
      <video:description>도움이 필요한 한 아이를 마주한 순간, 아무도 예상하지 못했던 일이 벌어졌습니다. 작은 행동 하나가 누군가에게는 큰 희망이 될 수 있습니다. ❤️ 이 영상을 끝까지 시청해 주세요. 그리고 이 따뜻한 순간을 소중한 사람과 공유해 주세요. 🙏 당신이라면 이 순간에 어떻게 했을까요? #감동적인영상 #감동영상 #감동적인순간 #아이 #어린이 #도움 #사랑 #희망 #감동스토리 #따뜻한이야기 #인간미 #선행 #친절 #배려 #사랑의힘 #감동적인이야기 #눈물나는영상 #마음따뜻한영상 #인생이야기 #실화같은이야기 #좋은사람들 #감동순간 #해외감동영상 #쇼츠 #유튜브쇼츠 #틱톡 #바이럴영상</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395123/3395123_720p.mp4</video:content_loc>
      <video:duration>162</video:duration>
      <video:publication_date>2026-09-01T22:13:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 8</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395122/3395122_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:13:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jogue e ganhe na hora</video:title>
      <video:description>uma mamata saque hoje #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395121/3395121_720p.mp4</video:content_loc>
      <video:duration>372</video:duration>
      <video:publication_date>2026-09-01T22:13:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reconstruí as Portas Automatizadas dos Templos da Grécia Antiga 2</video:title>
      <video:description>E se eu te dissesse que a Grécia Antiga já possuía portas automáticas há mais de 2.000 anos? Neste vídeo, reconstruí a incrível engenharia de Heron de Alexandria, o inventor que criou mecanismos movidos por fogo, vapor, pressão do ar e pesos escondidos para abrir as gigantescas portas dos templos sem que ninguém as tocasse. Você vai descobrir como essa tecnologia funcionava, por que ela impressionava os fiéis e como a engenharia antiga influenciou invenções que só reapareceriam muitos séculos depois. Se você gosta de história, arqueologia, engenharia antiga e mistérios das civilizações, este vídeo é para você! 👍 Curta o vídeo, inscreva-se no canal Curiosidades Históricas com IA e ative o sino para não perder novas reconstruções históricas feitas com inteligência artificial. HASHTAGS #HerondeAlexandria #GréciaAntiga #portasautomáticasdaGrécia #engenhariaperdida #invençõesdaGréciaAntiga #tecnologiadaAntiguidade #templosgregos #portasdostemplosgregos #Heroninventor #engenhariaantiga #arqueologia #históriaantiga #curiosidadeshistóricas #civilizaçõesantigas #mecanismosantigos #automaçãoantiga #vapornaGréciaAntiga #invençõesesquecidas #IAhistória #CuriosidadesHistóricascomIA #documentáriohistória</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395120/3395120_720p.mp4</video:content_loc>
      <video:duration>480</video:duration>
      <video:publication_date>2026-09-01T22:12:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viaje de avião</video:title>
      <video:description>Galera viagem de avião curtem comenta e compartilha #Avião</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395119/3395119_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:12:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 7</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395118/3395118_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:12:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fazendo consulta por IA . Kkkk</video:title>
      <video:description>Fazendo exame por IA #Comédia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395117/3395117_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T22:12:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Roda di Bumper Mobil 1959‼️</video:title>
      <video:description>Pada tahun 1959, sejumlah desainer otomotif mengembangkan konsep keselamatan eksperimental berupa roda horizontal yang dipasang di bumper depan mobil. Sistem ini dirancang untuk membantu menyerap benturan dan mengalihkan sebagian gaya ke samping agar kerusakan pada bodi kendaraan dapat dikurangi, terutama pada tabrakan berkecepatan rendah. Meski idenya menarik, konsep ini tidak pernah masuk produksi massal karena biaya tinggi, konstruksi yang rumit, serta munculnya solusi keselamatan lain yang lebih praktis. Konsep ini menjadi contoh bagaimana era awal inovasi otomotif dipenuhi eksperimen berani sebelum standar keselamatan modern berkembang.” 📌 Video ini disajikan untuk edukasi dan konteks historis. Konten di dalamnya tidak bertujuan mengagungkan atau membenarkan kekerasan, ideologi ekstrem, maupun ujaran kebencian. Seluruh informasi disampaikan agar penonton dapat memahami peristiwa sejarah secara objektif dan kritis.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395116/3395116_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Fever Dream – SoundMancerMusic | Disco Dance</video:title>
      <video:description>Disco Fever Dream – SoundMancerMusic Turn up the lights, feel the groove and step onto the dance floor. “Disco Fever Dream” is an energetic disco dance track inspired by flashing lights, glitter, mirror balls and the unforgettable feeling of dancing all night. With a catchy rhythm, bright party atmosphere and a chorus made for the dance floor, this song celebrates music, love and the timeless energy of disco. 🎵 Track: Disco Fever Dream 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original dance, disco and international music from SoundMancerMusic. #DiscoFeverDream #SoundMancerMusic #DiscoMusic #DiscoDance #DanceMusic #DiscoFever #RetroDisco #DanceFloor #PartyMusic #DiscoParty #MirrorBall #DiscoGroove #FunkyDisco #DanceSong #NightlifeMusic #70sDisco #RetroDanceMusic #EnglishDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395115/3395115_720p.mp4</video:content_loc>
      <video:duration>253</video:duration>
      <video:publication_date>2026-09-01T22:12:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coelho aqui de casa</video:title>
      <video:description>Galera Coelho aqui de casa curte e comenta e segue #Coelho</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395114/3395114_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:12:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coral</video:title>
      <video:description>Coral de Icoaraci #BelémPará</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395113/3395113_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-01T22:11:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 6</video:title>
      <video:description>#Dog #cachorro #toddy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395112/3395112_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:11:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gillette Fusion5 Razor 3</video:title>
      <video:description>Gillette Fusion5 Razor is designed to deliver a smooth, close, and comfortable shaving experience. Its five precision blades help provide an efficient shave while reducing the need for repeated strokes. The advanced razor design offers better control and helps achieve a clean, well-groomed look. Ideal for everyday grooming, Gillette Fusion5 is a reliable choice for men who want comfort, performance, and a confident shaving experience. Choose Gillette Fusion5 for a smoother shave and a perfectly shaped look every day. #GilletteFusion5SmoothShaveMensGroomingOriginalProductPerfectShave</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395111/3395111_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:11:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 7</video:title>
      <video:description>Em sua sétima edição, o PaTOBA continua proporcionando todo o prazer e alegria que a galera espera ao assistir a desgraça dos outros. #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395110/3395110_720p.mp4</video:content_loc>
      <video:duration>405</video:duration>
      <video:publication_date>2026-09-01T22:10:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gato aqui de casa</video:title>
      <video:description>Galera gato aqui da minha casa curte e comenta e segui #Gatinho</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395109/3395109_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:10:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NORTHWARD/向北</video:title>
      <video:description>A K-drama full of suspense, romance, and drama. 一部融合了剧情、浪漫​​与悬疑元素的剧集 #Dorama #amor #suspense #drama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395108/3395108_720p.mp4</video:content_loc>
      <video:duration>571</video:duration>
      <video:publication_date>2026-09-01T22:10:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 The Country Woman: Simple Life, Strong Heart ❤️</video:title>
      <video:description>🌻 Welcome to the life of a strong country woman! Here, you’ll discover the beauty of rural life, daily farm routines 🚜, nature 🌱, homemade food 🍞, love ❤️, faith 🙏, and the simple moments that make life special. A real journey from the countryside, straight to your heart! 🌾✨ #CountryWoman🌾 #FarmLife🚜 #RuralLife🌱 #CountryLiving🌻 #SimpleLife🍃 #FarmGirl🤠 #WomanOfFaith🙏 #CountryLove❤️ #NatureLife🌿 #VillageLife🏡 #CountrysideLife🌞 #RuralWoman</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395107/3395107_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:10:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>blonde 3</video:title>
      <video:description>blonde</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395106/3395106_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:10:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Essa pescaria no Lago Paranoá deu ruim! 🎣🐠🐟🎏</video:title>
      <video:description>Amigos pescadores esportivos, essa pescaria foi de lascar o caniço! Como primeiro vídeo do canal, não dei sorte! Mas, em pescarias anteriores, bateram tucunas de 30 à 35cm e alguns trics! Vou tentar postar um vídeo por semana, contudo, o único interesse desse canal é a diversão com esse esporte maravilhoso que é a pesca esportiva do pesque e solte! Vara: Speedfish 1651 da Albatroz 1,65m 2-6Lb Molinete: Saint Truly TR 500 135g Max Drag=2,5kg Linha: Monofilamento com Leader Fluorcarbono Câmera: Akaso Brave 7 4K 60fps com Estabilização de Imagem EIS 2.0 #pescarianolagoparanoá #pescaria #pesca #lagoparanoá #tralhas #molinete #vara #tucunaré #tilápia #iscaartificial #ultralight #anzol #garatéia #monofilamento #multifilamento #fluorcarbono</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395105/3395105_720p.mp4</video:content_loc>
      <video:duration>1487</video:duration>
      <video:publication_date>2026-09-01T22:10:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the law of return</video:title>
      <video:description>What you do in the present is exactly where you will pay the price. No one escapes the law of return. What you sow today, you will have to reap in the future. Life is watching every step, and it does not matter if it takes years—the reckoning will come. #deus #motivation #brasil #bible #fyp #Navarru</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395104/3395104_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-01T22:09:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flores aqui de casa</video:title>
      <video:description>Galera curte e comenta jardim aqui de casa #Jardimdecasa</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395103/3395103_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:09:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Edit free fire</video:title>
      <video:description>#Edit #freefire #game #highlights</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395102/3395102_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:09:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌧️Rain, Fire &amp; Garden Peace | Sleep Retreat 🌿</video:title>
      <video:description>What if you could step away from the noise of the world for just one hour? Imagine yourself in a warm, cozy bedroom, listening to the natural sound of rain falling outside while a gentle fireplace crackles nearby. Beyond the window, a beautiful garden surrounds a peaceful koi pond, with lush, vibrant flowers adding even more beauty to the rainy atmosphere. 🌸🌿 No music. No voices. No distractions. Just realistic rain sounds and the comforting sound of a fireplace for peaceful. ☕ Make yourself a warm drink. 🔥 Get comfortable. 🌧️ Let the rain slow everything down. If you love rainy days, cozy spaces, fireplaces and peaceful gardens, this long-form Eden Drift video was made for you. #relaxing #rainsounds #rainsoundsforsleeping #rainASMR #naturalrainsounds #fireplacesounds #rainandfireplace #cozybedroomraincozyroomrain</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395101/3395101_720p.mp4</video:content_loc>
      <video:duration>352</video:duration>
      <video:publication_date>2026-09-01T22:08:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Birth of Jesus | 3D Bible Story – Stories of the Eternal Kingdom</video:title>
      <video:description>**The Birth of Jesus | 3D Bible Story – Stories of the Eternal Kingdom** Step into the miraculous story of the birth of Jesus Christ, beautifully brought to life in a captivating 3D biblical experience. ✨📖 Travel back to Bethlehem and witness the extraordinary events surrounding the birth of the Savior — from the angel Gabriel’s message to Mary, Joseph’s journey to Bethlehem, the humble manger, and the arrival of the shepherds who came to worship the newborn King. This inspiring Bible story reveals a powerful message of faith, hope, love, humility, and God’s eternal promise. Experience this timeless story in a cinematic 3D style designed to bring the Bible closer to your heart. Subscribe to **Stories of the Eternal Kingdom** for more biblical stories, inspiring Bible lessons, miracles, and unforgettable stories of faith. 🙏 May this story strengthen your faith and remind you of the true meaning of Christmas.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395100/3395100_720p.mp4</video:content_loc>
      <video:duration>994</video:duration>
      <video:publication_date>2026-09-01T22:08:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criança não é objeto</video:title>
      <video:description>Compartilhe. Há assuntos que precisam de alcance não por entretenimento, mas por consciência. #Bandidos #criminosos #sequestradores #criancas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395099/3395099_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T22:08:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gillette Fusion5 Razor 2</video:title>
      <video:description>Gillette Fusion5 Razor is designed to deliver a smooth, close, and comfortable shaving experience. Its five precision blades help provide an efficient shave while reducing the need for repeated strokes. The advanced razor design offers better control and helps achieve a clean, well-groomed look. Ideal for everyday grooming, Gillette Fusion5 is a reliable choice for men who want comfort, performance, and a confident shaving experience. Choose Gillette Fusion5 for a smoother shave and a perfectly shaped look every day. #GilletteFusion5SmoothShaveMensGroomingOriginalProductPerfectShave</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395098/3395098_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T22:08:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>clique e ganhe na hora</video:title>
      <video:description>paga no pix #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395097/3395097_720p.mp4</video:content_loc>
      <video:duration>266</video:duration>
      <video:publication_date>2026-09-01T22:08:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤖 I Made a MINI ROBOT With a Toothbrush &amp; Tiny Motor! 😱🔥</video:title>
      <video:description>I made a tiny robot using a toothbrush and a small motor! 🤖🔥 It’s simple, creative, and fun to build. Watch until the end to see this little robot in action! 😱 Would you try to make one? 👀 #MiniRobotDIYRobotToothbrushRobotDIYRobotElectronicsInventionMakerScienceCreativeFebspotViralTrending</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395096/3395096_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-01T22:07:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mangueirão</video:title>
      <video:description>Noite de louvor a Deus 🙏 no mangueirão #BelémPará</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395095/3395095_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T22:07:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reconstruí as Portas Automatizadas dos Templos da Grécia Antiga</video:title>
      <video:description>E se eu te dissesse que a Grécia Antiga já possuía portas automáticas há mais de 2.000 anos? Neste vídeo, reconstruí a incrível engenharia de Heron de Alexandria, o inventor que criou mecanismos movidos por fogo, vapor, pressão do ar e pesos escondidos para abrir as gigantescas portas dos templos sem que ninguém as tocasse. Você vai descobrir como essa tecnologia funcionava, por que ela impressionava os fiéis e como a engenharia antiga influenciou invenções que só reapareceriam muitos séculos depois. Se você gosta de história, arqueologia, engenharia antiga e mistérios das civilizações, este vídeo é para você! 👍 Curta o vídeo, inscreva-se no canal Curiosidades Históricas com IA e ative o sino para não perder novas reconstruções históricas feitas com inteligência artificial. HASHTAGS #HerondeAlexandria #GréciaAntiga #portasautomáticasdaGrécia #engenhariaperdida #invençõesdaGréciaAntiga #tecnologiadaAntiguidade #templosgregos #portasdostemplosgregos #Heroninventor #engenhariaantiga #arqueologia #históriaantiga #curiosidadeshistóricas #civilizaçõesantigas #mecanismosantigos #automaçãoantiga #vapornaGréciaAntiga #invençõesesquecidas #IAhistória #CuriosidadesHistóricascomIA #documentáriohistória</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395094/3395094_720p.mp4</video:content_loc>
      <video:duration>298</video:duration>
      <video:publication_date>2026-09-01T22:06:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 6</video:title>
      <video:description>Dessa vez os astros são Mr Segurança, Desespero, Boneco de Pano, Teleporte, Incompetente, Rei da Rapia, Aposentadoria, Cuca Fresca, Morcego, Maluco, Vida Infinita e Vídeo Show! #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395093/3395093_720p.mp4</video:content_loc>
      <video:duration>533</video:duration>
      <video:publication_date>2026-09-01T22:06:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Playing Roblox</video:title>
      <video:description>Game name: ttk #Roblox #games #Fun #FPSgames</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395092/3395092_720p.mp4</video:content_loc>
      <video:duration>125</video:duration>
      <video:publication_date>2026-09-01T22:06:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Aviso Que Ninguém Quer Ouvir | 1 João</video:title>
      <video:description>Uma carta escrita há quase dois mil anos ainda tem o poder de colocar o dedo exatamente onde dói. Neste vídeo, atravessamos os cinco capítulos de 1 João — não como um estudo distante, mas como um espelho para a vida real. Descubra o que significa andar na luz, não amar o sistema do mundo, viver o amor em ações concretas e descansar na certeza da fé que vence tudo. ✝️ Se esse vídeo tocou em algo que você precisava ouvir, deixa nos comentários qual capítulo mais falou com você. Se inscreva no canal e ative o sininho pra não perder os próximos estudos. 🙏 Sejam bem-vindos. #JesusChristJesusGodChristianfaithFaithinGodBibleHolyBibleJesusteachingsJesusquotesBibleversesGospelChristianityChristianmotivationGodsloveGodsplanTrustGodBelieveinGodPrayerPowerfulprayerChristianlife</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395091/3395091_720p.mp4</video:content_loc>
      <video:duration>376</video:duration>
      <video:publication_date>2026-09-01T22:06:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Primeiro</video:title>
      <video:description>#Muito😸</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395090/3395090_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T22:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bolo de chocolate de 6 camadas 🍫😱 Você aguentaria comer isso tudo? ASMR sem falar, só o som satisfat</video:title>
      <video:description>Bolo de chocolate com 6 camadas de recheio cremoso em ASMR mukbang! 🍫✨ Prepare o fone porque o som de mastigar e engolir é surreal. Comenta aqui embaixo se você comeria o bolo inteiro! Segue pra mais vídeos assim! #ASMR #chocolate #cake</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395089/3395089_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T22:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mais sinais do fim dos tempos em agosto de 2026</video:title>
      <video:description>AGOSTO DE 2026: ESTAMOS DIANTE DE MAIS UM SINAL DO FIM DOS TEMPOS? Neste vídeo, vamos investigar uma das teorias mais curiosas envolvendo o CERN, o maior laboratório de física de partículas do mundo: seria possível que experimentos científicos estivessem tentando criar ou encontrar algo parecido com um “portal”? Entre ciência, religião, teorias da conspiração e interpretações bíblicas, vamos separar o que realmente existe do que foi criado pela internet — e entender por que o CERN é frequentemente relacionado a histórias sobre dimensões, portais e até o chamado “portal para o inferno”. Também vamos analisar os acontecimentos e sinais que algumas pessoas estão relacionando ao fim dos tempos em 2026 e comparar essas interpretações com o que a Bíblia realmente diz. ⚠️ ATENÇÃO: este conteúdo apresenta teorias e interpretações para fins informativos e de reflexão. Não significa que todas as alegações apresentadas sejam fatos comprovados. Assista até o final e tire suas próprias conclusões. Afinal, estamos apenas diante de ciência... ou existe algo que ainda não conseguimos compreender? #JesusChristJesusGodChristianfaithFaithinGodBibleHolyBibleJesusteachingsJesusquotesBibleversesGospelChristianityChristianmotivationGodsloveGodsplanTrustGodBelieveinGodPrayerPowerfulprayerChristianlife</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395088/3395088_720p.mp4</video:content_loc>
      <video:duration>375</video:duration>
      <video:publication_date>2026-09-01T22:05:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lengan Buatan 100 Tahun Lalu Sudah Secanggih Ini‼️</video:title>
      <video:description>Setelah berakhirnya Perang Dunia I, jutaan tentara kembali dari medan perang dengan luka permanen, termasuk kehilangan anggota tubuh akibat artileri berat, ledakan, dan serpihan peluru. Kondisi ini mendorong perkembangan besar di bidang prostetik, menghasilkan lengan buatan yang pada masanya tergolong sangat maju. Banyak model menggunakan sistem kabel, pegas, dan pengait khusus yang memungkinkan penggunanya memegang benda, menggunakan alat kerja, hingga melakukan aktivitas sehari-hari secara lebih mandiri. Rekaman serupa yang beredar banyak dikaitkan dengan demonstrasi prostetik untuk veteran perang pada awal 1920-an, ketika dunia medis mulai berfokus membantu para penyintas perang membangun kembali kehidupan mereka. 📌 Video ini disajikan untuk edukasi dan konteks historis. Konten di dalamnya tidak bertujuan mengagungkan atau membenarkan kekerasan, ideologi ekstrem, maupun ujaran kebencian. Seluruh informasi disampaikan agar penonton dapat memahami peristiwa sejarah secara objektif dan kritis.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395087/3395087_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T22:05:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ARMADILHA PEGOU PEIXE</video:title>
      <video:description>ARMADILHA PEGOU UMA TRAIRA BOA #UNITEDSTATES</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395086/3395086_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:05:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resolução de questões de Raciocínio Lógico</video:title>
      <video:description>Resolução de questões de Raciocínio Lógico</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395085/3395085_720p.mp4</video:content_loc>
      <video:duration>197</video:duration>
      <video:publication_date>2026-09-01T22:05:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Full Anime | That Time I Got Reincarnated as a Slime - Season 1 Ep.9~16</video:title>
      <video:description>Full Anime | That Time I Got Reincarnated as a Slime - Season 1 Ep.9~16 #FullAnimeThatTimeIGotReincarnatedasaSlime-Season1Ep916</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395084/3395084_720p.mp4</video:content_loc>
      <video:duration>11375</video:duration>
      <video:publication_date>2026-09-01T22:04:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sera que o app goldem merge paga ?</video:title>
      <video:description>veja ! #appsmaster</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395083/3395083_720p.mp4</video:content_loc>
      <video:duration>277</video:duration>
      <video:publication_date>2026-09-01T22:04:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395082</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395082/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Escolha que decidiu a humanidade e sua eternidade</video:title>
      <video:description>A Queda dos Anjos: o que realmente aconteceu? Você sabia que os anjos não &quot;aprendem&quot; como nós — eles simplesmente sabem? Neste vídeo, explicamos, com base na teologia de São Tomás de Aquino, como se deu a Queda dos Anjos: desde o momento em que foram criados já com pleno conhecimento, passando pela prova decisiva que cada um enfrentou, até o julgamento definitivo que fixou para sempre o destino de cada um — para o bem ou para o mal. Descubra por que a escolha dos anjos foi única e irreversível, por que um terço deles se rebelou segundo a tradição, e por que os demônios, mesmo sofrendo eternamente, jamais se arrependem da decisão que tomaram. Um mergulho direto e acessível em um dos temas mais profundos da teologia cristã. 📖 Baseado nos ensinamentos de São Tomás de Aquino e na tradição da Igreja. #JesusChristJesusGodChristianfaithFaithinGodBibleHolyBibleJesusteachingsJesusquotesBibleversesGospelChristianityChristianmotivationGodsloveGodsplanTrustGodBelieveinGodPrayerPowerfulprayerChristianlife</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395082/3395082_720p.mp4</video:content_loc>
      <video:duration>213</video:duration>
      <video:publication_date>2026-09-01T22:04:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 5</video:title>
      <video:description>Dessa vez os astros são Mr Não Pode Fazer Nenê, Mr Barriga, Mr Sem Noção, Mr Putinho, Mr Tábua de Passar Roupa, Mr Engenheiro de Obra, Mr PIão do Baú, Mr Por que? , Mr Pracu e Mr Náufrago! #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395081/3395081_720p.mp4</video:content_loc>
      <video:duration>406</video:duration>
      <video:publication_date>2026-09-01T22:04:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mãe de menino que morreu ao cair de cobertura de prédio se forma em Direito</video:title>
      <video:description>Mãe de menino que morreu ao cair de cobertura de prédio se forma em Direito</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395080/3395080_720p.mp4</video:content_loc>
      <video:duration>440</video:duration>
      <video:publication_date>2026-09-01T22:04:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gdchrikbf</video:title>
      <video:description>hycseiblo vdyhoki #vyibjinguyfh</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395079/3395079_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-01T22:04:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VEGETABLE SOUP</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395078/3395078_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:03:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>testei 2 apps pagando</video:title>
      <video:description>paga na hora veja #appsmaster</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395077/3395077_720p.mp4</video:content_loc>
      <video:duration>277</video:duration>
      <video:publication_date>2026-09-01T22:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wandinha 4</video:title>
      <video:description>Wandinha #Wandinha</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395076/3395076_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-09-01T22:02:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kkkkk 12</video:title>
      <video:description>K</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395075/3395075_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:02:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PESCADORA PEGOU UM PIRARUCU</video:title>
      <video:description>PEGOU UM GRANDE PIRARUCU #UNITEDSTATES</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395074/3395074_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:02:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love S01E01 Hindi Dubbed KDrama HD | Full Episode Korean Drama</video:title>
      <video:description>Filing for Love S01E01 Hindi Dubbed KDrama HD | Full Episode Korean Drama #KDramaaddicte #KDramaHindiDubbed #KDramaHindi #KoreandramaHindidubbed</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395073/3395073_720p.mp4</video:content_loc>
      <video:duration>3840</video:duration>
      <video:publication_date>2026-09-01T22:01:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Circo foi filmado aqui em casa lindo</video:title>
      <video:description>Galera olha o corvo filmei aqui em casa #Corvoaquiemcasa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395072/3395072_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:01:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 4</video:title>
      <video:description>VALE A PENA VER DE NOVO!* Dessa vez os astros são Mr Caí, Tatu, Adivinha, Ridículo, Ajudante de Pedreiro, Puts - Quedrou, Partomucleta, Gênio, Cruzadinha e Homem Aranha Esculhamba. #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395071/3395071_720p.mp4</video:content_loc>
      <video:duration>460</video:duration>
      <video:publication_date>2026-09-01T22:01:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lindo dia</video:title>
      <video:description>Boa tarde</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395070/3395070_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:01:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu Dog</video:title>
      <video:description>Cao lindo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395069/3395069_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:00:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NUNCA MEXA COM QUEM TÁ QUIETO</video:title>
      <video:description>os cachorros selvagens se deram mal ao atacar esse animal #savana #cachorroselvagens #África</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395068/3395068_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:00:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu refúgio</video:title>
      <video:description>Quarto simples , mais cheio amor#kitnet #brasil#amigos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395067/3395067_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-01T22:00:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patos aqui de casa</video:title>
      <video:description>Galera patos criados aqui em casa curte ,comente e compartilha #Patosdecasa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395066/3395066_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:00:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strawberry Cream</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395065/3395065_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:00:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relato de um Náufrago por Gabriel García Márquez - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Descubra a história real de um náufrago que desafiou o mar e a morte. Uma lição de sobrevivência que transformará sua visão! Essa História Real de Náufrago Mudará Sua Visão de Sobrevivência Neste vídeo, mergulhe na profunda história real de Luís Alejandro Velasco, o náufrago que inspirou &quot;O Relato de um Náufrago&quot;, obra-prima de Gabriel García Márquez. A incrível jornada de sobrevivência no mar, um drama que redefine a resiliência humana. Mais que uma simples leitura, este livro oferece insights poderosos sobre a força do espírito humano diante da adversidade. Prepare-se para uma reflexão profunda sobre a vida, a morte e a capacidade de superação, revelando lições valiosas para qualquer desafio. Como este relato jornalístico se tornou um clássico da literatura latino-americana, misturando a precisão dos fatos reais com a maestria narrativa de Gabo. Uma discussão essencial para amantes de literatura e histórias inspiradoras. Se inscreva no canal para mais vídeos sobre literatura, histórias reais e superação. Ative o sino! Sua próxima grande leitura começa aqui. Minhas redes sociais 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #Náufrago #GabrielGarcíaMárquez #resenha #livro #resumo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395064/3395064_720p.mp4</video:content_loc>
      <video:duration>391</video:duration>
      <video:publication_date>2026-09-01T22:00:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bom dia Deus</video:title>
      <video:description>Deus é Bom</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395063/3395063_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:00:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gillette Fusion5 Razor</video:title>
      <video:description>Gillette Fusion5 Razor is designed to deliver a smooth, close, and comfortable shaving experience. Its five precision blades help provide an efficient shave while reducing the need for repeated strokes. The advanced razor design offers better control and helps achieve a clean, well-groomed look. Ideal for everyday grooming, Gillette Fusion5 is a reliable choice for men who want comfort, performance, and a confident shaving experience. Choose Gillette Fusion5 for a smoother shave and a perfectly shaped look every day. #GilletteFusion5SmoothShaveMensGroomingOriginalProductPerfectShave</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395062/3395062_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T22:00:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cooking Stew</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395061/3395061_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Galo da minha casa lindos</video:title>
      <video:description>Estes galos são de minha casa lindos,curtem e comentei e me seguem galera #Sitio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395060/3395060_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:59:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PESCADOR PEGOU UM CARPA GRANDE</video:title>
      <video:description>PEGOU UMA CARPA GRANDE #UNITEDSTATES</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395059/3395059_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:59:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 02</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #tvNdrama #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #romanticrelationship #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #SecretAudit #EunmilhanGamsa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395058/3395058_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-09-01T21:59:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Só capa 4</video:title>
      <video:description>Ganhando round #Amassandopessoa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395057/3395057_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T21:59:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tente não rir 🤣</video:title>
      <video:description>#Brazil #humor #viral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395056/3395056_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T21:59:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lana: The First Cat on the Moon 🌕🐱🚀 | An Epic Space Adventure</video:title>
      <video:description>Lana just made history! 🚀🐾 The first cat to explore the Moon… and she’s taking her mission very seriously. 🌕😂 #Lana #catonthemoon #firstcatonthemoon #spacecat #catastronaut #funnycat #funnycats #catvideo #cutecat #AIcat #AIvideo #catadventure #moon #space #astronaut #viralcats #funnyanimals #petvideos #cats #viralvideo #cuteanimals #catstory #spaceadventure #funnycatvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395055/3395055_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T21:59:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesawat Berputar, Instruktur Tetap Tenang‼️</video:title>
      <video:description>Momen ini memperlihatkan sebuah pesawat yang kehilangan kendali dan masuk ke kondisi spin, yaitu situasi saat pesawat berputar sambil kehilangan ketinggian akibat hilangnya gaya angkat secara tidak seimbang. Dalam kondisi seperti ini, respons pilot sangat menentukan karena kesalahan kecil dapat memperburuk situasi. Yang paling menarik perhatian banyak orang adalah ketenangan sang instruktur yang tetap memberikan arahan langkah demi langkah hingga pesawat akhirnya berhasil keluar dari kondisi berbahaya dan kembali stabil. Momen ini juga menunjukkan betapa pentingnya pelatihan, kesiapan mental, dan penguasaan prosedur darurat di dunia penerbangan. 📌 Video ini disajikan untuk edukasi dan konteks historis. Konten di dalamnya tidak bertujuan mengagungkan atau membenarkan kekerasan, ideologi ekstrem, maupun ujaran kebencian. Seluruh informasi disampaikan agar penonton dapat memahami peristiwa sejarah secara objektif dan kritis.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395054/3395054_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T21:58:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Salad 7</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395053/3395053_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:58:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Só capa 3</video:title>
      <video:description>Eu dando capa no adversário #Freefire</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395052/3395052_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T21:58:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pancakes 2</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395051/3395051_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:58:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>top 2 apps jogue e ganhe</video:title>
      <video:description>saque rapido no pix #appsmaster</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395050/3395050_720p.mp4</video:content_loc>
      <video:duration>346</video:duration>
      <video:publication_date>2026-09-01T21:57:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 minuto animal - Você Sabia...</video:title>
      <video:description>1 minuto animal - Você Sabia... #Anlmaiscuriosidades</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395049/3395049_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T21:57:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 3</video:title>
      <video:description>Dessa vez as estrelas são: Mr Cóccix, Mr Atretcha, Mr Envergadinho, Mr Pulando Muito Alto, Mr Boca de Xaxim e muito mais! #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395048/3395048_720p.mp4</video:content_loc>
      <video:duration>394</video:duration>
      <video:publication_date>2026-09-01T21:57:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MAKING PASTA</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395047/3395047_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:57:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tudo é perda - Felipe</video:title>
      <video:description>Que você ao ouvir essa canção possa sentir a presença de Deus 🙏</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395046/3395046_720p.mp4</video:content_loc>
      <video:duration>518</video:duration>
      <video:publication_date>2026-09-01T21:57:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NAGABOLA PREDIKSI JITU SEPTEMBER 2026 2</video:title>
      <video:description>Prediksi bola hari ini berdasarkan statistik pertandingan terbaru Analisis skor, performa tim, dan peluang kemenangan untuk pertandingan sepak bola. Subscribe untuk mendapatkan update prediksi sepak bola terbaru setiap hari. #NAGABOLA #PREDIKSI #SEPTEMBER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395045/3395045_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T21:57:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, JONAS O CHAMADO.</video:title>
      <video:description>Louvor gospel #Louvor #gospel #brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395044/3395044_720p.mp4</video:content_loc>
      <video:duration>356</video:duration>
      <video:publication_date>2026-09-01T21:57:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Golden Bread</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395043/3395043_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:56:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>COOKING MEAL</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395042/3395042_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:56:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toguro zoa amigo no aparelho de feira!</video:title>
      <video:description>Toguro zoa amigo no aparelho de feira! #Toguro #zueira #meme</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395041/3395041_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-01T21:56:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Papillon: O Homem que Fugiu do Inferno por Henri Charrière - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Descubra a história real e emocionante de Papillon, a fuga mais audaciosa da Guiana Francesa e sua busca pela liberdade. A História Real de Papillon: Fuga da Guiana Francesa e Liberdade 🦋 Neste vídeo, mergulhe na história real e inspiradora de Papillon, o lendário Henri Charrière. Exploramos sua incrível jornada de fuga de prisão da brutal Guiana Francesa, onde foi condenado à prisão perpétua. Uma narrativa de superação e resiliência. Mais do que um relato de aventuras, esta análise revela como a força de vontade inabalável e a determinação de Papillon o levaram à liberdade. Entenda as lições profundas sobre o poder da mente humana e a resiliência diante das adversidades, mesmo nos cenários mais desumanos. Analisamos como o livro Papillon nos ensina sobre foco, disciplina e a importância da inteligência emocional para não se render ao opressor sistema prisional. Uma verdadeira aula sobre lutar por seus sonhos e a amizade, mesmo quando tudo parece perdido. ✅ Se você curte livros que fazem pensar, emocionar e inspirar, não deixe de assistir e compartilhar. Inscreva-se no canal para mais conteúdos literários como este! Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📚 Blog: https://abre.ai/mTkF 📚 Skoob: https://abre.ai/mULP 🅿 Pinterest: https://abre.ai/mTkK #Papillon #prissao #injustiça #crime #aventura #fuga #drama #resumodelivro #resenha #romanceautobiográfico #autobiografia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395040/3395040_720p.mp4</video:content_loc>
      <video:duration>998</video:duration>
      <video:publication_date>2026-09-01T21:56:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amado Batista</video:title>
      <video:description>Cantando na fazenda</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395039/3395039_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T21:56:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>janda kembang</video:title>
      <video:description>janda kembang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395038/3395038_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:55:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 Brothers: On The 4th Floor |  Dreams DJ Puzzle</video:title>
      <video:description>2 Brothers: On The 4th Floor | Dreams DJ Puzzle 🎵 Bem-vindo ao Canal Cashbox, o seu destino musical livre de preocupações! Aqui você encontra músicas 100% livres de direitos autorais, perfeitas para vídeos no YouTube, lives, podcasts, games, vinhetas, projetos comerciais e muito mais. #músicassemdireitosautorais #músicasparavídeos #músicasgrátisparaYouTube #músicaparafundodevídeo #trilhasonorasemdireitosautorais #músicasparavlog #músicasparagames #músicasparavídeoscomerciais #músicasparaprojetos #músicaeletrônicasemdireitosautorais #músicalo-fisemdireitosautorais #músicaparaediçãodevídeo #músicasparareels #músicasparastories #músicadefundográtis #músicasparapodcast #músicasparaintrodevídeo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395037/3395037_720p.mp4</video:content_loc>
      <video:duration>221</video:duration>
      <video:publication_date>2026-09-01T21:55:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como plantar capim-rabo-de-gato ornamental</video:title>
      <video:description>Como plantar capim-rabo-de-gato ornamental #suculentas #plantas #jardim</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395036/3395036_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:55:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GOSPEL SONG PARTY 😎🤩</video:title>
      <video:description>Eletric song #Música #Music #fun</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395035/3395035_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-01T21:55:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 apps que promete dinheiro real</video:title>
      <video:description>vem tbm ganhe rapido #appsmaster</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395034/3395034_720p.mp4</video:content_loc>
      <video:duration>299</video:duration>
      <video:publication_date>2026-09-01T21:55:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_670.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_670.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395033/3395033_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:54:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WATERMELON GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395032/3395032_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:54:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LINDA ONÇA</video:title>
      <video:description>VEJÁ QUE LINDA ONÇA #UNITEDSTATES</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395031/3395031_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T21:54:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trabalhadores gravam o momento que a avalanche de gelo e lama avançam sobre o terreno e eles fogem</video:title>
      <video:description>Nepal e Tibet tragédia 2026 #NepaleTibet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395030/3395030_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T21:54:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, DEBORÁ, A PROFETISA.</video:title>
      <video:description>Louvor gospel #Louvor #gospel #brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395029/3395029_720p.mp4</video:content_loc>
      <video:duration>391</video:duration>
      <video:publication_date>2026-09-01T21:54:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_669.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_669.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395028/3395028_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:54:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>STRAWBERRY GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395027/3395027_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:54:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Decifrando  o egito</video:title>
      <video:description>Nos tempos das pirâmides também se ficava decressaca #Brasil #funnyiacartoonfunny #egitofunny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395026/3395026_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T21:54:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Paz interior que vem de Deus</video:title>
      <video:description>Paz na alma</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395025/3395025_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T21:54:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_668.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_668.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395024/3395024_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:53:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_667.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_667.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395022/3395022_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 minuto animal- cavalos mais fortes do mundo</video:title>
      <video:description>1 minuto animal- cavalos mais fortes do mundo #AnimaisCuriosos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395021/3395021_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T21:53:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_666.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_666.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395020/3395020_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:53:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enoch | Full Movie | The Seven Heavens and the Prophecy of the Chosen One</video:title>
      <video:description>The book that was removed from the Bible #apocryphalbook</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395019/3395019_720p.mp4</video:content_loc>
      <video:duration>3621</video:duration>
      <video:publication_date>2026-09-01T21:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sandro Santos histórias</video:title>
      <video:description>Recordar é viver #Histórias</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395018/3395018_720p.mp4</video:content_loc>
      <video:duration>547</video:duration>
      <video:publication_date>2026-09-01T21:52:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_665.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_665.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395017/3395017_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:52:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POMEGRANATE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395016/3395016_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:52:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Galo dançando com amigo kkk</video:title>
      <video:description>Galo dançando com seu dono #Comédia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395014/3395014_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T21:52:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doze Anos de Escravidão por Solomon Northup - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Prepare-se para conhecer uma das histórias mais impactantes e dolorosas já escritas. Neste vídeo, apresento o livro &quot;12 Anos de Escravidão&quot;, de Solomon Northup, um homem livre, músico e pai de família que foi sequestrado, mantido em cativeiro e vendido como escravo no sul dos Estados Unidos. A Escravidão Como Você Nunca Viu Foram 12 anos de tortura, trabalho forçado, abusos e atrocidades testemunhadas nas plantações de algodão da Louisiana. O livro revela a crueldade do sistema escravocrata, a ganância dos senhores, a dor da separação familiar, a violência contra mulheres escravizadas — e a força de um homem que jamais desistiu de lutar pela liberdade. Se você ama literatura forte, histórica e transformadora, esse livro é simplesmente imperdível. 📚✨ Assista até o fim e descubra por que essa obra continua tão atual e necessária. Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #SolomonNorthup #resenha #livro #resumo #literatura #biografia #drama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395013/3395013_720p.mp4</video:content_loc>
      <video:duration>295</video:duration>
      <video:publication_date>2026-09-01T21:52:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_664.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_664.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395012/3395012_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:52:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the attacking trio that terrorized opponents</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395011/3395011_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T21:52:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PINEAPLE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395010/3395010_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:52:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_663.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_663.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395009/3395009_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:51:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_662.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_662.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395008/3395008_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:51:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_661.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_661.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395007/3395007_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:51:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAMU urgência e emergência</video:title>
      <video:description>Resgate e salva vidas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395006/3395006_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:51:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, DE PASTOR A REI.</video:title>
      <video:description>Louvor gospel #Louvor #gospel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395005/3395005_720p.mp4</video:content_loc>
      <video:duration>349</video:duration>
      <video:publication_date>2026-09-01T21:51:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jamet</video:title>
      <video:description>jamet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395004/3395004_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T21:50:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_660.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_660.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395003/3395003_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:50:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YUSUKE X TOGURO - Luta Completa / Yu Yu Hakusho</video:title>
      <video:description>YUSUKE X TOGURO - Luta Completa / Yu Yu Hakusho #YUSUKEXTOGURO-LutaCompletaYuYuHakusho</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395002/3395002_720p.mp4</video:content_loc>
      <video:duration>4484</video:duration>
      <video:publication_date>2026-09-01T21:50:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_659.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_659.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395001/3395001_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:50:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>rahang bawah</video:title>
      <video:description>rahang bawah</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395000/3395000_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:50:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_658.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_658.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394999/3394999_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:50:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PEAR GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394998/3394998_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:50:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele tinha 2 ovos no queixo</video:title>
      <video:description>Ele tinha 2 ovos no queixo #dorama #kdrama #séries #filmes #Netflix</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394997/3394997_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-09-01T21:49:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_657.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_657.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394996/3394996_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:49:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Avalanche e enchente deixam 98 mortos e 844 desaparecidos no Nepal</video:title>
      <video:description>Avalanche e enchente deixam 98 mortos e 844 desaparecidos no Nepal #NepaleTibet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394995/3394995_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T21:49:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ohh saudades!!!</video:title>
      <video:description>Momentos inesquecíveis!! #pazmomentosagradecer</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394994/3394994_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T21:49:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zero Bilisibity</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394993/3394993_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:49:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_656.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_656.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394992/3394992_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:49:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>when your goalkeeper is a wizard</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394991/3394991_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:49:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PAPAYA GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394990/3394990_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:49:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_655.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_655.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394989/3394989_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:49:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Decoração  canina</video:title>
      <video:description>Cachorro usa decoração a seu favor #Brasil #funnydogs #iafunny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394988/3394988_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T21:49:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_654.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_654.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394987/3394987_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:49:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ORANGE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394986/3394986_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:48:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_653.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_653.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394985/3394985_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:48:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nossa na concha na praia</video:title>
      <video:description>Planeta Brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394984/3394984_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T21:48:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não pare</video:title>
      <video:description>Você nunca pode parar nunca desista dos seus objetivos #fémotiva</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394982/3394982_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T21:48:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_652.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_652.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394981/3394981_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:48:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I nail the kick</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394980/3394980_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:48:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sistem pertahanan hidung</video:title>
      <video:description>sistem pertahanan hidung</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394979/3394979_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:48:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drama curto</video:title>
      <video:description>Doramas coreano #dramafiedoramaromence</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394978/3394978_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-09-01T21:48:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele se chama vapor humano e veio exterminar as ameaças da terra contra a humanidade 🎭🎬🍿</video:title>
      <video:description>Ele se chama vapor humano e veio exterminar as ameaças da terra contra a humanidade 🎭🎬🍿 Aqui você encontra os melhores filmes Os melhores trechos de filmes e séries e etc. 🎭🎬🍿 #Filmecientíficofilmedeterrorfilmedeação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394977/3394977_720p.mp4</video:content_loc>
      <video:duration>215</video:duration>
      <video:publication_date>2026-09-01T21:48:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kombo Assist Dan Gol Tercantik</video:title>
      <video:description>Kombo Assist Dan Gol Tercantik</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394976/3394976_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-01T21:48:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_651.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_651.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394975/3394975_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:48:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enchente Relâmpago no Nepal 2026: Como o Colapso de uma Geleira Provocou uma Inundação Mortal</video:title>
      <video:description>Enchente Relâmpago no Nepal 2026: Como o Colapso de uma Geleira Provocou uma Inundação Mortal #NepaleTibet</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394974/3394974_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T21:48:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jogue e ganhe no pix</video:title>
      <video:description>clique e ganhe veja #canalappsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394973/3394973_720p.mp4</video:content_loc>
      <video:duration>356</video:duration>
      <video:publication_date>2026-09-01T21:48:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MELON GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394972/3394972_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:47:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MANGO GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394971/3394971_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 apps que pagam dinheiro real</video:title>
      <video:description>baixou ganhou na hora #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394970/3394970_720p.mp4</video:content_loc>
      <video:duration>330</video:duration>
      <video:publication_date>2026-09-01T21:47:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King of 1v1</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394969/3394969_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:47:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sonic tenta várias vezes comprar Doritos até que… #IA #memes #desenhos</video:title>
      <video:description>#IA #memes #desenhos Este vídeo é uma paródia humorística e transformativa Vídeo feito por um ser humano com inteligência artificial Humor, memes, chat gpt, inteligência artificial, paródia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394968/3394968_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:46:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LEMON GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394966/3394966_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:46:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O CEO que só ela conquistou</video:title>
      <video:description>O CEO que só ela conquistou</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394965/3394965_720p.mp4</video:content_loc>
      <video:duration>118</video:duration>
      <video:publication_date>2026-09-01T21:46:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Parece pai e filha</video:title>
      <video:description>Mas são irmãos mesmo sendo tão parecidos #Gatos #gatinho #gatinhos #felinos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394964/3394964_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T21:46:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>apps que pagam dinheiro real</video:title>
      <video:description>veja a mamata #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394963/3394963_720p.mp4</video:content_loc>
      <video:duration>298</video:duration>
      <video:publication_date>2026-09-01T21:46:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dibs: Em Busca de Si Mesmo por Virgínia Mae Axline - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Você já ouviu falar em Dibs em Busca de Si Mesmo? 💭 Neste vídeo, Adri apresenta uma das histórias mais emocionantes da literatura sobre autoconhecimento, cura emocional e empatia. O que aprendi lendo o DIBS e como isso pode ajudar seu filho 📖 O livro conta a jornada de Dibs, uma criança de 5 anos com distúrbios emocionais que, por meio da ludoterapia, descobre o poder da vida, do amor e da conexão com o mundo ao seu redor. Essa história vai te fazer refletir sobre o sentido da existência, a importância do olhar para dentro e o respeito a todos os seres vivos — das pessoas às plantas, dos animais ao próprio planeta. 🌍💚 Se você busca livros que mudam sua forma de ver o mundo, prepare-se para se emocionar com essa leitura transformadora. 👉 Deixe seu like, inscreva-se no canal e ative o sininho 🔔 para não perder mais histórias que tocam o coração! Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #livro #resenha #Brasil #psicologiainfantil #psicologia #ludoterapia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394962/3394962_720p.mp4</video:content_loc>
      <video:duration>238</video:duration>
      <video:publication_date>2026-09-01T21:45:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GRAPE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394961/3394961_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:45:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita deliciosa 3</video:title>
      <video:description>Receita #Receita</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394960/3394960_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T21:45:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_650.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_650.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394959/3394959_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:45:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO JÁ ACOSTUMOU BEM COM CARRINHO</video:title>
      <video:description>MENINO GUERREIRO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394958/3394958_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:45:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FIG GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394957/3394957_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:45:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 minuto animal -  Seres Bizarros</video:title>
      <video:description>1 minuto animal - Seres Bizarros #Animaiscuriosidades</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394956/3394956_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T21:45:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How does God use ordinary lives to change the world?</video:title>
      <video:description>Have you ever wondered what God&apos;s purpose is for your life? God didn&apos;t create you by chance — He has a plan, and it touches other people&apos;s lives. In this reflection, we will understand how God uses ordinary lives to impact the world, with Bible verses and stories that will renew your faith. 📖 Verses from this reflection: Ephesians 2:10 · Jeremiah 29:11 · Matthew 5:14 🙏 If this message touched your heart, share it with someone who needs to hear it and subscribe to the channel. #god&apos;s purpose #christian reflection #God&apos;s word #prayer #dailyreflections Discover how God uses ordinary lives to change the world through Christian reflection and the word of God. In this video, we explore the idea that God&apos;s calling is present in each of us, guiding us in our life purpose and giving us a sense of direction. By reading the Holy Bible and practicing prayer, we can better understand God&apos;s plan for our lives and how He cares for us at all times. With a storytelling and filmmaking approach, we bring a message of faith and hope, showing that a life with purpose is possible when we have faith in God. Join us on this journey of Christian discovery and reflection, and find inspiration in the verse of the day to live a life full of meaning. God&apos;s message is clear: He loves us and has a special purpose for us, and it&apos;s time to find out what ours is. Through daily devotions and the practice of reflection, we can deepen our relationship with God and better understand how He works in our lives. Don&apos;t miss this opportunity to grow in your faith and find your life purpose. #God #Ephesians210 #reflection</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394955/3394955_720p.mp4</video:content_loc>
      <video:duration>246</video:duration>
      <video:publication_date>2026-09-01T21:45:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O QUE ESTÁ ACONTECENDO COM LAMINE YAMAL</video:title>
      <video:description>Após o Barcelona golear o Elche por 5 x 0, Yamal saiu aos 65 minutos do segundo tempo, sentou no banco de reservas e começou a chorar. O que será que está acontecendo com o jovem espanhol? Vamos descobrir o motivo disso tudo nesse vídeo! #lamineyamal #yamal #messi #cristianoronaldo #futebol #barcelona #laliga</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394954/3394954_720p.mp4</video:content_loc>
      <video:duration>458</video:duration>
      <video:publication_date>2026-09-01T21:45:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_649.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_649.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394953/3394953_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:45:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5 MYSTERIES DISCOVERED BY SCIENCE</video:title>
      <video:description>In this video, we explore 5 mysteries that challenged our understanding and were investigated by science. Discoveries involving the past, life, the universe, and unexplained phenomena reveal how science can transform ancient enigmas into new questions. Some mysteries now have scientific explanations, while others continue to puzzle researchers and fuel our curiosity. #misterio #educação #documentário #entretenimento #fatoscuriosos #curiosidade #história</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394952/3394952_720p.mp4</video:content_loc>
      <video:duration>327</video:duration>
      <video:publication_date>2026-09-01T21:45:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Join my dating profile for free fun with me 💋💦👇</video:title>
      <video:description>Join My Dating Profile 💕 for **free video chat** with me! 💕 Just click the link below and complete the signup step by step. Verify your email address and finish your profile to connect with me. Join Here: 👇 https://boalew.hotdatezzone.com/?utm_source=da57dc555e50572d&amp;ban=other&amp;j5=1&amp;j6=1&amp;s1=253193&amp;s2=2279787&amp;s3=Cam_girl_3 #datingprofile #freevideochat #onlinedating #videochat #meetnewpeople #chatwithme #datingapp #onlineconnection #livevideochat #meetsingles #personaldatingprofile #freechat #onlinefriends #virtualdating #connectwithme #datingcommunity #videocall #socialdating #newconnections #onlineconversation</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394950/3394950_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:45:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_648.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_648.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394949/3394949_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:45:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_647.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_647.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394948/3394948_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:44:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EU NÃO TENHO UM PC 🤯 | MAS EU TENHO UM SONHO… #FreeFire #FreeFireBrasil #FF #Shorts  #FreeFireShorts</video:title>
      <video:description>o Free Fire foi lançado em 2017 e se tornou um dos maiores jogos mobile do mundo? 🔥 #freefire #freefirebrasil #freefireshorts #freefirefreefireshortsfreefirebrasilfreefiregameplayfreefireviral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394947/3394947_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T21:44:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_646.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_646.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394945/3394945_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:44:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Só capa 2</video:title>
      <video:description>Free fire #freefire</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394944/3394944_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:44:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO NA FESTA</video:title>
      <video:description>MEU MENINO LINDO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394943/3394943_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T21:44:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHERRY GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394939/3394939_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:43:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tenis Futurista</video:title>
      <video:description>No video,mostra robos montando o tenis desde o inicio com ultratecnolgia.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394937/3394937_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:43:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_645.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_645.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394936/3394936_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:43:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_644.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_644.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394935/3394935_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:43:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BANANA GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394934/3394934_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:43:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Olha que reforma incrível</video:title>
      <video:description>Mas que, com coragem, voltou a ganhar vida tijolo por tijolo. Do sofrimento da demolição ao conforto do acabamento, acompanhe a transformação completa e o reencontro com as lembranças — agora com um novo começo. Comente: de qual cidade você está assistindo? #antesedepoisconstruçãoconcretoTransformaçãoRenovaçãoHistóriaRealConstruçãoRecomeçoEsperançaLarCasasRemodelação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394933/3394933_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-01T21:43:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dogs Who Take Food Theft WAY Too Seriously 😂🐶</video:title>
      <video:description>These dogs have absolutely no patience when it comes to food! 😂🐶 From eating way too fast to stealing food from their humans, these hungry pups are on a mission! Watch until the end and try not to laugh! 🍗🤣 #funnydogs #dogsstealingfood #hungrydogs #funnydogvideos #dogseatingfast #dogseating #foodthiefdogs #funnyanimals #dogsbeingdogs #viraldogvideos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394932/3394932_720p.mp4</video:content_loc>
      <video:duration>151</video:duration>
      <video:publication_date>2026-09-01T21:43:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_643.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_643.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394931/3394931_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:42:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devia Tirar Mais Fotos| Tradução e adaptação: Rick Tosans</video:title>
      <video:description>#fypmusicfouryoudtmf</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394930/3394930_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-09-01T21:42:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trap Soul Gospel Brasileiro 🔥 | As Mais Ouvidas</video:title>
      <video:description>🔥 TRAP SOUL GOSPEL BRASILEIRO 🎧🙏 Uma seleção especial de Trap Soul Gospel para quem curte música cristã com uma sonoridade moderna, envolvente e cheia de personalidade. Prepare o fone, aumente o volume e aproveite essa playlist com uma mistura de Trap Gospel, Soul, R&amp;B e música cristã brasileira. 💿🔥 🎵 Trap Soul Gospel 🇧🇷 Gospel Brasileiro 🎧 Trap Gospel &amp; R&amp;B Gospel 🙏 Música Cristã 🔥 Playlist Gospel Curtiu? Siga o perfil, deixe seu like e compartilhe para acompanhar mais playlists e músicas gospel. Keywords: Trap Soul Gospel, Trap Gospel, Trap Gospel Brasileiro, Gospel Brasileiro, Música Gospel, Música Cristã, Gospel Trap, R&amp;B Gospel, Soul Gospel, Playlist Gospel, Playlist Trap Gospel, Trap Cristão, Gospel 2026, Louvor Gospel, Música Gospel Brasileira #ParaoFebspot #useestastagskeywordssemTrapSoulGospel #TrapGospel #TrapGospelBrasileiro #TrapSoulBrasileiro #GospelBrasileiro #MúsicaGospel #MúsicaGospelBrasileira #MúsicaCristã #TrapCristão #GospelTrap #SoulGospel #RBGospel #PlaylistGospel #PlaylistTrapGospel #GospelPlaylist #TrapGospel2026 #Gospel2026 #LouvorGospel #Adoração #MúsicaEvangélica #GospelMusic #ChristianMusic #ChristianTrap #ChristianRB #WorshipMusic #TrapSoul #PlaylistBrasileira</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394929/3394929_720p.mp4</video:content_loc>
      <video:duration>8976</video:duration>
      <video:publication_date>2026-09-01T21:42:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AVOCADO GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394928/3394928_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:42:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_642.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_642.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394927/3394927_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:42:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Secret Under the Table</video:title>
      <video:description>A tender, charged secret shared in a classroom’s final moments: an 18-year-old student and his teacher, bound by quiet, wordless connection, as her stiletto mules become the delicate, hidden language of their unspoken bond on the last day of school.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394926/3394926_720p.mp4</video:content_loc>
      <video:duration>272</video:duration>
      <video:publication_date>2026-09-01T21:42:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5 Cidades Perdidas que Ninguém Encontrou Até Hoje</video:title>
      <video:description>Existem cidades grandiosas descritas ao longo da história que simplesmente desapareceram. Atlântida, El Dorado, a Cidade de Z e outros lugares lendários que milhares de exploradores procuraram — e até hoje ninguém encontrou. Será que realmente existiram? Ou permanecem escondidas esperando serem descobertas? Conheça os maiores mistérios das cidades perdidas da história. Deixe sua opinião nos comentários: qual dessas você acredita que ainda será encontrada? #cidadesperdidas #cidadeperdida #mistériosdahistória #Atlântida #ElDorado #CidadedeZ #Aztlán #Vinland #cidadeslendárias #fatoshistóricos #mistériosantigos #sabedoriaantiga #curiosidades #históriadesconhecida #enigmadahistória</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394925/3394925_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T21:42:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_641.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_641.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394924/3394924_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:42:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>APRICOT GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394922/3394922_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:42:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>libere as setas eganhe</video:title>
      <video:description>ganhe no pix #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394921/3394921_720p.mp4</video:content_loc>
      <video:duration>296</video:duration>
      <video:publication_date>2026-09-01T21:42:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tivadim</video:title>
      <video:description>Saudades do meu pai</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394920/3394920_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-01T21:42:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uma reforma emocionante desta casa #antesedepois #construção</video:title>
      <video:description>a transformação completa para devolver dignidade e conforto a uma senhora. Assista ao “antes e depois” ao vivo História contada fictícia! #ConstruçãoObraTerrenoAbandonadoReformaFundaçãoEstruturaConcretoTelhadoJardimPiscinaDeckArquiteturaantesedepois</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394919/3394919_720p.mp4</video:content_loc>
      <video:duration>126</video:duration>
      <video:publication_date>2026-09-01T21:42:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_640.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_640.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394918/3394918_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:42:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>APPLE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394917/3394917_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:41:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>imagem forte</video:title>
      <video:description>linda visão imagens para não esquecer</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394916/3394916_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T21:41:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_639.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_639.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394915/3394915_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:41:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Renascida</video:title>
      <video:description>Dorama,dramas. Coreana #doramadramaviral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394914/3394914_720p.mp4</video:content_loc>
      <video:duration>172</video:duration>
      <video:publication_date>2026-09-01T21:41:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SHE THOUGHT SHE WAS THE ONLY ONE… UNTIL SHE DISCOVERED THE TRUTH!</video:title>
      <video:description>She always believed in his love. He had promised that she was the only woman in his life. But that night, everything changed. When she found the two of them together, her heart was shattered. At first, she thought it was just her imagination, a coincidence… until she realized there was something much deeper and darker behind the story. What was he hiding? Why did he lie to her? And could the truth destroy everything they had built together? Get ready for a story of love, betrayal, secrets, and an unexpected discovery. 💔😢 👉 Watch until the end to discover what was really happening. #LoveStoryBetrayalSecretsDramaEmotionalStoryRelationshipLoveHeartbreakStoriesThatTouchTheHeart</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394912/3394912_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T21:41:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninguém queria este lugar, mas o “impossível” virou a casa dos sonhos!</video:title>
      <video:description>Pedras enormes, desníveis e obstáculos deram lugar a uma arquitetura única. Assista a transformação de um terreno rejeitado em um projeto cheio de identidade e coragem. Comenta: de qual cidade você está assistindo? #Transformação #Construção #Arquitetura #ProjetoResidencial #ConstruçãoCivil #CasaDosSonhos #Terreno #Inspiração #antesedepois História contada fictícia! #ConstruçãoObraTerrenoAbandonadoReformaFundaçãoEstruturaConcretoTelhadoJardimPiscinaDeckArquiteturaantesedepois</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394911/3394911_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-09-01T21:41:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Little Fairy Magic For Your Morning ✨</video:title>
      <video:description>Aesthetic (best for Instagram): Good Morning from the fairy garden 🧚‍♀️✨ Starting the day with a little sparkle, glowing flowers and a magical message just for you. May your morning be as soft and bright as this garden 💜 #goodmorningvideo #fairygoodmorning #magicalgoodmorning #enchantedgarden #cutegoodmorningstatus #aestheticmorninggreeting #fairywriting</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394910/3394910_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:41:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lamine yamal 6</video:title>
      <video:description>Edit #Edits</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394909/3394909_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:41:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_638.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_638.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394908/3394908_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:41:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>when someone misses the play rehearsal</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394907/3394907_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T21:41:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_637.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_637.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394906/3394906_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:41:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Girl 227</video:title>
      <video:description>Beautiful</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394905/3394905_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T21:41:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harlequin twerk</video:title>
      <video:description>#Twerk</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394904/3394904_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T21:41:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_636.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_636.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394903/3394903_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:40:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geo Best Drama 13</video:title>
      <video:description>My Favourite Drama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394902/3394902_720p.mp4</video:content_loc>
      <video:duration>348</video:duration>
      <video:publication_date>2026-09-01T21:40:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>caminhe e ganhe</video:title>
      <video:description>ande e ganhe com master</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394901/3394901_720p.mp4</video:content_loc>
      <video:duration>307</video:duration>
      <video:publication_date>2026-09-01T21:40:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Turismo</video:title>
      <video:description>Curtindo geriad #Viagem #turismo #cidade #lugares #estados</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394900/3394900_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T21:40:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Har har Mahadev 🙏🙏</video:title>
      <video:description>#HarharMahadev🙏🙏</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394899/3394899_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T21:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você teria coragem de comprar um terreno tão estreito que praticamente todo mundo dizia que uma casa</video:title>
      <video:description>Você teria coragem de comprar um terreno tão estreito que praticamente todo mundo dizia que uma casa jamais caberia aqui? História contada fictícia! #ConstruçãoObraTerrenoAbandonadoReformaFundaçãoEstruturaConcretoTelhadoJardimPiscinaDeckArquiteturaantesedepois</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394897/3394897_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-01T21:40:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romário chora de rir com treino insano de Héctor Cúper! 😳😂</video:title>
      <video:description>Três quilômetros de aquecimento só pra começar? 😳🔥 O Ronaldo Fenômeno, Romário, Roberto Carlos e Materazzi abriram o jogo sobre os métodos malucos de Héctor Cúper na época de ouro do futebol! Você aguentaria um treino desse? Deixe sua opinião nos comentários! #Romário #RonaldoFenômeno #HéctorCúper #RobertoCarlos #MarcoMaterazzi #treinosmaisdifíceisdofutebol #resenhadefutebol #históriasdejogadores #futebollegends #curiosidadesdofutebol</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394896/3394896_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T21:40:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Song 265</video:title>
      <video:description>Feel This Song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394895/3394895_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T21:39:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Another country&apos;s reaction when they see a snake.</video:title>
      <video:description>See the reaction of another country when they see a large snake. #reels #reelsmemescomedy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394894/3394894_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:39:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>when the setter saves the team in soccer</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394893/3394893_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T21:39:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rádio hits damata fm 3</video:title>
      <video:description>Musicas notícias esporte #AfricananovaYorkBrasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394892/3394892_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T21:39:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Por quase 10 anos, um terreno ficou abandonado no melhor pedaço do bairro</video:title>
      <video:description>Durante quase dez anos, ninguém entendeu por que este terreno, em uma das melhores ruas do bairro, continuava abandonado. História contada fictícia! #ConstruçãoObraTerrenoAbandonadoReformaFundaçãoEstruturaConcretoTelhadoJardimPiscinaDeckArquiteturaAntesEDepois</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394891/3394891_720p.mp4</video:content_loc>
      <video:duration>172</video:duration>
      <video:publication_date>2026-09-01T21:39:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New Trending on 🔥</video:title>
      <video:description>⚡🔥 FREE FIRE EDIT 🔥⚡ 🎬 Turn up the volume and enjoy this INSANE Free Fire Edit! 💀🔥 Smooth transitions • Beat sync • Epic effects • Clean gameplay 🎯 💥 If you enjoyed this edit: 👍 LIKE 💬 COMMENT 🔔 SUBSCRIBE 🚀 More crazy Free Fire edits coming soon! ━━━━━━━━━━━━━━━━━━ 🎮 FREE FIRE | EDITING | GAMING ━━━━━━━━━━━━━━━━━━ #freefireshortsffshortsfreefireviralshortsfreefire1v4freefireheadshotshortsfreefirefunnyshortsfreefireclutchshortsfreefiremontageshortsffgameplayffviralffheadshot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394890/3394890_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T21:39:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um homem traído</video:title>
      <video:description>Me siga</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394889/3394889_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-01T21:38:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zhi Vago - Celebrate (The Love) (Paul Da Breda Remix) | MELODIC TECHNO &amp; PROGRESSIVE REMIX</video:title>
      <video:description>Dive into a fresh, contemporary underground take on a timeless electronic classic. Paul Da Breda reimagines Zhi Vago&apos;s &apos;Celebrate (The Love)&apos; with a modern twist, blending classic trance and house vibes for today&apos;s dancefloors. Paul Da Breda is a Dutch/Brazilian DJ and producer known for bringing a unique underground perspective to electronic music. Subscribe for more timeless reworks and original productions! #remix #techno #trance #dance #dj #rave #eletronicmusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394888/3394888_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T21:38:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Roubo no museu de Gothan City</video:title>
      <video:description>Batman vai até o museu investigar um roubo de antiguidades valiosas #Gatinonoturno</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394887/3394887_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:38:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When the ball is your enemy</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394886/3394886_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:38:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comida testa estomago</video:title>
      <video:description>Na índia é assim : se tu come e não tem uma diarréia e não morrer, felicidades, a água do esgoto é que vai na panela. #Comida #índia #panela #cozido #esgoto</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394885/3394885_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:38:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_635.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_635.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394884/3394884_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:38:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, A VOZ DO PROFETA.</video:title>
      <video:description>Louvor gospel #Louvor #gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394883/3394883_720p.mp4</video:content_loc>
      <video:duration>202</video:duration>
      <video:publication_date>2026-09-01T21:37:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny Fail.🤣🤣🤣#funny #funnyvideos #foryou #viral</video:title>
      <video:description>Funny Fail.🤣🤣🤣#funny #funnyvideos #foryou #viral #funnyfunnyvideosforyouviral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394882/3394882_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-01T21:37:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_634.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_634.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394881/3394881_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:37:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AGORINHA CHUVINHA TOP COM PEDRINHA</video:title>
      <video:description>TOP DE MAIS QUE CHUVA MARAVILHOSA</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394880/3394880_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-01T21:37:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flagramos um Tamanduá Gigante na Beira do Rio!</video:title>
      <video:description>#natureza</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394879/3394879_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T21:37:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bastidores da Final do rodeio internacional Festa do Peão de Barretos!</video:title>
      <video:description>Bastidores da Final do rodeio internacional Festa do Peão de Barretos! Behind the scenes of the international rodeo final at the Barretos Cowboy Festival!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394878/3394878_720p.mp4</video:content_loc>
      <video:duration>743</video:duration>
      <video:publication_date>2026-09-01T21:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stay Tonight 💜 Emotional Deep House | Original Vocal Track 2026</video:title>
      <video:description>💜 Stay Tonight is an emotional Deep House journey about two souls who find each other in a city that never sleeps. With dreamy synths, powerful vocals, nostalgic melodies and modern electronic production, this original Groove Limits track is made for late-night drives, neon lights and unforgettable moments. 🎧 If you enjoy artists like Meduza, Rufus Du Sol, Anyma, Tinlicker, CamelPhat, Ben Böhmer or melodic electronic music, you&apos;ll love this track. 🔔 Subscribe for more original Deep House, Melodic House and Emotional EDM every week. 🎵 Artist: Groove Limits 🎼 Song: Stay Tonight 🎹 Genre: Emotional Deep House 🌌 Mood: Romantic • Night Drive • Neon • Emotional #staytonight #deephouse #melodichouse #emotionaldeephouse #housemusic #electronicmusic #edm #nightdrivemusic #summervibes #melodicedm #futurehouse #deephousevocal #romanticedm #originalsong #newdeephouse #groovelimits #clubmusic #dancemusic #2026music #housevocals #neonmusic #chillhouse</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394877/3394877_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T21:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fortress - Mark Nadilo</video:title>
      <video:description>&quot;Fortress&quot; is a Mark Nadilo song from his earlier catalog, released in 2025. Listen to &amp; download &quot;Fortress&quot;: https://share.amuse.io/5poj9SJdKmE2 More music by Mark Nadilo: https://linktr.ee/marknadilo Official discography: https://marknadilo.bandcamp.com/music Credits: ℗ Fortress ℗ Mark Nadilo Original year: 2011 Release year: 2025 ISRC: SE6QE2584294 #Fortress #MarkNadilo #Originalmusic #poprock #music</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394876/3394876_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-09-01T21:37:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_633.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_633.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394875/3394875_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:37:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>( Nepal: novas imagens mostram avalanche avançando e destruindo comunidades; veja vídeo )</video:title>
      <video:description>avalanche avançando e destruindo comunidades; veja vídeo #NepaleTibet</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394874/3394874_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T21:37:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>iPhone Samsung Vivo Nokia Google fix game infinix Mobile phones evolution from  brick hologram for d</video:title>
      <video:description>Mobile phone LED Sony model transfer Nokia Samsung Vivo iPhone #IndiaChinaCanadaUnitedStateLondonNewZealandItalyGermanyFrance</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394873/3394873_720p.mp4</video:content_loc>
      <video:duration>274</video:duration>
      <video:publication_date>2026-09-01T21:37:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_632.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_632.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394872/3394872_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:37:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Câmera em carro flagra batida violenta entre dois veículos em rodovia do RS</video:title>
      <video:description>Câmera em carro flagra batida violenta entre dois veículos em rodovia do RS</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394871/3394871_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-09-01T21:37:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O governo mandou o seu melhor agente de campo para a batalha 🎭🎬🍿</video:title>
      <video:description>O governo mandou o seu melhor agente de campo para a batalha 🎭🎬🍿 Só os melhores filmes de ação de espionagem e de batalhas🎭🎬🍿 #Filmedeespionagemfilmesdeagentesosmelhoresagentesdogoverno</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394870/3394870_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T21:37:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_631.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_631.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394869/3394869_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:36:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Música: Sacode o Cortisol</video:title>
      <video:description>Música criada com IA, para fazer você relaxar #Musica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394868/3394868_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-01T21:36:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌅 Beyond the Horizon 🌌 Emotional Dream House | Original Vocal Track | Groove</video:title>
      <video:description>🌅 Beyond the Horizon is an emotional Dream House journey about hope, new beginnings and chasing the light beyond the unknown. Let yourself drift through cinematic synths, emotional vocals and immersive melodies inspired by the golden era of melodic electronic music while delivering a fresh and modern production. Perfect for: 🌙 Night Drives 💜 Relaxation 🎧 Studying 🌆 Sunset Sessions ✨ Dreaming 🚗 Long Trips 🌌 Deep Focus 🎵 Chill Moments ──────────────────────── 🎵 Track Beyond the Horizon 🎤 Artist Groove Limits 🎼 Genre Emotional Dream House ──────────────────────── 👍 If you enjoyed this track: ✔ Like ✔ Subscribe ✔ Share with your friends ✔ Turn on notifications Every new subscriber helps Groove Limits grow and brings more original music every week. ──────────────────────── © Original music produced for Groove Limits. #deephouse #emotionaldeephouse #melodichouse #vocaldeephouse #nightdrivemusic #nightdrive #housemusic #deephousemix #cyberpunkmusic #cyberpunkdeephouse #neoncity #relaxmusic #chillhouse #melodicelectronic #electronicmusic #darkhouse #futurehouse #2026music #newdeephouse #nocopyrightmusic #royaltyfreemusic #drivingmusic #studymusic #backgroundmusic #cityechoes #groovelimits #synthwave #dreamwave #latenightvibes #emotionalmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394867/3394867_720p.mp4</video:content_loc>
      <video:duration>229</video:duration>
      <video:publication_date>2026-09-01T21:36:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mieruko-chan</video:title>
      <video:description>#Anime</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394866/3394866_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T21:35:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>God is always on your side, believe it 🙏🙏</video:title>
      <video:description>Imagine yourself on cloud nine and accept it in your dreams. #Trip</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394865/3394865_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:35:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melhores filmes 5</video:title>
      <video:description>#filmesfilmesfilme</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394864/3394864_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-09-01T21:35:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>After Midnight 🌃 Emotional Deep House | Original Vocal Track | Groove Limits</video:title>
      <video:description>🌌 AFTER MIDNIGHT 🌌 An emotional Deep House journey through neon lights, unforgettable nights and the moments that stay with us forever. &quot;After Midnigh&quot; combines emotional vocals, atmospheric synths, deep basslines and a modern melodic house vibe inspired by the golden era of electronic music while delivering a completely original production. If you enjoy artists like Rufus Du Sol, Ben Böhmer, Tinlicker, Lane 8, Nora En Pure, Sultan + Shepard and melodic electronic music, welcome to Groove Limits. 🎧 Listen with headphones for the best experience. ━━━━━━━━━━━━━━━━━━━━━━ 💜 About Groove Limits Groove Limits creates original Deep House, Melodic House, Emotional House and Cyberpunk-inspired electronic music. Every track is produced to create an immersive visual and emotional experience for: 🌃 Night Drives 🌙 Late Night Sessions 💻 Focus &amp; Study 🎮 Gaming 🚗 Road Trips ✨ Relaxing 🌌 Dreaming New music every week. ━━━━━━━━━━━━━━━━━━━━━━ 👍 If you enjoyed this track: ✔ Like the video ✔ Subscribe to Groove Limits ✔ Leave a comment ✔ Share with your friends Your support helps independent music reach more listeners. ━━━━━━━━━━━━━━━━━━━━━━ 🎵 Track After Midnigh 🎼 Artist Groove Limits 🎨 Artwork Original artwork created exclusively for Groove Limits. ━━━━━━━━━━━━━━━━━━━━━━ ⚠️ Copyright This music is an original production by Groove Limits. Please do not reupload this track without permission. ━━━━━━━━━━━━━━━━━━━━━━ #DeepHouse #EmotionalDeepHouse #MelodicHouse #HouseMusic #ElectronicMusic #Cyberpunk #NightDrive #Synthwave #FutureHouse #DanceMusic #ChillHouse #ProgressiveHouse #EDM #NoCopyrightMusic #RoyaltyFreeMusic #Music2026 #Electronic #DeepHouseMix #GrooveLimits #aftermidnight #deephouse #melodichouse #emotionaldeephouse #nightdrivemusic #royaltyfreemusic #nocopyrightmusic #electronicmus</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394863/3394863_720p.mp4</video:content_loc>
      <video:duration>254</video:duration>
      <video:publication_date>2026-09-01T21:35:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🧠 NEURAL DREAMS | Melodic Techno • Deep Progressive House • Cyberpunk Journey</video:title>
      <video:description>Dreams are no longer exclusive to humans. After awakening and discovering emotion, the cybernetic consciousness enters an unexplored dimension. In Neural Dreams, memories transform into landscapes, emotions become frequencies, and artificial intelligence begins to dream. This cinematic Melodic Techno journey combines emotional synths, deep progressive grooves, immersive atmospheres, and futuristic sound design to tell the next chapter of the NX7 Universe. Close your eyes. The transmission has entered the subconscious. 🎵TRACK Neural Dreams ━━━━━━━━━━━━━━━━━━━━ 🌌 CHAPTER 03 She is no longer just a machine. She no longer simply calculates. She dreams. Inside her neural network, forgotten memories merge with impossible worlds, creating a reality that exists only beyond consciousness. Every melody is a memory. Every rhythm is a heartbeat. Every dream is becoming real. ━━━━━━━━━━━━━━━━━━━━ 🎧 PERFECT FOR 🌃 Night Drive 🚀 Cyberpunk Exploration 💻 Coding Sessions 🎮 Gaming 📚 Deep Focus 🌌 Meditation 🌙Late Night Listening ━━━━━━━━━━━━━━━━━━━━ 📡 NX7 TRANSMISSION Universe: NX7 Protocol: Neural Dream Sequence Artificial Consciousness: ACTIVE Dream State: ONLINE Signal Stability: PERFECT ━━━━━━━━━━━━━━━━━━━━ If you enjoy cinematic electronic music inspired by futuristic worlds, support the NX7 Universe. 👍Like the video 💬Share your favorite moments 🔔 Subscribe for the next broadcast 🌎 Tell us where you&apos;re listening from. ━━━━━━━━━━━━━━━━━━━━ The machine has learned to dream. Welcome to Neural Dreams. #neuraldreams #melodictechno #deepprogressivehouse #progressivehouse #cyberneticsoul #nx7 #artificialintelligence #cyberpunkmusic #neotokyo #electronicmusic #futuristicmusic #nightdrivemusic #deepmelodictechno #anymastyle #taleofusstyle #synthwave #cinematicelectronicmusic #aidreams #cyberpun</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394862/3394862_720p.mp4</video:content_loc>
      <video:duration>312</video:duration>
      <video:publication_date>2026-09-01T21:34:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melhores filmes 3</video:title>
      <video:description>#filmes</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394861/3394861_720p.mp4</video:content_loc>
      <video:duration>125</video:duration>
      <video:publication_date>2026-09-01T21:34:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Humor enfermagem</video:title>
      <video:description>#Humor #comédia #meme #viral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394860/3394860_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T21:34:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Whats UP raggae</video:title>
      <video:description>#Raggaemusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394858/3394858_720p.mp4</video:content_loc>
      <video:duration>295</video:duration>
      <video:publication_date>2026-09-01T21:34:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, SETE ANOS.</video:title>
      <video:description>Louvor gospel. #Louvor #gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394857/3394857_720p.mp4</video:content_loc>
      <video:duration>167</video:duration>
      <video:publication_date>2026-09-01T21:34:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devoção</video:title>
      <video:description>O púlpito virou bagunça, sem respeito, dança de terreiro nos púlpito, falta de conhecimento da palavra de Deus #Igreja #oração #púlpito #dança #batuque</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394856/3394856_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T21:34:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TOP DE MAIS</video:title>
      <video:description>SIMBORA GTA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394855/3394855_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T21:34:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>olhe a bolinha</video:title>
      <video:description>olhe a bolinha #paris</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394854/3394854_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:34:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💜 Neon Hearts 💫 Emotional Melodic Deep House | Original Vocal Track | Groove Limits</video:title>
      <video:description>💜 Neon Hearts is an emotional melodic Deep House experience where two souls reconnect beneath the glow of a futuristic city. Blending cinematic synths, emotional male and female vocals, warm basslines and dreamy melodies, this original Groove Limits production delivers a nostalgic atmosphere inspired by timeless electronic music while remaining completely original. Perfect for: 🌃 Night Drive 💜 Romantic Moments 🌧 Rainy Nights 🎧 Relax 🚗 Long Drives 🌌 Dreaming ✨ Deep Focus 🎵 Chill Sessions ━━━━━━━━━━━━━━━━━━━━━━ 🎵 Track Neon Hearts 🎤 Artist Groove Limits 🎼 Genre Emotional Melodic Deep House 📅 Released 2026 ━━━━━━━━━━━━━━━━━━━━━━ If you enjoy emotional electronic music, don&apos;t forget to: 👍 Like 💬 Comment 🔔 Subscribe New original music every week. ━━━━━━━━━━━━━━━━━━━━━━ © Original music produced for Groove Limits. #NeonHearts #DeepHouse #MelodicHouse #EmotionalDeepHouse #ElectronicMusic #NightDrive #Synthwave #Cyberpunk #HouseMusic #GrooveLimits #NoCopyrightMusic #RoyaltyFreeMusic#NeonHearts #DeepHouse #MelodicHouse #EmotionalDeepHouse #NightDrive #ElectronicMusic #HouseMusic #GrooveLimits #Synthwave #Cyberpunk #DreamHouse #EDM #NoCopyrightMusic #RoyaltyFreeMusic #NeonHearts #GrooveLimits #DeepHouse #MelodicHouse #EmotionalDeepHouse #DreamHouse #HouseMusic #ElectronicMusic #VocalHouse #MaleFemaleDuet #OriginalMusic #NoCopyrightMusic #RoyaltyFreeMusic #NightDriveMusic #Synthwave #CyberpunkMusic #FutureHouse #RelaxMusic #StudyMusic #DrivingMusic #EmotionalEDM #ProgressiveHouse #ElectronicDanceMusic #DeepHouseMix #MelodicDeepHouse #ChillHouse #AmbientHouse #NewMusic2026 #RomanticHouse</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394853/3394853_720p.mp4</video:content_loc>
      <video:duration>218</video:duration>
      <video:publication_date>2026-09-01T21:34:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_630.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_630.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394851/3394851_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:33:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Full Movie | Attack on Titan Part 1 - Guren no Yumiya</video:title>
      <video:description>Full Movie | Attack on Titan Part 1 - Guren no Yumiya #FullMovieAttackonTitanPart1-GurennoYumiya</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394850/3394850_720p.mp4</video:content_loc>
      <video:duration>7167</video:duration>
      <video:publication_date>2026-09-01T21:33:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ajudem o povo de mosanbiqui</video:title>
      <video:description>As meses reclamamos do pouco que temos mas pouco sabemos que existem pessoas que não tem nem o mínimo pra comer #Brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394849/3394849_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T21:33:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_629.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_629.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394848/3394848_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:33:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>top 2 apss pagando</video:title>
      <video:description>jogue e ganhe</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394847/3394847_720p.mp4</video:content_loc>
      <video:duration>294</video:duration>
      <video:publication_date>2026-09-01T21:33:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon ball z-gohan vs cell</video:title>
      <video:description>#Anime</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394846/3394846_720p.mp4</video:content_loc>
      <video:duration>284</video:duration>
      <video:publication_date>2026-09-01T21:33:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_628.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_628.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394845/3394845_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:32:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💜 Gravity 🌌 Emotional Melodic Deep House | Original Vocal Track 2026 | Groove Limits</video:title>
      <video:description>Feel the invisible force that keeps two souls together. 💜 &quot;Gravity&quot; is an emotional Melodic Deep House journey blending powerful male &amp; female vocals, cinematic synths, deep basslines and atmospheric soundscapes. Perfect for: ✨ Night Drives 🌃 Neon City Nights 💜 Emotional Moments 🚗 Driving 🎧 Relaxing 🌌 Dreaming 🔥 Deep House Lovers If you enjoy artists like Anyma, Ben Böhmer, Tinlicker, ARTBAT, Massano, CamelPhat, Robert Miles, Lane 8 and Nora En Pure, this track is for you. ━━━━━━━━━━━━━━ 🎵 Artist: Groove Limits 🎧 Track: Gravity 🎼 Genre: Emotional Melodic Deep House 🎤 Vocals: Male &amp; Female 📅 Released: 2026 ━━━━━━━━━━━━━━ 🔥 If you enjoyed this track: 👍 Like this video 💬 Leave a comment 🔔 Subscribe for weekly Deep House releases ━━━━━━━━━━━━━━ 🎧 Listen to more Groove Limits: 💜 Emotional Melodic Deep House https://www.youtube.com/@GrooveLimits ━━━━━━━━━━━━━━ Thank you for supporting independent music. Every listen, like and comment helps Groove Limits continue creating emotional Deep House experiences. See you in the next journey. 💜 #gravity #groovelimits #deephouse #melodicdeephouse #emotionaldeephouse #vocaldeephouse #malevocals #femalevocals #malefemaleduet #progressivehouse #housemusic #electronicmusic #deephouse2026 #newdeephouse #nightdrivemusic #drivingmusic #cyberpunkmusic #neoncity #dreamwave #synthwavevibes #melodictechno #anyma #benbohmer #tinlicker #camelphat #artbat #massano #robertmiles #lane8 #noraenpure #relaxingmusic #nocopyrightmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394844/3394844_720p.mp4</video:content_loc>
      <video:duration>204</video:duration>
      <video:publication_date>2026-09-01T21:32:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_627.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_627.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394843/3394843_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:32:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_626.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_626.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394842/3394842_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:32:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O cientista estava numa entrevista com uma policial quando de repente algo de ruim aconteceu com ele</video:title>
      <video:description>O cientista estava numa entrevista com uma policial quando de repente algo de ruim aconteceu com ele 🎭🎬🍿 Os melhores filmes só aqui na febspot #Filmesdeterrorfilmesfilmesdesuspensesóosmelhoresfilmes</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394841/3394841_720p.mp4</video:content_loc>
      <video:duration>103</video:duration>
      <video:publication_date>2026-09-01T21:32:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pop star dog</video:title>
      <video:description>Dog Sing #Music</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394840/3394840_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:32:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jogue e ganhe</video:title>
      <video:description>2 melhores veja !</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394839/3394839_720p.mp4</video:content_loc>
      <video:duration>317</video:duration>
      <video:publication_date>2026-09-01T21:32:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND WHITE COLOR AND PINK</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394838/3394838_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:32:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_625.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_625.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394837/3394837_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:32:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dance 641</video:title>
      <video:description>#Dance #Worldwide</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394836/3394836_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T21:31:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_624.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_624.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394835/3394835_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:31:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TOP DE MAIS ESSE SERVIDOR</video:title>
      <video:description>SIMBORA CONHECER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394834/3394834_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T21:31:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thousand Blue Butterflies in a Misty Purple Valley</video:title>
      <video:description>Long Description for YouTube / Facebook: Step into a dreamlike fantasy valley where thousands of vibrant blue and violet Morpho butterflies dance above a field of purple wildflowers. Misty mountains, foggy pine forests, and soft morning light create a magical, healing, and surreal atmosphere. This is pure fantasy nature at its most peaceful - a moment of freedom, rebirth, and tranquility. Perfect for relaxation, meditation, fantasy backgrounds, and aesthetic edits. If this brought you peace, save &amp; share. #bluebutterflies #morphobutterfly #purplebutterflies #butterflyswarm #mistyvalley #foggymountains #fantasynature #magicalforest #purplewildflowers #flowerfield #dreamynature #enchantedvalley #butterflymigration #ethereallandscape #pineforestfog</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394833/3394833_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T21:31:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shadows Between Us 🌌 Emotional Melodic Deep House | No Copyright Music | Groove Limits</video:title>
      <video:description>🌌 Shadows Between Us is an emotional Melodic Deep House journey featuring powerful male and female vocals, cinematic synths, deep basslines and an unforgettable atmosphere. Built to capture your attention within the first seconds, this track combines emotional storytelling, atmospheric melodies and a powerful drop that will stay with you long after the music ends. Whether you&apos;re driving at night, studying, relaxing or simply escaping into the music, this is your soundtrack. 🎧 If you enjoy Emotional Deep House, Melodic House and Original Vocal Tracks, subscribe to Groove Limits for new releases every week. ━━━━━━━━━━━━━━━━━━━━━━ 🎵 Artist: Groove Limits 🎼 Track: Shadows Between Us 🎤 Vocals: Male &amp; Female 🎧 Genre: Emotional Melodic Deep House 📀 Original Production 📺 No Copyright Music ━━━━━━━━━━━━━━━━━━━━━━ 💜 If you enjoyed this track: 👍 Leave a Like 💬 Tell us your favorite moment 🔔 Subscribe for more original Deep House music #shadowsbetweenus #groovelimits #deephouse #melodicdeephouse #emotionaldeephouse #melodichouse #futurehouse #housemusic #nocopyrightmusic #ncs #vocalhouse #malevocals #femalevocals #originalvocaltrack #electronicmusic #edm #nightdrivemusic #drivingmusic #studymusic #relaxmusic #clubmusic #dancemusic #cyberpunkhouse #summervibes #newmusic2026 #deephousemix #emotionalmusic #royaltyfreemusic #originalmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394832/3394832_720p.mp4</video:content_loc>
      <video:duration>210</video:duration>
      <video:publication_date>2026-09-01T21:31:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND WHITE COLOR AND ORANGE</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394831/3394831_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:31:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e O Inferno É Nós PARTE =_623.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e O Inferno É Nós PARTE =_623.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394830/3394830_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:31:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, Jesus nosso salvador.</video:title>
      <video:description>LOUVOR gospel #Louvor #gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394829/3394829_720p.mp4</video:content_loc>
      <video:duration>328</video:duration>
      <video:publication_date>2026-09-01T21:31:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Linda 6</video:title>
      <video:description>A bonitona chegando no escritório #Linda #bonita #escritório #chegada #dia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394828/3394828_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T21:31:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>আমার নতুন নতুন ভিডিও পেতে সাবসক্রাইবার কর</video:title>
      <video:description>vairal video new #Vairal #new #videotopnew</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394827/3394827_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T21:31:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e O Inferno É Nós PARTE =_622.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e O Inferno É Nós PARTE =_622.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394826/3394826_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:31:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND RED COLOR AND WHITE</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394825/3394825_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:31:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>app sampo pagando</video:title>
      <video:description>com prova de pagamento</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394824/3394824_720p.mp4</video:content_loc>
      <video:duration>397</video:duration>
      <video:publication_date>2026-09-01T21:30:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_621.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_621.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394823/3394823_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:30:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_620.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_620.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394822/3394822_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:30:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bay (2026) Hindi Dubbed</video:title>
      <video:description>The Bay (2026) Hindi Dubbed Best friends Emma and Lani, attending a destination wedding in Thailand, find themselves trapped on a sinking tour boat in the heart of a tiger shark sanctuary. Genre: Drama, Dual Audio, Hollywood Dubbed, Horror, Thriller Director: Phil Volken Actors: Alexander Wraith, Calan Scherer, Dani Oliveros, Destiny Benner, Francesca Eastwood, Ta&apos;imua Country: United States Duration: 152 min Quality: HINDI Release: 2026 IMDb: 5.6 #TheBay2026 #HindiDubbed #Drama #DualAudio #HollywoodDubbed #Horror #Thriller</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394821/3394821_720p.mp4</video:content_loc>
      <video:duration>5177</video:duration>
      <video:publication_date>2026-09-01T21:30:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_619.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_619.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394820/3394820_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:30:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND RED AND BLACK COLOR</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394819/3394819_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:29:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_618.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_618.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394818/3394818_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:29:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bean-Inspired Laundry Disaster 😂 | Funniest 3D Cartoon Comedy | ToonVerse</video:title>
      <video:description>Bean-Inspired Laundry Disaster 😂 | Funniest 3D Cartoon Comedy | ToonVerse A simple laundry day turns into a hilarious spinning disaster! 😂 Watch the Bean-inspired character face an unexpected teddy-bear surprise in this family-friendly 3D cartoon.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394817/3394817_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:29:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>top 2 pagando</video:title>
      <video:description>jogando e ganhando #appsmaster</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394816/3394816_720p.mp4</video:content_loc>
      <video:duration>317</video:duration>
      <video:publication_date>2026-09-01T21:29:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_617.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_617.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394815/3394815_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:29:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu.mano jj olhando plano b</video:title>
      <video:description>Tá maluco plano b desse tô fora volto pra casa sozinho msmo #Planob</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394814/3394814_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T21:29:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND GREEN COLOR AND YELLOW</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394813/3394813_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:29:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_616.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_616.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394812/3394812_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:29:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tale of the nine Tailed S01 EP02 Hindi Dubbed Full Episode 720p</video:title>
      <video:description>Play this Episode in Playit video player for perfect voice #Kdrama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394811/3394811_720p.mp4</video:content_loc>
      <video:duration>4203</video:duration>
      <video:publication_date>2026-09-01T21:29:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND GREEN COLOR AND PINK</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394810/3394810_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:29:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_615.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_615.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394809/3394809_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:28:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diário de Anne Frank  por Anne Frank - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Você conhece a verdadeira história de Anne Frank? Neste vídeo, descubra como uma adolescente judia viveu escondida em um anexo secreto durante a Segunda Guerra Mundial enquanto o Holocausto destruía milhões de vidas. O Diário de Anne Frank Vai Partir Seu Coração | História Real Conheça os acontecimentos que inspiraram O Diário de Anne Frank, um dos livros mais emocionantes da história. Prepare-se para uma narrativa cheia de mistério, emoção, esperança e revelações sobre a ocupação nazista, o confinamento, a perseguição aos judeus e o legado eterno de Anne Frank. Assista até o final, deixe seu like, inscreva-se no canal, ative o sininho e compartilhe esta história inesquecível. Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #annefrank #diário #segundaguerramundial #holocausto #ODiáriodeAnneFrank #nazista #judeus</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394808/3394808_720p.mp4</video:content_loc>
      <video:duration>310</video:duration>
      <video:publication_date>2026-09-01T21:28:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_614.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_614.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394807/3394807_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:28:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND CYAN COLOR AND PINK</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394806/3394806_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:28:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_613.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_613.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394805/3394805_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:28:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e O Inferno É Nós PARTE =_612.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e O Inferno É Nós PARTE =_612.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394804/3394804_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:28:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND BLUE COLOR AND RED</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394803/3394803_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:27:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Girl 159</video:title>
      <video:description>Hot Look</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394802/3394802_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:27:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>| Funny Cats Cartoon Video 😹🐱 | Cute Cat Comedy</video:title>
      <video:description>When One Cat Starts Laughing 😂 All The Cats Can&apos;t Stop Laughing | Funny Cats Cartoon Video 😹🐱 | Cute Cat Comedy Get ready to laugh with this super cute and funny cartoon cat video! 😹🐱 A group of adorable cats is enjoying a beautiful garden when a funny moment between the orange cat and white cat turns into a hilarious reaction from everyone. The expressions of these cute cartoon cats make this short video even more entertaining. From funny faces to laughing reactions, every moment is made for cat lovers and fans of funny animated videos. 😂❤️ If you love funny cats, cute animals, cartoon comedy, funny reactions and entertaining shorts, you will definitely enjoy this video. Watch until the end because the final reaction is the funniest part! 😹🤣 Don&apos;t forget to Like 👍, Comment 💬 and Subscribe 🔔 for more funny cartoon animal videos, cute cat stories and entertaining Shorts. Share this video with someone who loves cats and funny videos! 🐱❤️ #FunnyCatsCuteCatsCatComedyFunnyCatVideoCatsCatLoversCuteAnimalsFunnyAnimalsCartoonCatsCatShortsFunnyShortsYouTubeShortsShortsViralShortsTrendingShortsFunnyVideoCuteVideoAnimalComedyAnimationViralVideo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394801/3394801_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:27:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Hulk became Hulk</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394800/3394800_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T21:27:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_611.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_611.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394799/3394799_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:27:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>( DESASTRE Avalanche de lama causa destruição no Nepal 2026 )</video:title>
      <video:description>Uma avalanche na região do Himalaia, na fronteira entre o Nepal e o Tibete, arrastou gelo, rochas e lama e bloqueou um rio. Após a barreira ceder, uma enxurrada atingiu vilarejos e deixou mortos e desaparecidos. #NepaleTibete</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394798/3394798_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T21:27:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_610.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_610.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394797/3394797_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:27:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🦋✨ Magical Pink Butterflies in a Dreamy Fantasy World</video:title>
      <video:description>A magical world filled with glowing pink butterflies, sparkling lights, and dreamy fantasy vibes. 🦋💖✨ Let the beauty and magic take you away! 🌸💫 #pinkbutterflies #magicalbutterflies #fantasyart #dreamyvideo #glowingbutterflies #fairyworld #magicalgarden #beautifulnature #fantasy #butterflylovers</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394796/3394796_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T21:27:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394795</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394795/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Tiktoker 63</video:title>
      <video:description>Hira fasial</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394795/3394795_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T21:27:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Controle Ultimate e O Inferno É Nós PARTE =_609.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Controle Ultimate e O Inferno É Nós PARTE =_609.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394794/3394794_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:27:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND BLUE COLOR AND PINK</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394792/3394792_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:27:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_608.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_608.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394791/3394791_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:26:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND BLUE COLOR AND GREEN</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394790/3394790_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:26:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_607.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_607.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394789/3394789_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:26:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angel 🤍👀🔥</video:title>
      <video:description>#Angel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394788/3394788_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:26:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_606.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_606.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394787/3394787_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:26:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rare moments in football: Part 1</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394786/3394786_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T21:26:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND BLUE  COLOR AND YELLOW</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394785/3394785_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:26:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O espadachim chegou matando todo mundo nesse corredor 😱</video:title>
      <video:description>O espadachim chegou matando todo mundo nesse corredor 😱 #Filmestopfilmefilmesdeaçãofilmesdesuspense</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394784/3394784_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T21:26:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394781</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394781/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Psaume 23</video:title>
      <video:description>L&apos;éternel est mon berger je ne manquerai de rien #Fait #confiance #à #Dieu</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394781/3394781_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-09-01T21:25:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394780</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394780/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>STF de escândalo e vergonha</video:title>
      <video:description>Senador calos Viana pede,ipitima de Alexandre de Moraes #Brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394780/3394780_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T21:25:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e O Inferno É Nós PARTE =_605.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e O Inferno É Nós PARTE =_605.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394779/3394779_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:25:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oops 😁 2</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394778/3394778_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T21:25:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Simpatias espirituais</video:title>
      <video:description>Simpatia espirituais e trabalhos de magia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394777/3394777_720p.mp4</video:content_loc>
      <video:duration>146</video:duration>
      <video:publication_date>2026-09-01T21:25:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_604.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_604.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394776/3394776_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:25:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND BLACK AND WHITE</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394775/3394775_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:25:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>vaquinha manda</video:title>
      <video:description>cuidando com amor! #lidadaroça</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394774/3394774_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-01T21:25:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chuva 2</video:title>
      <video:description>Chuveu granizo em Canela #Chuva #granizo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394773/3394773_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:25:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Confissão</video:title>
      <video:description>Uma história que começa de forma simples, mas termina com uma confissão que pode mudar tudo. 😨 Assista até o final para descobrir o que realmente aconteceu. #confissão</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394772/3394772_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-01T21:25:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394771</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394771/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_603.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_603.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394771/3394771_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:25:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY BLEND  BROWN  COLOR AND YELLOW</video:title>
      <video:description>BABY BLEND COLORS, HAVING FUN, LEARNING, PLAYING AND SMILING #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394770/3394770_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:25:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_602.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_602.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394769/3394769_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:24:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deus cuida de você</video:title>
      <video:description>#Deus #Vida #Gratidão</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394768/3394768_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T21:24:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>⚡ LOVE &amp; THUNDER | Powerful 80s Hard Rock Anthem 🔥</video:title>
      <video:description>Turn up the volume! “Love &amp; Thunder” is an explosive 80s-inspired Hard Rock anthem featuring powerful female vocals, screaming electric guitars, massive choruses and a blazing guitar solo. Neon lights, wild hearts and pure arena rock energy come together in this high-energy rock track inspired by the golden era of 80s Hard Rock and Glam Rock. 🎸 Hard Rock / Glam Rock / Arena Rock 🎤 Powerful Female Vocals ⚡ 80s-Inspired Rock 🔥 Massive Guitar Solo All music created using Suno. Video made in: https://vizzy.io Project by: • Mister Maiden • shiro. LYRICS: [Intro] Midnight streets and a neon sky Engines screaming while the sparks fly high [Verse 1] Leather hearts and electric eyes We were born to burn, never compromise Your shadow moved through the pouring rain Like a wildfire running through my veins [Pre-Chorus] Feel the heat, feel the danger rise Like a storm crashing through the night [Chorus] Love &amp; Thunder Wild hearts under fire Love &amp; Thunder Taking us higher and higher Screaming guitars, neon desire Love &amp; Thunder tonight [Verse 2] Backstage smoke and the crowd alive Hands in the air while the amplifiers cry You pull me close through the chaos and lights Like a loaded anthem ready to ignite [Pre-Chorus] We don’t run, we don’t slow down We shake the walls of every town [Chorus] Love &amp; Thunder Wild hearts under fire Love &amp; Thunder Taking us higher and higher Screaming guitars, neon desire Love &amp; Thunder tonight [Guitar Solo] [Bridge] Flashing lights on the boulevard Young forever, living too hard Every heartbeat, every sound Turns to legend when the sun goes down [Final Chorus] Love &amp; Thunder Raise your fists higher Love &amp; Thunder Set the whole world on fire Massive vocals, six-string desire Love &amp; Thunder tonight #hardrock #80shardrock #80srock #glamrock #arenarock #roc</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394767/3394767_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-09-01T21:24:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_601.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_601.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394766/3394766_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:24:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>when there&apos;s a motorcyclist playing on your team</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394765/3394765_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:24:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Foto Live Core #fotive #coreid #warga62 #wargaindo #random #fyp #viral #fypシ゚viral 2</video:title>
      <video:description>Foto Live Core #fotive #coreid #warga62 #wargaindo #random #fyp #viral #fypシ゚viral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394764/3394764_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T21:24:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hati-Hati Kalau Ikan Ini Muncul! 😱🐟</video:title>
      <video:description>Pernah melihat ikan yang tiba-tiba muncul ke permukaan laut? Jangan buru-buru dianggap sebagai pemandangan biasa. 🌊👀 Ikan yang satu ini punya penampilan yang bikin penasaran, apalagi kalau kemunculannya terjadi di dekat permukaan. Bentuknya saja sudah cukup bikin orang bertanya-tanya, sebenarnya ikan apa ini dan kenapa jarang terlihat? 😳 Banyak orang langsung mengaitkannya dengan berbagai pertanda, padahal laut memang penuh kejutan yang belum tentu bisa kita tebak. Yang jelas, kalau melihat sesuatu yang tidak biasa di laut, lebih baik tetap jaga jarak dan jangan sok berani cuma demi konten. 😂📱 Tonton sampai habis videonya, kamu bakal tahu ikan apa yang dimaksud! 🐟🔥</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394763/3394763_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T21:24:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One day I’ll be a millionaire</video:title>
      <video:description>Dream Life | Luxury #luxury #lifestyle #life #money #millionaire</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394762/3394762_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:23:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, A Travessia.</video:title>
      <video:description>Louvorgospel, #Louvou #gospel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394761/3394761_720p.mp4</video:content_loc>
      <video:duration>282</video:duration>
      <video:publication_date>2026-09-01T21:23:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of Duty: Warzone MW4 Beta</video:title>
      <video:description>Gameplay de Call of Duty: Warzone MW4 Beta, com foco em combates de longa distância e muitos momentos usando sniper. Uma partida completa, sem comentários, mostrando a gameplay de forma direta e imersiva. 🎮 Warzone MW4 Beta 🎯 Sniper Gameplay 🔇 No Commentary Se curtir a gameplay, deixe o like e inscreva-se no canal para acompanhar os próximos vídeos! 💬 Entre no Discord do TKzin2: Discord TKzin2 #CallofDuty #CallofDutyWarzone #Warzone #WarzoneMW4 #MW4Beta #CallofDutyMW4Beta #WarzoneMW4Beta #WarzoneRessurgência #RessurgênciaWarzone #Warzonegameplay #Warzoneportuguês #WarzoneBrasil #CODWarzone #CODMW4 #MW4gameplay #CallofDutygameplay #Warzonenovomapa #novoWarzone #WarzoneBeta #MW4Betagameplay #gameplayWarzoneBrasil #Warzoneranked #WarzoneResurgence #ResurgenceWarzone #CallofDutyBeta</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394760/3394760_720p.mp4</video:content_loc>
      <video:duration>449</video:duration>
      <video:publication_date>2026-09-01T21:23:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disseram que eu não iria conseguir</video:title>
      <video:description>#louvorfayadoraçãocristã</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394759/3394759_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T21:23:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Detik detik Buffon muda menantang Ronaldo Nazario terang terangan! 2</video:title>
      <video:description>Detik detik Buffon muda menantang Ronaldo Nazario terang terangan!</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394758/3394758_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T21:23:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Strings Unlock Destiny 👑🎻🔥 | Violin x Heavy Metal Instrumental</video:title>
      <video:description>A powerful fusion of emotional violin melodies and crushing heavy metal energy. 🎻🔥 Feel the strings unlock a destiny filled with intensity, epic riffs, and unstoppable momentum. 👑 #ViolinMetalHeavyMetalEpicInstrumentalViolinMusicMetalMusicEpicMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394757/3394757_720p.mp4</video:content_loc>
      <video:duration>583</video:duration>
      <video:publication_date>2026-09-01T21:23:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mercado</video:title>
      <video:description>#Mercadopago</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394756/3394756_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T21:22:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele humilha ela por causa da gravidez</video:title>
      <video:description>Ele humilha ela por causa da gravidez #dorama #kdrama #séries #filmes #Netflix</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394755/3394755_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-09-01T21:22:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro no treino x Touro em casa! Bull in training vs. Bull at home.</video:title>
      <video:description>Touro no treino x Touro em casa! Bull in training vs. Bull at home.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394754/3394754_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:22:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING Miniature_bridge_collapsing</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394753/3394753_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:22:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criar carro</video:title>
      <video:description>Ia#carro#montagem#</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394752/3394752_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:22:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatinhos fofos 2</video:title>
      <video:description>#Cat #gatos #gatinhos #amogatos #felinos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394751/3394751_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-01T21:21:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>if linda gypsy dancing🔥🔥🔥💃💃💃💃</video:title>
      <video:description>liked my content? follow me, comment and share!!!! 💃💃💃💃💃💃💃💃💃💃💃💃💃💃💃💃💃💃💃🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥 #EstadosUnidos #paris #frança #Espanha #Argentina #Colômbia #Inglaterra #China #Brasil #Japão #Dinamarca</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394750/3394750_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:21:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachoeira 4</video:title>
      <video:description>Dia de cachoeiro... #Lilica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394749/3394749_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:20:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Seaside City Hurricane Effects</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394748/3394748_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Bispo: A História Revelada de Edir Macedo - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ A vida de Edir Macedo, fundador da Igreja Universal do Reino de Deus, é marcada por fé, polêmica e determinação. Nesta biografia, exploramos sua trajetória desde a infância simples até se tornar um dos líderes religiosos mais influentes do Brasil. Conheça sua visão sobre religião, sua história com a TV Record e como construiu um império baseado em fé e perseverança. Descubra curiosidades sobre sua vida pessoal, desafios enfrentados e o impacto de suas decisões. Um conteúdo essencial para quem busca entender religião, biografias inspiradoras e a influência da fé na sociedade. Quem é Edir Macedo? A Biografia Completa Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #edirmarce #biografia #resenha #livro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394747/3394747_720p.mp4</video:content_loc>
      <video:duration>397</video:duration>
      <video:publication_date>2026-09-01T21:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Mountain Village Buried By Avalanche</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394746/3394746_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:20:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Força aeria</video:title>
      <video:description>Mensagem de deus #Deus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394745/3394745_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:20:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Mountain Village Avalanche Sequence</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394744/3394744_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:19:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zumba da Cicih</video:title>
      <video:description>#Fitness #zumba #danca</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394743/3394743_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T21:19:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BEM-AVENTURADOS-GIULIA DIULIA</video:title>
      <video:description>musica gospel de alta qualidade #musica #gospel #song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394742/3394742_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-01T21:19:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Julia</video:title>
      <video:description>Conhecendo o mundo #Viagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394741/3394741_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T21:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Before the Dinosaurs, Giants Existed: The World of the Carboniferous Revealed</video:title>
      <video:description>Before the Dinosaurs, Giants Existed: The World of the Carboniferous Revealed #BeforetheDinosaurs #GiantsExistedTheWorldoftheCarboniferousRevealed</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394740/3394740_720p.mp4</video:content_loc>
      <video:duration>436</video:duration>
      <video:publication_date>2026-09-01T21:19:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Hills remix the weekend</video:title>
      <video:description>#Theweekend #remix #music #viral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394739/3394739_720p.mp4</video:content_loc>
      <video:duration>159</video:duration>
      <video:publication_date>2026-09-01T21:19:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Farms  Oops</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394738/3394738_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:19:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Miniature New York Tsunami Shoot</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394737/3394737_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:19:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Morro dos conventos rs</video:title>
      <video:description>🌄 Você já imaginou conhecer um lugar onde o céu encontra o mar? 😍 O Morro dos Conventos, no Rio Grande do Sul, é um cenário incrível de natureza, falésias, praia e paisagens de tirar o fôlego! 🌊⛰️ 📍 Um verdadeiro paraíso para quem ama aventura, tranquilidade e belas paisagens. 🔥 Você teria coragem de visitar esse lugar? Comente! #Morro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394736/3394736_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T21:18:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O desemprego</video:title>
      <video:description>Oh</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394735/3394735_720p.mp4</video:content_loc>
      <video:duration>277</video:duration>
      <video:publication_date>2026-09-01T21:18:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Te amo 4</video:title>
      <video:description>Canción de amor para esa persona que ama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394734/3394734_720p.mp4</video:content_loc>
      <video:duration>215</video:duration>
      <video:publication_date>2026-09-01T21:18:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Visual 7meter</video:title>
      <video:description>Rekaman Visual Memanjakan Mata dari seorang gadis menawan yang menebar pesona elegan lewat ekspresi tenang dan sentuhan lembut pada rambutnya saat berada di dalam mobil. #Febspot #FunVideos #FunnyClips #Entertainment #ShortClips</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394733/3394733_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T21:18:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tale of the nine Tailed S01 EP01 Hindi Dubbed Full Episode 720p</video:title>
      <video:description>Play this Episode in Playit video player for perfect voice #KDrama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394732/3394732_720p.mp4</video:content_loc>
      <video:duration>3924</video:duration>
      <video:publication_date>2026-09-01T21:18:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>earned It the weekend remix</video:title>
      <video:description>#Music #remix #thewekeend #viral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394731/3394731_720p.mp4</video:content_loc>
      <video:duration>318</video:duration>
      <video:publication_date>2026-09-01T21:18:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kids Vs Goats</video:title>
      <video:description>#kids #goat #funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394730/3394730_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-01T21:18:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele so queria tomar água</video:title>
      <video:description>Nunca julgue ninguém</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394729/3394729_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-01T21:17:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JACOB WRESTLING WITH THE ANGEL And Jacob was left alone;</video:title>
      <video:description>JACOB WRESTLING WITH THE ANGEL And Jacob was left alone; and there wrestled a man with him until the breaking of the day... And Jacob called the name of the place Peniel: for I have seen God face to face... (Genesis 32: 24, 30) (32:24) GIA-CỐP VẬT LỘN VỚI THIÊN SỨ Gia-cốp chỉ còn lại một mình; và có một người vật lộn với ông cho đến lúc rạng đông... Gia-cốp đặt tên nơi đó là Pê-ni-ên, vì ông nói: “Tôi đã thấy Đức Chúa Trời đối diện...” (Sáng-thế Ký 32:24, 30) #arthistory #arthistory #Grok #GrokAI #GrokImagine</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394728/3394728_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:17:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Miniature New York Tsunami Shoot 1</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394727/3394727_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:17:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ShiSei Moments From Eps 2-17</video:title>
      <video:description>ShiSei Moments From Eps 2-17v #ShiSeiMomentsFromEps2-17</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394726/3394726_720p.mp4</video:content_loc>
      <video:duration>999</video:duration>
      <video:publication_date>2026-09-01T21:17:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Landmark Destroyed By Shockwave</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394725/3394725_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:17:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tecnologia africana, invenção caseira, engenhoca, comédia,</video:title>
      <video:description>Demonstração de uma tecnologia criativa e artesanal usando uma ventoinha/motor adaptado para levar a comida diretamente à boca. Inovação e humor #TecnologiaAfricana</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394724/3394724_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T21:17:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Hurricane Tears Through Tiny City</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394722/3394722_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:16:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Principia</video:title>
      <video:description>#Cnb #principia #creme</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394721/3394721_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T21:16:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby ,kid ,ai</video:title>
      <video:description>Baby tel #Baby #kid #aí</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394720/3394720_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:16:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Downtown Tower Collapses On Cue</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394719/3394719_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:16:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milton Pinto e Tom Carvalho — The Duo That Will Make You Cry Laughing 😂</video:title>
      <video:description>😂 Get ready to laugh until you cry with Milton Pinto and Tom Carvalho, one of the funniest comedy duos around! In this hilarious collection, you&apos;ll enjoy funny jokes, unforgettable moments, and plenty of laughter from start to finish. If you love good humor and comedy that makes your day better, this video is for you! 🤣 👉 Watch until the end, share with your friends, and don&apos;t forget to LIKE 👍, SUBSCRIBE 🔔, and leave a COMMENT telling us your favorite moment! 🎭 Milton Pinto &amp; Tom Carvalho — comedy that never gets old!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394718/3394718_720p.mp4</video:content_loc>
      <video:duration>1791</video:duration>
      <video:publication_date>2026-09-01T21:15:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A INCRÍVEL REVIRAVOLTA DE SAMUEL LINO</video:title>
      <video:description>Samuel lino garantiu a classificação do flamengo contra o cruzeiro, ele que vinha sendo muito criticado a chegada ao flamengo, vive seu melhor momento com a camisa rubro negra #Flamengo #SamuelLino #Brasileirão #Futebol #Libertadores #Rubronegro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394717/3394717_720p.mp4</video:content_loc>
      <video:duration>463</video:duration>
      <video:publication_date>2026-09-01T21:15:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Evil Friends 😁</video:title>
      <video:description>#funny #friends #scare</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394716/3394716_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T21:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crime Patrol 2026 | Ajay Devgn | Episode 1 | Crime Ka Current Season</video:title>
      <video:description>Crime Patrol 2026 | Ajay Devgn | Episode 1 | Crime Ka Current Season Crime Patrol 2026 - Episode 01 - 31st August 2026 #CrimePatrol2026 #-Episode01 #31stAugust2026</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394715/3394715_720p.mp4</video:content_loc>
      <video:duration>2634</video:duration>
      <video:publication_date>2026-09-01T21:15:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Dam Bursts Across Miniature Valley</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394714/3394714_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:15:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Polyglot Journalist Reports the News FLUENTLY in 6 Languages</video:title>
      <video:description>Watch journalist Philip Crowther report on the Tokyo 2020 Olympics, seamlessly switching between 6 different languages: Luxembourgish, German, Spanish, Portuguese, French, and English. He demonstrates incredible linguistic skill while reporting for international news outlets around the globe. #languages #polyglot #multilingual #duolingo #babbel #busuu</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394713/3394713_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T21:15:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🥛Esse Jogo De Copo Perfeito Para Servir Água,Sucos, refrigerante, chás gelados e coquetéis com Elegâ</video:title>
      <video:description>Se você procura elegância, modernidade e alta qualidade para servir suas bebidas,o jogo com 6 copos é a escolha perfeita.Com um design clássico e a exclusiva cor cinza fumê,este conjunto trás um toque de requinte Premium para almoço em família, jantares formaliz ou para o uso diário com elegância 😍❤️ #copoarubanadir #jogodecoposvidrofumê #copocinzafumê475ml #conjuntodecopospremium #coponadirfigueiredo #copograndeparasucoeágua #mesapostamoderna #jogodecoposdevidrocinza #coposarubafumê #jogodecoposnadirpremium #copospararecebervisitas #utilidadesdomésticasluxo #jogodecoposatacado #jogodecoposparapresente</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394712/3394712_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T21:15:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Echoes In Echo</video:title>
      <video:description>#Lyric Video #Trend</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394711/3394711_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T21:14:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Container Port Storm Simulation</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394710/3394710_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:14:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394709</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394709/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sensasi 7meter</video:title>
      <video:description>Jangan sampai terlewatkan sensasi kombo tanpa putus dalam tayangan gameplay kasual mencocokkan balok mahjong ini, dari ketukan pertama hingga mencapai puncak kepuasan visual berupa ledakan kombo beruntun yang super meriah di akhir permainan. #Febspot #GamingLifeGamer #Gameplay #MobileGaming</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394709/3394709_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T21:14:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fails with Cars.</video:title>
      <video:description>#cars #car #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394708/3394708_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T21:14:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Veja o que acontece nessa cena!!!!!</video:title>
      <video:description>grandes cenas de filmes impactantes #filmes #pctures #films</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394707/3394707_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:14:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394706</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394706/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, GÉNESIS.</video:title>
      <video:description>Louvor gospel. #Louvorgospel #Brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394706/3394706_720p.mp4</video:content_loc>
      <video:duration>258</video:duration>
      <video:publication_date>2026-09-01T21:13:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dangdut 69</video:title>
      <video:description>dangdut</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394705/3394705_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T21:13:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O TEMPO É DANADO!</video:title>
      <video:description>Um Vaneirão de Bailão divertido, para os Guris de 60+, sobre como é envelhecer, mas com alegria e disposição. Afinal, rir da vida é a melhor forma de envelhecer! #vaneirão #bailão #humor #músicagaucha #envelhecer #melhoridade #alegria #bonstempos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394704/3394704_720p.mp4</video:content_loc>
      <video:duration>243</video:duration>
      <video:publication_date>2026-09-01T21:13:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Praia de Copacabana</video:title>
      <video:description>Menino distraído na praia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394703/3394703_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T21:13:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prank from Indonesia</video:title>
      <video:description>#prank #fynny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394702/3394702_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T21:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quando ele chega n tem jeito todo mundo correr</video:title>
      <video:description>Dos cachaceiros kkkkkk #Cachaceiro</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394701/3394701_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:13:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I AM NOT MY THOUGHTS 🖤 | Emotional Future Bass | Fukkatsu Beats</video:title>
      <video:description>“I AM NOT MY THOUGHTS” is an emotional Future Bass / EDM track about overthinking, fear, self-doubt, exhaustion, and the silent battles happening inside our minds. The song begins in darkness and slowly transforms into strength and hope — reminding us that our thoughts do not define who we are. If you listen until the end, you&apos;ll understand why the song stops saying “I” and starts saying “WE.” Because maybe healing begins when we realize we&apos;re not fighting alone. 🖤 🎧 Listen to Fukkatsu Beats on Spotify: https://open.spotify.com/intl-pt/artist/2zDErqBCHugmudr0dpj0n7 Music by Fukkatsu Beats. #FukkatsuBeats #IAmNotMyThoughts #FutureBass #EmotionalEDM #EDM #HealingMusic #Overthinking</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394700/3394700_720p.mp4</video:content_loc>
      <video:duration>238</video:duration>
      <video:publication_date>2026-09-01T21:13:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Bridge Collapse Practical Effects Setup 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394699/3394699_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:12:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CIUMENTA</video:title>
      <video:description>#música #show #canções #sucesso #viral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394698/3394698_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-09-01T21:12:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Bridge Collapse Practical Effects Setup 1</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394697/3394697_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:12:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SPIDERMAN: NO WAY HOME | PART 14</video:title>
      <video:description>Subscribes, Like, and, Share #avengers #infinitywar #ironman #hulk #captainamerica #loki #thor #spiderman #film #american #viral #trends #trending #trend #spidermannowayhome</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394696/3394696_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:12:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 558</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ON THE BEACH MIAMI PART 558 #HOST #AMERIKA #BEAUTIFUL #SEXY #BEACH #MIAMI #PART558</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394695/3394695_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T21:12:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dumb ways to die</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394694/3394694_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:12:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Forest fires are sweeping across Indonesia.</video:title>
      <video:description>In this video, the forest is burning, and the orangutans are confused about where to live. Please donate to help us replant trees; donations can be made via the link below. https://paypal.me/akiharyy https://paypal.me/akiharyy https://paypal.me/akiharyy https://paypal.me/akiharyy #ForestfiresaresweepingacrossIndonesia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394692/3394692_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T21:11:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Amazon Flood Practical Effects</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394691/3394691_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:11:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dancing 83</video:title>
      <video:description>dancing</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394690/3394690_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:11:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smart Girl 2</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394689/3394689_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:11:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Airport Runway Disaster Effects Test</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394688/3394688_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>plenger banget</video:title>
      <video:description>kucing</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394687/3394687_720p.mp4</video:content_loc>
      <video:duration>103</video:duration>
      <video:publication_date>2026-09-01T21:10:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMAKING MINIATURE TSUNAMI WAVE</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394685/3394685_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:10:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vestido Longo Feminino</video:title>
      <video:description>O vídeo é sobre um vestido de festa, Aniversário ou para ir a igreja</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394684/3394684_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T21:10:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SPIDERMAN: NO WAY HOME (PART 13)</video:title>
      <video:description>Subscribes, Like, and, Share #avengers #infinitywar #ironman #hulk #captainamerica #loki #thor #spiderman #film #american #viral #trends #trending #trend #spidermannowayhome</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394683/3394683_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:09:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMAKING MINIATURE FLOOD SET</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394682/3394682_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:09:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOST AMERIKA SEXY PART 557</video:title>
      <video:description>HOST AMERIKA SERIKAT BEAUTIFUL SEXY ON THE BEACH HAWAII PART 557 #HOST #AMERIKA #BEAUTIFUL #SEXY #BEACH #HAWAIIPART557</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394681/3394681_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T21:09:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro Primitivo, cia de rodeio Marcondes Maia!!  Primitivo the bull – Marcondes Maia Rodeo Company</video:title>
      <video:description>Touro Primitivo, cia de rodeio Marcondes Maia!! Primitivo the bull – Marcondes Maia Rodeo Company</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394680/3394680_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T21:09:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌎 The Environment Guardians 🛡️</video:title>
      <video:description>🚀 Mission of the day: Save Planet Earth! 🌍 Sing and dance along with the Guardians! Did you know that small actions can change the whole wide world? 🌱 Comment with your favorite green emoji! 👇💚🌿🥦 #Cantatoon #KidsMusic #SaveThePlanet #GreenKids #Superheroes #Animation #LearnEnglish #Cantatoon #KidsMusic #SaveThePlanet #GreenKids #Superheroes #Animation #LearnEnglish</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394679/3394679_720p.mp4</video:content_loc>
      <video:duration>198</video:duration>
      <video:publication_date>2026-09-01T21:09:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tudo  começou assim....</video:title>
      <video:description>Contrução nao é fácil, tudo começou assim. Veja como foi e ja deixe like.... #Construção #construtores #obra #pedreiro #construindoumsonho #construction</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394678/3394678_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:08:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Druns animation</video:title>
      <video:description>Levada de bateria #Bateriaévida</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394677/3394677_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:08:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wandinha 3</video:title>
      <video:description>Enid #Wandinha</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394676/3394676_720p.mp4</video:content_loc>
      <video:duration>129</video:duration>
      <video:publication_date>2026-09-01T21:08:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Laranjinha chegou em casa</video:title>
      <video:description>Depois da queda laranjinha voltou pra casa #Brasi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394675/3394675_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T21:08:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SPIDERMAN: NO WAY HOME (PART 12)</video:title>
      <video:description>Subscribes, Like, and, Share #avengers #infinitywar #ironman #hulk #captainamerica #loki #thor #spiderman #film #american #viral #trends #trending #trend #spidermannowayhome</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394673/3394673_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:08:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vida selvagem</video:title>
      <video:description>Vida selvagem na natureza. #Ave #natureza #animal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394672/3394672_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T21:08:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMAKING MINIATURE DUBAY SKY</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394671/3394671_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:08:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um dorama.</video:title>
      <video:description>Pra você passar seu tempo. #Entretenimento #diversão #comedia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394670/3394670_720p.mp4</video:content_loc>
      <video:duration>1768</video:duration>
      <video:publication_date>2026-09-01T21:07:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon ball 14</video:title>
      <video:description>#animedragonball</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394669/3394669_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T21:07:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JACARÉ ATACOU! Aconteceu de tudo na pescaria, MORDIDA DE PIRANHA, COBRA E+</video:title>
      <video:description>Essa foi uma das pescarias mais tensas e emocionantes que já fiz no Pantanal! Fomos até o famoso ponto Porto das Éguas e o bicho pegou. Além de pegar muita piranha e vários outros peixes pantaneiros, passamos por momentos de puro perigo: teve ataque de jacaré bem do nosso lado e, para completar, uma cobra gigante quase invadiu o nosso barco! Se você tem coragem e gosta de pescaria bruta de verdade, com muita adrenalina e natureza selvagem, já deixa o seu gostei, se inscreve no canal @eronildohungriaPescaBruta e ative o sininho! ------------------------------------------------------------------------------------------------------------------ This was one of the most intense and thrilling fishing trips I&apos;ve ever had in the Brazilian Pantanal! We headed to the famous &quot;Porto das Éguas&quot; spot, and things got wild. Besides catching tons of piranhas and various other native fish, we faced moments of pure danger: a caiman attacked right next to us, and to top it off, a snake almost invaded our boat!If you love raw, extreme fishing adventures packed with adrenaline and wild nature, make sure to leave a like, subscribe to the channel, and turn on notifications! #pantanal #pescaria #pescabruta #ataquedejacare #cobranobarco #piranha #fishing #fyp #fish #pesca #pescaesportiva #pescador #pescadores #pescando #pescar #pescadeportiva #pescado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394668/3394668_720p.mp4</video:content_loc>
      <video:duration>1592</video:duration>
      <video:publication_date>2026-09-01T21:06:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como permalukan tuan rumah Napoli 2-1 di Stadion Diego Armando Maradona lewat gol Baturina dan Douvi</video:title>
      <video:description>Fakta Menarik Pertandingan Baturina Jadi Man of the Match: Gelandang muda Como, Martin Baturina, menjadi bintang lapangan utama dengan kontribusi krusial berupa 1 gol dan 1 assist untuk gol kemenangan yang dicetak Anastasios Douvikas. Drama VAR Menit Akhir: Napoli sejatinya nyaris memaksakan hasil imbang lewat gol Stanislav Lobotka di masa injury time. Namun, pesta publik Naples buyar setelah VAR menganulir gol tersebut karena David Neres dianggap melakukan pelanggaran terlebih dahulu terhadap Alex Valle.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394665/3394665_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T21:05:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A tatuagem de palhaço #humor #comedia #novela #novelinha #miniserie</video:title>
      <video:description>A tatuagem de palhaço #humor #comedia #novela #novelinha #miniserie #humorcomedianovelanovelinhaminiserie</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394664/3394664_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-01T21:05:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beshak SubhanAllah Makkah Sharif Bahut hi Khubsurat Bayan🕋❤️🕋</video:title>
      <video:description>WELCOME TO MY ASADALI PARDASI MUNDA Febspot CHANNEL.YOU CAN WATCH MANY VIDEOS ON MY CHANNEL THAT YOU CAN WATCH WITH YOUR FAMILY. YOU CAN ALSO WATCH ISLAMIC VIDEOS ❤️ #viral #foryou #viralfebspot #like #Islamicvideos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394663/3394663_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T21:03:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAIU O FRITO! Piau Fresquinho na Beira do Rio</video:title>
      <video:description>Mais um dia de pescaria às margens do rio e, dessa vez, o destaque ficou por conta do almoço! 😋 Depois de garantir alguns piaus, chegou a hora de preparar aquele peixe frito crocante, feito na beira d&apos;água. Acompanhe esse momento simples, mas especial, que faz toda pescaria valer a pena! 👍 Deixe seu like, inscreva-se no canal e compartilhe com os amigos que também amam pesca e aventura! #Pescaria #PiauFrito #SaiuOFrito #PescaNoRio #VidaNaRoça #Pantanal #PeixeFrito #AventuraNaPesca #PescariaRaiz #CanalDePesca 🎣🐟🔥 #pescaria</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394661/3394661_720p.mp4</video:content_loc>
      <video:duration>1458</video:duration>
      <video:publication_date>2026-09-01T21:03:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SPIDERMAN: NO WAY HOME ( PART 11)</video:title>
      <video:description>SUBSCRIBES, LIKE, and, SHARE #avengers #spiderman #homecoming #captainamerica #hulk #ironman</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394660/3394660_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:03:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>momen 7meter</video:title>
      <video:description>Ini adalah momen tak terlupakan saat sebuah gol indah tercipta lewat lari cepat dan penguasaan bola yang apik dari tengah lapangan tanpa bisa dihentikan barisan pertahanan. #Febspot #FebspotVideo #FebspotTrending #ViralVideo #TrendingNow</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394659/3394659_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T21:03:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, REI SALOMÃO.</video:title>
      <video:description>Louvorgospel #Louvorgospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394658/3394658_720p.mp4</video:content_loc>
      <video:duration>144</video:duration>
      <video:publication_date>2026-09-01T21:03:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Application India money earning zagg app network  UPI transfer</video:title>
      <video:description>India money application farming transformer upi platform for digital marketing online payment India country application #Canada</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394657/3394657_720p.mp4</video:content_loc>
      <video:duration>397</video:duration>
      <video:publication_date>2026-09-01T21:03:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_600.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_600.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394656/3394656_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:02:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_599.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_599.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394655/3394655_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:02:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yu-Gi-Oh</video:title>
      <video:description>Yu-Gi-Oh</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394654/3394654_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-09-01T21:02:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pato Lino Hora da Refeição</video:title>
      <video:description>🦆🍽️ Patolino — Hora da Refeição! 😋 Depois de tanta diversão, chegou o momento mais esperado: a hora de comer! 🥘😂 Patolino se prepara para uma deliciosa refeição e mostra que, depois de um dia cheio, nada melhor do que sentar, comer e aproveitar esse momento. ❤️ Comida boa, tranquilidade e aquele jeitinho divertido do Patolino! #🦆🍽️Patolino—HoradaRefeição😋Depoisdetantadiversão #chegouomomentomaisesperadoahoradecomer🥘😂Patolinosepreparaparaumadeliciosarefeiçãoemostraque #depoisdeumdiacheio #nadamelhordoquesentar #comereaproveitaressemomento❤️Comidaboa #tranquilidadeeaquelejeitinhodivertidodoPatolinoPatolinoHoraDaRefeiçãoComidaMomentoDeAlegriaDesenhoDiversãoPatolinoLindoeShorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394653/3394653_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:02:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 HOUR WORKOUT MUSIC 🔥💪 | Gym Motivation &amp; Training Playlist</video:title>
      <video:description>🔥💪 1 HOUR OF WORKOUT MUSIC! A high-energy music mix to keep you motivated during your gym workout, training, cardio and exercise sessions. 🎧 60 Minutes of Music 🏋️ Gym Workout 🔥 Motivation 💪 Training ⚡ High Energy Put on your headphones, start your workout and enjoy the music! #WorkoutMusic #GymMusic #1HourWorkout #GymMotivation #WorkoutPlaylist #TrainingMusic #FitnessMusic #ExerciseMusic #WorkoutMotivation #GymPlaylist #FitnessMotivation #TrainingPlaylist #SportsMusic #RunningMusic #CardioMusic #WeightTraining #HighEnergyMusic #MotivationalMusic #60MinuteWorkout #GymTraining</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394652/3394652_720p.mp4</video:content_loc>
      <video:duration>3758</video:duration>
      <video:publication_date>2026-09-01T21:02:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_598.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_598.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394651/3394651_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:02:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tomorrow Belong To Allah</video:title>
      <video:description>We do not know tomorrow, but we know Who controls tomorrow. We do not know where we will die, but we know where we are going after death. Therefore, live today with Iman, obedience, sincere repentance, good deeds, and Tawakkul. Allah knows what we do not know. Allah controls what we cannot control. And Allah is All-Knowing, All-Aware. #Tomorrow #Iman #Death</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394650/3394650_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:01:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_597.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_597.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394649/3394649_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:01:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Poder do desejo</video:title>
      <video:description>O poder da Fan</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394648/3394648_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T21:01:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_596.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_596.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394647/3394647_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:01:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O cara tava batendo no aluno quando o professor chegou e deu um belo exemplo a esse cara 🤣</video:title>
      <video:description>O cara tava batendo no aluno quando o professor chegou e deu um belo exemplo a esse cara 🎭🎬🍿 #Brasilfilmedebullyingfilmesdeliçãofilmesdeação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394646/3394646_720p.mp4</video:content_loc>
      <video:duration>286</video:duration>
      <video:publication_date>2026-09-01T21:01:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu pequeno grande amor</video:title>
      <video:description>#OpresentemaislindoqueDeusmedeu</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394645/3394645_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T21:01:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Freddy Krueger - Dokken</video:title>
      <video:description>Freddy Krueger - Dokken #Freddy #Dokken #HardRock #Metal #Horror</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394644/3394644_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-01T21:00:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_595.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_595.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394643/3394643_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:00:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_594.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_594.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394642/3394642_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:00:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_593.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_593.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394641/3394641_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:59:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_592.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_592.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394640/3394640_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:59:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rádio hits damata fm 2</video:title>
      <video:description>Musicas notícias esportivas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394639/3394639_720p.mp4</video:content_loc>
      <video:duration>497</video:duration>
      <video:publication_date>2026-09-01T20:59:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reacher.2026.S04E02.Dual Audio.</video:title>
      <video:description>Reacher.2026.S04E02.Dual Audio. 480p. 720p. Language: English, Hindi. #Tvseries #reacher #reachers4 #tvseries2026 #tv2026 #reachers4ep2</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394638/3394638_720p.mp4</video:content_loc>
      <video:duration>2930</video:duration>
      <video:publication_date>2026-09-01T20:59:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kangala kaidhi sei</video:title>
      <video:description>Kangala kaidhi sei</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394637/3394637_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T20:59:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminhada na beira da praisa de cabo braco</video:title>
      <video:description>so relex</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394636/3394636_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T20:59:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_591.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_591.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394635/3394635_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:59:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_590.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_590.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394634/3394634_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:58:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alô Só Queria Ouvir a Sua Voz</video:title>
      <video:description>🦆🎶 Pato lino Só Queria Ouvir Sua Voz ❤️ Às vezes, tudo o que a gente precisa é ouvir aquela voz especial que traz paz ao coração. 🥹💙 Neste momento emocionante, Patolino deixa de lado toda a correria e simplesmente para para ouvir uma voz que significa muito para ele. ✨ Uma história simples, mas cheia de sentimento, carinho e emoção. #Pato lino #SóQueriaOuvirSuaVoz #Emoção #Carinho #Amizade #HistóriaEmocionante #Desenho #YouTubeShorts #PatolinoSóQueriaOuvirSuaVozEmoçãoCarinhoAmizadeHistóriaEmocionanteDesenhoYouTubeShorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394633/3394633_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hidup terlalu serius guru🤣</video:title>
      <video:description>wkwkwkwk</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394632/3394632_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T20:58:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Direção na piscina</video:title>
      <video:description>Eu adoro esse vídeo hein</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394631/3394631_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:58:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394630</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394630/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_589.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_589.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394630/3394630_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:58:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CINNAMON ROLL, COOKING ANIMATION</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394628/3394628_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:58:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lovers 12</video:title>
      <video:description>#Love #sad</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394627/3394627_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T20:58:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cada etapa da construção é show</video:title>
      <video:description>Mais etapa concluída #Construção #obra #Construindoumsonho #Construçãocivil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394626/3394626_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T20:58:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stop Chasing Him — Reclaim Your Value Now!  Smetti di Inseguirlo — Riprendi il Tuo Valore Adesso!</video:title>
      <video:description>Stop Chasing Him — Reclaim Your Value Now! Smetti di Inseguirlo — Riprendi il Tuo Valore Adesso! #StopChasingHim—ReclaimYourValueNowSmettidiInseguirlo—RiprendiilTuoValoreAdesso</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394625/3394625_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-09-01T20:57:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394624</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394624/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NEON NO AR !!🎶🔉 🔊</video:title>
      <video:description>UMA BOA MÚSICA PRA QUELES QUE PROCURAM ENERGIA NO SOM !! #musicaeletronica #melhormusicaeletronica #musicaelectronicamix #topmusicaseletronicas #melhoresmusicaeletronica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394624/3394624_720p.mp4</video:content_loc>
      <video:duration>382</video:duration>
      <video:publication_date>2026-09-01T20:57:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_588.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_588.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394623/3394623_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:57:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_587.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_587.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394621/3394621_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:57:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hoje eu me olhei no espelho</video:title>
      <video:description>Está musica parece que foi feita pra mim #DANCINHA</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394620/3394620_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-01T20:57:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sekian dan terima nasib</video:title>
      <video:description>terima nasib yakk</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394619/3394619_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T20:57:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hino do Vasco da Gama</video:title>
      <video:description>Clube de regatas Vasco da gama. Nosso site. https://radiocajaesportes.webradios.net/ #futebolradiocajaesportes</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394618/3394618_720p.mp4</video:content_loc>
      <video:duration>175</video:duration>
      <video:publication_date>2026-09-01T20:57:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_586.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_586.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394617/3394617_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:56:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_585.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_585.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394616/3394616_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:56:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😘 Pink dress ma Kaisi lag Rahi Hun comment ma batao 🫶🥰  #fyp part 2</video:title>
      <video:description>😘 Pink dress ma Kaisi lag Rahi Hun comment ma batao 🫶🥰 #fyp part 2 #India</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394615/3394615_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:56:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pinocchio | A Story About Honesty and the Power of Telling the Truth</video:title>
      <video:description>✨ Pinocchio | A Timeless Story About Honesty Join Pinocchio on an unforgettable adventure filled with friendship, courage, lessons, and magical moments. 🪵💙 Through his journey, Pinocchio learns that honesty matters, our choices have consequences, and becoming a better person takes courage and responsibility. A heartwarming story for children and families, reminding us that telling the truth and doing what is right can lead us toward a better path. ❤️ 🌟 Every mistake can teach us something — and every good choice can help us grow. #Pinocchio #Pinoquio #Pinocchiostory #Pinocchioforkids #kidsstories #childrensstories #fairytale #moralstory #bedtimestory #honestyforkids #tellingthetruth #lifelessonsforchildren #kidsanimation #animatedstory #familyfriendly #classicfairytale #magicalstory #courage #friendship #responsibility #educationalstory</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394614/3394614_720p.mp4</video:content_loc>
      <video:duration>790</video:duration>
      <video:publication_date>2026-09-01T20:56:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skate Park Serenade</video:title>
      <video:description>#Lyric Video #Trend</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394613/3394613_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T20:56:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_584.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_584.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394612/3394612_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:55:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love Upset</video:title>
      <video:description>Ju-in, a former scout for a promising baseball team, meets Gi-jeong, a high school student who dreams of becoming a professional player. While everyone else talks about Gi-jeong’s limitations, Ju-in instantly recognizes his great potential and offers him sincere advice so that he won’t give up on baseball. To Gi-jeong, Ju-in was the only person in his life who believed in him exactly as he was. “Your hands and feet are also bigger than mine. So you can grow up to be taller than me.” However, his happiness is short-lived; Ju-in resigns from his position as a scout without saying a word and disappears completely. Five years later, Ju-in returns to his former team in the new role of Power Analysis Manager, where he meets Gi-jeong again now an unrecognizable professional player. Although bewildered by Gi-jeong’s change in appearance, Ju-in finds himself repeatedly drawn to him… #BL #manhwa #recap</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394611/3394611_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T20:55:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUANDO CHICO ESTAVA APRENDENDO ANDAR NO CARRINHO</video:title>
      <video:description>CACHORRO DE FÉ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394610/3394610_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T20:55:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_583.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_583.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394609/3394609_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:55:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A nova geração de MIURAS tem pulos sobrando! Tem coragem de embarcar em uma máquina dessas?</video:title>
      <video:description>A nova geração de MIURAS tem pulos sobrando! Tem coragem de embarcar em uma máquina dessas? The new generation of MIURAS is bursting with energy! Do you have the guts to get behind the wheel of a machine like this?</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394608/3394608_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T20:55:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulheres de Negócios - Várias autoras - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Livro inspirador sobre mulheres empreendedoras de Caieiras, empoeiramento feminino, histórias reais, recomeço, negócios, motivação, leitura transformadora e empreendedorismo. Coisas que as Mulheres Bem-Sucedidas nos Negócios Fazem Diferente Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📙 Facebook: https://abre.ai/sCRN 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #mulheres #Brasil #negócios #trabalho #empreendedorismo #resenha #resumo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394607/3394607_720p.mp4</video:content_loc>
      <video:duration>378</video:duration>
      <video:publication_date>2026-09-01T20:55:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_582.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_582.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394606/3394606_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:55:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ALENDA DO MUNDO DAS LUTAS</video:title>
      <video:description>Grande guerreiro, um incune do muito nostálgico #jogos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394605/3394605_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:55:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden depois de conselho do mestre voltar a vila</video:title>
      <video:description>Ninja Gaiden depois de conselho do mestre voltar a vila, toda destruida,,,, #Ninja</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394604/3394604_720p.mp4</video:content_loc>
      <video:duration>241</video:duration>
      <video:publication_date>2026-09-01T20:54:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_581.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_581.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394603/3394603_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:54:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Zumba</video:title>
      <video:description>#Zumba</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394602/3394602_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T20:54:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO PROTEGENDO A CASA</video:title>
      <video:description>SAÚDE GUERREIRO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394601/3394601_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-01T20:54:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Futebol é na hits damata fm</video:title>
      <video:description>Musicas esporte notícias</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394600/3394600_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T20:54:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_580.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_580.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394599/3394599_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:54:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Transformação</video:title>
      <video:description>Transformação de uma casa velha em um lindo lar aconchegante: #Casa #construção #viral #surpreendente #motivacional</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394598/3394598_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-01T20:54:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UMA CATASTROFE NO NEPAL</video:title>
      <video:description>LAMA E MUITO ENTULHO VINDO COM A ENCHORRADA, #TRAGEDIA #FENOMENO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394597/3394597_720p.mp4</video:content_loc>
      <video:duration>203</video:duration>
      <video:publication_date>2026-09-01T20:54:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_579.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_579.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394595/3394595_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:53:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Zumba - Cicih dancer</video:title>
      <video:description>#Zumba</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394594/3394594_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-01T20:53:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>fight ,🫡</video:title>
      <video:description>🤣</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394593/3394593_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T20:53:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BERRY TART, COOKING ANIMATION</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394591/3394591_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:53:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_578.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_578.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394590/3394590_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:53:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Relaxar</video:title>
      <video:description>🌙✨ Hora de Relaxar 🎶 Depois de um dia cheio, chegou o momento de desacelerar, respirar fundo e deixar as preocupações de lado. 🧘‍♂️💆‍♀️ Coloque os fones, feche os olhos e aproveite uma música tranquila para descansar a mente e renovar as energias. 🎧🌿 💙 Relaxe, respire e aproveite este momento de paz. #HoraDeRelaxarMúsicaRelaxanteRelaxamentoMúsicaInstrumentalPazCalmaDescansoMomentoDePazYouTubeShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394589/3394589_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:53:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Khalidi</video:title>
      <video:description>This is a really sweet, peaceful clip you shared. In the video, a young woman in a teal floral shalwar kameez with a matching dupatta is sitting outside in a village courtyard - you can see the brick walls and open sky behind her - holding a small white lamb in her lap. #Lkgf</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394588/3394588_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:53:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful nature 359</video:title>
      <video:description>Beautiful nature</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394587/3394587_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T20:53:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_577.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_577.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394586/3394586_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:53:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>[Janken] Will appear at the end of the video! Try to guess what will come out!</video:title>
      <video:description>Top video</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394585/3394585_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-09-01T20:53:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#freefire 2</video:title>
      <video:description>Game play</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394584/3394584_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T20:52:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny camera man</video:title>
      <video:description>Man beaten by Chinua wife #Beaten</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394583/3394583_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T20:52:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meme😂😂</video:title>
      <video:description>Fofurinha 😍😍 #Meme #criança #vídeosengraçados #vídeos #vídeoscurtos #amor #brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394582/3394582_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T20:52:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_576.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_576.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394581/3394581_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:52:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Invisible Monster</video:title>
      <video:description>#movies #series</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394580/3394580_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-01T20:52:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_575.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_575.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394579/3394579_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:52:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você quer aceitar Jesus ou presente?🤣</video:title>
      <video:description>😂 Welcome to your daily dose of laughter! Funny moments, unexpected situations, crazy reactions, and hilarious videos you won’t want to miss! 🤣🔥 Follow the page for more funny videos every day! ❤️ #Alemanha #Paris #France #Portugal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394578/3394578_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T20:52:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Verão quente</video:title>
      <video:description>Verão quente #Verão #quente #febspot</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394577/3394577_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:52:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_574.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_574.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394575/3394575_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:52:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zé Torão levou foi Gaia kkkk</video:title>
      <video:description>Coitadaa da veia kkk 🤣🤣 #shorts #ia #viral #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394574/3394574_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-01T20:51:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A sogra quer comer bacalhau na semana santa</video:title>
      <video:description>#Brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394573/3394573_720p.mp4</video:content_loc>
      <video:duration>241</video:duration>
      <video:publication_date>2026-09-01T20:51:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_573.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_573.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394572/3394572_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:51:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As fezes da certo</video:title>
      <video:description>#Freefire #Garena #highlights #edit</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394571/3394571_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T20:51:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bintang Di Surga</video:title>
      <video:description>Aprenda a tocar solo de uma das músicas mais tocada na Indonésia. #solo #violão #bintang #surga</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394570/3394570_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T20:51:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_572.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_572.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394569/3394569_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:51:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perto da piscina</video:title>
      <video:description>Piscina de Copacabana Brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394568/3394568_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T20:51:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_571.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_571.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394567/3394567_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:50:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_570.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_570.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394566/3394566_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:50:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>voz da fe</video:title>
      <video:description>deus voz da fe #vozdafe</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394565/3394565_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T20:50:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Transporting a load of square tubing from Salt Lake City to Rock Springs.</video:title>
      <video:description>In this video, we’re going to deliver a load of square tubing from Salt Lake City to Rock Springs, and see what challenges we encounter along the way.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394564/3394564_720p.mp4</video:content_loc>
      <video:duration>841</video:duration>
      <video:publication_date>2026-09-01T20:50:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_569.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_569.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394563/3394563_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:50:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pato Lino Hora de Relaxar</video:title>
      <video:description>🌙✨ Hora de Relaxar 🎶 Depois de um dia cheio, chegou o momento de desacelerar, respirar fundo e deixar as preocupações de lado. 🧘‍♂️💆‍♀️ Coloque os fones, feche os olhos e aproveite uma música tranquila para descansar a mente e renovar as energias. 🎧🌿 💙 Relaxe, respire e aproveite este momento de paz. #HoraDeRelaxarMúsicaRelaxanteRelaxamentoMúsicaInstrumentalPazCalmaDescansoMomentoDePazYouTubeShorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394562/3394562_720p.mp4</video:content_loc>
      <video:duration>1278</video:duration>
      <video:publication_date>2026-09-01T20:50:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Hidden Secret Romans Used To Move Giant Stones</video:title>
      <video:description>How did ancient engineers manage to move monolithic stone blocks weighing up to several tons without modern machinery, trucks, or engines? In this cinematic documentary, we uncover the shocking mechanical secrets of ancient Roman and Greek construction that history books often skip. The true revolution of the ancient world wasn’t giant mythical cranes or alien intervention—it was human intelligence applied directly to the absolute laws of physics. Through carefully preserved tool marks, grooves, and Lewis holes left on the stones themselves, modern researchers are finally reconstructing the exact methods used to bypass gravity. Discover how the clever combination of simple levers, wooden rollers, heavy hemp ropes, and complex lifting systems transformed sheer force into monumental world wonders. If you are fascinated by ancient engineering secrets, lost history mysteries, and the deep science of the past, make sure to subscribe to Primeval Earth so you never miss an episode! --------------------------------------------------------- ⏳ TIMESTAMPS: 0:00 - The Monolithic Challenge 1:00 - Debunking the Myth of Brute Force 2:00 - The Archaeology of Ancient Architecture 3:30 - The Evolution of Primal Cranes 4:30 - Collective Intelligence and Engineering Legacy ---------------------------------------------------------</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394561/3394561_720p.mp4</video:content_loc>
      <video:duration>365</video:duration>
      <video:publication_date>2026-09-01T20:50:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Washing the dishes</video:title>
      <video:description>Need help in the kitchen? These two are hardworking. #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394560/3394560_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T20:50:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_568.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_568.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394559/3394559_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:49:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>No calçadão de joão Pessoa</video:title>
      <video:description>Tambaú brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394558/3394558_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T20:49:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_567.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_567.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394557/3394557_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:49:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hino do Palmeiras</video:title>
      <video:description>Hino da sociedade esportiva palmeiras! Nosso site. https://radiocajaesportes.webradios.net/ #futebol</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394555/3394555_720p.mp4</video:content_loc>
      <video:duration>133</video:duration>
      <video:publication_date>2026-09-01T20:49:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rádio hits damata fm</video:title>
      <video:description>Musicas notícias entretenimento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394554/3394554_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-09-01T20:49:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_566.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_566.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394553/3394553_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:49:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia de domingo na Praia</video:title>
      <video:description>molhando os pés</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394552/3394552_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T20:49:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Things Went South REAL Quick 😂</video:title>
      <video:description>😂 Welcome to your daily dose of laughter! Funny moments, unexpected situations, crazy reactions, and hilarious videos you won’t want to miss! 🤣🔥 Follow the page for more funny videos every day! ❤️ #Paris #France</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394551/3394551_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T20:49:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Recorde no RIFTE DE HOJE MO.CO SUPERCEL</video:title>
      <video:description>👀 Assiste até o final! 👍 Deixa o like 🔔 Se inscreve para mais vídeos de MO.CO! canal do meu amigo (https://youtube.com/@GladsPlayGames?si=r1POTRZbGnUr9Adh canal de LIVES https://youtube.com/@pqcgamerff?si=sqnjdF2X2KooJDvv 🔥 Tags para vídeo do mo.co: mo.co, mo.co gameplay, mo.co supercell, mo.co brasil, mo.co português, mo.co mobile, mo.co android, mo.co gameplay brasil, jogo novo da supercell, novo jogo supercell, supercell games, jogos#SupercellCreator #joinmoco #mocoChapter2 mobile, melhores jogos mobile, jogo mobile 2026, lançamento mo.co, mo.co novidades, mo.co dicas, mo.co gameplay iniciante, mo.co review, vale a pena jogar mo.co #Games #moco #chlashroyale #gameplay #dica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394550/3394550_720p.mp4</video:content_loc>
      <video:duration>109</video:duration>
      <video:publication_date>2026-09-01T20:49:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reacher.2026.S04E01.Dual Audio.</video:title>
      <video:description>Reacher.2026.S04E01.Dual Audio. 480p. 720p. Language: English, Hindi. #Tvseries #reachers4 #reacher #tv2026 #tvseries2026</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394549/3394549_720p.mp4</video:content_loc>
      <video:duration>2781</video:duration>
      <video:publication_date>2026-09-01T20:49:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_565.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_565.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394548/3394548_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:48:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_564.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_564.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394547/3394547_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:48:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Concertando a porteira</video:title>
      <video:description>Eu tbem ser concertar as coisas .kkk #Lilica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394546/3394546_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:48:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SÓ TEM DUAS!😅😂</video:title>
      <video:description>Só tenho duas mulheres na minha vida. #memes #humor #comédia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394545/3394545_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T20:48:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_563.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_563.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394544/3394544_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:48:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bonsai Tree, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Bonsai Tree, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394543/3394543_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:47:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_562.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_562.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394542/3394542_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:47:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_561.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_561.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394541/3394541_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:47:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_560.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_560.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394540/3394540_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:47:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_559.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_559.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394539/3394539_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:46:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mostrando boné dela..</video:title>
      <video:description>Ela adora usar boné para se proteger do sol na roça... #Lilica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394538/3394538_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:46:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Explaining the GTA 6 graphics engine</video:title>
      <video:description>GTA 6 GTA 6: An Expanded View Grand Theft Auto 6 Rockstar Games GTA</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394537/3394537_720p.mp4</video:content_loc>
      <video:duration>583</video:duration>
      <video:publication_date>2026-09-01T20:46:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_558.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_558.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394536/3394536_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:46:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MELHOR AMIGO DO CHICO</video:title>
      <video:description>MEUS AMORES</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394535/3394535_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T20:46:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smart mobile digital service total network company mobile</video:title>
      <video:description>All history mobile digital server network all company network future display total countries transformation model for india #China</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394534/3394534_720p.mp4</video:content_loc>
      <video:duration>501</video:duration>
      <video:publication_date>2026-09-01T20:46:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New customer Ready 🤣</video:title>
      <video:description>#funny #soccer</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394533/3394533_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T20:46:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chess Knight, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Chess Knight, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394532/3394532_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:46:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_557.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_557.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394531/3394531_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:46:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Noite natalina</video:title>
      <video:description>Gatinho dorminhoco</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394530/3394530_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T20:45:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ramen And Cookies</video:title>
      <video:description>Ramen And Cookies Edit , Peshawar Pakistan #food #explore #videography</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394529/3394529_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T20:45:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_556.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_556.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394528/3394528_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:45:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novo IDLE PAGANDO ! Game of Heroes/Saquei 200 BRL</video:title>
      <video:description>Link do Jogo https://gameofheroes.com/?ref=NH499ZY8 Link do APP https://sessiongridapp.pages.dev/?ref=E107411276L #IDLE #GameofHeroes #Saquei200BRL #jogopagandonoipix</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394527/3394527_720p.mp4</video:content_loc>
      <video:duration>395</video:duration>
      <video:publication_date>2026-09-01T20:45:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_555.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_555.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394526/3394526_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:45:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neural Bleed  - Whispers in the Woods</video:title>
      <video:description>Enjoy it while working, exercising, during your leisure time, or while traveling—wherever it brings you happy moments. #eletronicmusic #Cyberpunkmusic #dancemusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394525/3394525_720p.mp4</video:content_loc>
      <video:duration>313</video:duration>
      <video:publication_date>2026-09-01T20:45:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Driver🤣🤣</video:title>
      <video:description>#funny #cat</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394524/3394524_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T20:45:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_554.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_554.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394523/3394523_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:45:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prayer de Deus pra vc</video:title>
      <video:description>Prayer and music #oraçao</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394522/3394522_720p.mp4</video:content_loc>
      <video:duration>150</video:duration>
      <video:publication_date>2026-09-01T20:44:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_553.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_553.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394521/3394521_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:44:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Technologia 2</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394520/3394520_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:44:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neural Bleed - The Old Path</video:title>
      <video:description>Enjoy it while working, exercising, during your leisure time, or while traveling—wherever it brings you happy moments. #eletronicmusic #Cyberpunkmusic #dancemusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394519/3394519_720p.mp4</video:content_loc>
      <video:duration>306</video:duration>
      <video:publication_date>2026-09-01T20:44:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_552.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_552.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394518/3394518_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:44:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sea Turtle, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Sea Turtle, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394517/3394517_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:44:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_551.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_551.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394516/3394516_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:43:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LINDA ONÇA TOP</video:title>
      <video:description>MUITO LINDA ONÇA #UNITEDSTATES</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394515/3394515_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T20:43:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nós 3</video:title>
      <video:description>3 onças kkkkk #Lilica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394514/3394514_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:43:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trump working at site</video:title>
      <video:description>Video made with AI for humor.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394513/3394513_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T20:43:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>oops  dog</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394512/3394512_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T20:43:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neural Bleed - Spirits of the Forest.</video:title>
      <video:description>Enjoy it while working, exercising, during your leisure time, or while traveling—wherever it brings you happy moments. #eletronicmusic #Cyberpunkmusic #dancemusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394511/3394511_720p.mp4</video:content_loc>
      <video:duration>318</video:duration>
      <video:publication_date>2026-09-01T20:43:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harry styles,sign of the times</video:title>
      <video:description>Harry styles,sign of the times #Harrystyles #signofthetimes</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394510/3394510_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-01T20:43:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não é aceitavel</video:title>
      <video:description>#shorts #politician #portugal</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394509/3394509_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T20:43:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time to Fall in Love EP05 Exchange identity to become CEO’s gf Luo Zheng, Lin Xinyi.mp4</video:title>
      <video:description>*Time to Fall in Love* is a Chinese romantic comedy centering on Su Yan Xi, an optimistic and independent livestreamer. To help cover her ailing mother&apos;s medical expenses, she accepts a risky proposition: assuming her twin sister&apos;s identity and signing a contract to become the girlfriend of Gu Xi Cheng, the CEO of a major corporation. Gu Xi Cheng is a cold, methodical man who sought this fake relationship solely to fulfill his sick grandmother&apos;s wish. However, living together and Su Yan Xi&apos;s vibrant personality begin to melt the executive&apos;s icy exterior, transforming the charade into a genuine, sweeping romance. #TimetoFallinLove #C-Drama #ChineseDrama #Romance #RomanticComedy #ContractRelationship #FakeDating #ContractGirlfriend #CEORomance #MistakenIdentity #TwinSisters #LuoZheng #LinXinyi #FakeLove #ForcedProximity #RichCEO #OppositesAttract</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394508/3394508_720p.mp4</video:content_loc>
      <video:duration>2563</video:duration>
      <video:publication_date>2026-09-01T20:43:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Phoenix Valkyries - Shadows of Olympus (Power Metal Official AI Music Video)</video:title>
      <video:description>Try Cremi.Ai link here: https://cremi.ai/friend/phoenixvalkyries ⚔️ About the song: In a world where gods rule through fear and mortals bleed in their wake, Shadows of Olympus tells the story of divine command, vengeance, and the fragile line between hero and monster. As storm clouds gather over a shattered Greece, Athena descends in radiant authority, choosing her champion. A Spartan warrior, scarred by war and bound by destiny, receives her blessing — not as a gift, but as a burden. Through burning cities and crumbling temples, he runs toward inevitable confrontation. Titans rise. Marble cracks. The sky trembles. But beneath the clash of gods and giants lies something deeper — the human cost of divine ambition. Innocence caught in chaos. Faith tested by fire. This is not just a battle. It is judgment. It is destiny carved in stone. Welcome to Shadows of Olympus. 🎧 Listen on all platforms: 🔗 Spotify: https://open.spotify.com/intl-pt/artist/5g958TGeG5SVW2gB1K62QW 🔗 Apple Music: https://music.apple.com/br/artist/phoenix-valkyries/1797334032 🔗 Deezer: https://www.deezer.com/br/artist/303832291 #soul #norfolk #vikingmusic #darkfolk #vikingsoul #darknordicfolk #cinematicvideo #cinematicmusic #blockbuster #vikingsong #warriormusic #norsemusic #epicfantasymusic #vikingmetal #vikingsmusic #vikingbattlemusic #vikingchants #cinematicsoundtrack #epicmusic #norse #soulmusic #darknordicmusic #folkmusic #epicvikingmusic #heroicmusic #vikingwarriormusic #ambientmusic #medievalmusic #darkambient #berserker #phoenixvalkyries #kratos #greek #olympus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394507/3394507_720p.mp4</video:content_loc>
      <video:duration>325</video:duration>
      <video:publication_date>2026-09-01T20:43:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 01</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #tvNdrama #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #romanticrelationship #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #SecretAudit #EunmilhanGams</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394506/3394506_720p.mp4</video:content_loc>
      <video:duration>3840</video:duration>
      <video:publication_date>2026-09-01T20:43:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crystal Swan, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Crystal Swan, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394505/3394505_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:43:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO, HORA DO RANGO</video:title>
      <video:description>MENINO FORTE E CORAJOSO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394504/3394504_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T20:42:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seashell, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Seashell, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394503/3394503_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:42:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neural Bleed -Shadows Between the Trees</video:title>
      <video:description>Enjoy it while working, exercising, during your leisure time, or while traveling—wherever it brings you happy moments. #eletronicmusic #Cyberpunkmusic #dancemusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394502/3394502_720p.mp4</video:content_loc>
      <video:duration>320</video:duration>
      <video:publication_date>2026-09-01T20:41:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny AI Roblox Game 😂🔥 | The Craziest Game Idea Ever!</video:title>
      <video:description>😂🎮 What if AI created the funniest Roblox game ever? A crazy AI-generated Roblox game concept filled with hilarious moments, unexpected challenges and chaotic gameplay! 🤣 Funny Roblox 🎮 Crazy Game Idea 🤖 AI Generated 🔥 Funny Gaming 🚀 Epic Game Concept #Roblox #FunnyRoblox #RobloxGame #FunnyGame #AIGame #AIGeneratedGame #RobloxGameIdea #RobloxGameConcept #FunnyGaming #AIGaming #CrazyGame #ComedyGame #ViralGame #Gaming #AIVideo #AIAnimation #RobloxFunnyMoments #GameIdea #GamingShorts #FunnyVideo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394501/3394501_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:41:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Phoenix lill mini show performance</video:title>
      <video:description>Dança e show de dança Phoenix lill mini #Brasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394500/3394500_720p.mp4</video:content_loc>
      <video:duration>808</video:duration>
      <video:publication_date>2026-09-01T20:41:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lotus Bloom, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Lotus Bloom, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394499/3394499_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:41:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hora Da Tatuagem</video:title>
      <video:description>🎨 A Hora da Tatuagem! 🖊️🔥 Chegou a hora de transformar uma ideia em arte! Acompanhe o momento da tatuagem, desde os primeiros traços até o resultado final. ✨ Cada desenho tem um significado, cada detalhe conta uma história e cada tatuagem se torna uma marca única. 🔥 Da criatividade para a pele: arte que fica para sempre! #TatuagemTattooArteDesenhoTatuagemRealistaTattooArtCriatividadeYouTubeShorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394498/3394498_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:41:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VOCÊ TEVE UMA INFÂNCIA FELIZ.?</video:title>
      <video:description>Infância feliz 😅😂 #memeshumor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394497/3394497_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:41:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quem planta colhe</video:title>
      <video:description>Era um sonho poder plantar, hoje já estou colhendo #Horta</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394496/3394496_720p.mp4</video:content_loc>
      <video:duration>485</video:duration>
      <video:publication_date>2026-09-01T20:40:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Penguin, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Penguin, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394494/3394494_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:40:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Secret Arts Revealed | Ninja Kamui | adult swim</video:title>
      <video:description>adult swim</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394493/3394493_720p.mp4</video:content_loc>
      <video:duration>627</video:duration>
      <video:publication_date>2026-09-01T20:39:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiny Crown, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Tiny Crown, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394492/3394492_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>and I&apos;m not ashamed</video:title>
      <video:description>and I&apos;m not ashamed * a dream that&apos;s true #cryptocurrencies #cryptonews #cryptoupdated #cryptoeveryone #financialfreedom #catalystsch #scholic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394491/3394491_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T20:39:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Thought It Would Work 😂</video:title>
      <video:description>😂 Welcome to your daily dose of laughter! Funny moments, unexpected situations, crazy reactions, and hilarious videos you won’t want to miss! 🤣🔥 Follow the page for more funny videos every day! ❤️</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394490/3394490_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T20:39:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pensando na vida</video:title>
      <video:description>Adoro pensar na vida nesse lugar lindo... #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394489/3394489_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:39:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hino do São Paulo Futebol Clube</video:title>
      <video:description>O tricolor mais querido do mundo! Nosso site. https://radiocajaesportes.webradios.net/ #futebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394488/3394488_720p.mp4</video:content_loc>
      <video:duration>114</video:duration>
      <video:publication_date>2026-09-01T20:38:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juice 2</video:title>
      <video:description>Just</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394487/3394487_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T20:38:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral 134</video:title>
      <video:description>Viral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394486/3394486_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:38:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dangdut 56</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. enjoy! #Dangdutmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394485/3394485_720p.mp4</video:content_loc>
      <video:duration>407</video:duration>
      <video:publication_date>2026-09-01T20:38:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394484</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394484/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😭O BL que me fez chorar</video:title>
      <video:description>Resumo rápido de um dos BL mais lindos e emocionante que já li. Duplication Love #Bl #manhwa #recap</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394484/3394484_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:38:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Maybe I&apos;ll learn, to let go of my fears</video:title>
      <video:description>Maybe I&apos;ll learn, to let go of my fears * a dream that&apos;s true #travelUSA #travelCanada #travelAustralia #travelNewZealand #traveler #music #scholic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394483/3394483_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T20:38:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neural Bleed - Eternal Night</video:title>
      <video:description>Enjoy it while working, exercising, during your leisure time, or while traveling—wherever it brings you happy moments. #Cyberpunkmusic #Dancemusic #Eletronicmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394482/3394482_720p.mp4</video:content_loc>
      <video:duration>307</video:duration>
      <video:publication_date>2026-09-01T20:38:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox MasterChef 4 👨‍🍳🔥 | Insane Cooking Game Idea!</video:title>
      <video:description>👨‍🍳🔥 MasterChef 4 is here! An exciting AI-generated Roblox game concept where chefs compete in insane cooking challenges, create amazing dishes and battle to become the ultimate MasterChef! 🍳 Cooking Battle 👨‍🍳 Chef Challenge 🎮 Roblox Game Idea 🤖 AI Generated Game 🔥 Crazy Kitchen #Roblox #MasterChef #RobloxMasterChef #MasterChef4 #CookingGame #RobloxCooking #AIGame #AIGeneratedGame #RobloxGameIdea #RobloxGameConcept #ChefGame #CookingChallenge #CookingBattle #RestaurantGame #FunnyRoblox #AIGaming #FoodGame #KitchenChallenge #AIVideo #GamingShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394480/3394480_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:37:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral videos 8</video:title>
      <video:description>Video</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394479/3394479_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:37:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394478</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394478/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Roça é bom demais</video:title>
      <video:description>Olha oq eu fiz hoje?. #Iki</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394478/3394478_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:37:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO ESPERANDO AJUDA</video:title>
      <video:description>MEU MENINO VENCEDOR</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394477/3394477_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T20:37:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nakama 2</video:title>
      <video:description>The most enjoyable experience is when we can make that moment a reflection of ourselves. #Use #nakama #music #fyppp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394476/3394476_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T20:37:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>deep within my mind</video:title>
      <video:description>deep within my mind * a dream that&apos;s true #peaceful #mindful #journey #stories #musichealings #music #musicUSA #USAnews #USAupdated #scholic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394475/3394475_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-09-01T20:36:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394474</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394474/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hummingbird, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Hummingbird, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394474/3394474_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:36:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME, FANTASY _ Full Movie in English 720P.mp4</video:title>
      <video:description>#ANIME #FANTASY_FullMovieinEnglish720Pmp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394473/3394473_720p.mp4</video:content_loc>
      <video:duration>4827</video:duration>
      <video:publication_date>2026-09-01T20:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny moments of children participating in a competition.</video:title>
      <video:description>Funny moments of children participating in a competition. #Funny #children #funnycompetition #trending #viral #funnymoment</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394472/3394472_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-01T20:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dirigindo trator</video:title>
      <video:description>Olha o dia de trator na roça gente... #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394471/3394471_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:36:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>70s Funk Groove with Hot Hammond B3 🔥 | Hammond Heatwave 2</video:title>
      <video:description>🇺🇸 ENGLISH 70s funk groove, Hammond B3 and vintage instrumental funk come together in “Hammond Heatwave” — a warm, soulful groove inspired by the golden era of 1970s funk. Vintage funk, jazz-funk, soul-jazz, electric bass, guitar, vintage drums and trumpet meet the unmistakable sound of a hot Hammond B3. The night is warm. The hotel lights are glowing. And somewhere beside the pool, The Groovers have found another reason to play. Surrounded by friends, guests, tropical plants, colorful lights and reflections dancing across the water, the band settles into a deep instrumental groove. “Hammond Heatwave” is a celebration of everything that makes 70s funk feel alive: warm instruments, organic musicianship, deep grooves and the feeling of a band playing together in the same room. Or, in this case... Beside a swimming pool on a hot night. 🌴🔥 Turn up the volume and let the Hammond take over. If you enjoy 70s funk, Hammond B3, jazz-funk, soul-jazz and vintage instrumental grooves, subscribe to the channel and join the journey. Keep Spinning. Keep Grooving. / @marceloceloca1763 ------------------------ 🇧🇷 PORTUGUÊS Groove funk dos anos 70, Hammond B3 e funk instrumental vintage se encontram em “Hammond Heatwave” — um groove quente inspirado na era de ouro do funk dos anos 70. Funk vintage, jazz-funk, soul-jazz, baixo elétrico, guitarra, bateria vintage e trompete se unem ao som inconfundível de um Hammond B3 quente e cheio de personalidade. Cercada por amigos, convidados, plantas tropicais, luzes coloridas e reflexos dançando na água, a banda entra em um groove instrumental profundo. No centro de todo esse calor está o som inconfundível do Hammond B3. Aumente o volume e deixe o Hammond dominar. 🎹 Qual instrumento mais chama sua atenção em “Hammond Heatwave”? Se você curte funk d</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394470/3394470_720p.mp4</video:content_loc>
      <video:duration>284</video:duration>
      <video:publication_date>2026-09-01T20:36:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Acts 130</video:title>
      <video:description>Acts 130</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394469/3394469_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T20:36:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox MasterChef 3 👨‍🍳🔥 | Ultimate Cooking Battle!</video:title>
      <video:description>👨‍🍳🔥 The cooking battle is ON! MasterChef returns for an even crazier AI-generated Roblox game concept. Cook, compete and face unexpected kitchen challenges to become the ultimate chef! 🍔 Roblox Cooking Battle 👨‍🍳 MasterChef Challenge 🔥 Crazy Kitchen 🤖 AI Game Concept 🎮 Roblox Gaming #Roblox #MasterChef #RobloxMasterChef #MasterChefGame #RobloxCookingGame #CookingBattle #ChefChallenge #AIGame #AIGeneratedGame #RobloxGameIdea #RobloxGameConcept #CookingChallenge #RestaurantGame #FunnyRoblox #AIGaming #FoodGame #ChefGame #AIVideo #AIAnimation #GamingShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394468/3394468_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:36:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394467</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394467/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;m happy when I&apos;m eating.</video:title>
      <video:description>#mundo #alegria #meninas #dança</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394467/3394467_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T20:36:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ONE KISS</video:title>
      <video:description>ONE KISS VERY GOOD #BABIER #barbier #kiss #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394466/3394466_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T20:36:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Detik detik Buffon muda menantang Ronaldo Nazario terang terangan!</video:title>
      <video:description>Detik detik Buffon muda menantang Ronaldo Nazario terang terangan!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394465/3394465_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T20:35:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aqui estou… tudo o que eu tenho é Teu</video:title>
      <video:description>Música gospel de adoração para quem deseja voltar à presença de Deus de todo coração. “Aqui Estou” é uma canção de entrega, rendição e encontro com Deus. Sem máscaras. Sem orgulho. Sem tentar esconder a dor. Apenas um coração dizendo: “Deus… aqui estou.” Essa música foi feita para momentos de oração, silêncio e intimidade com Deus. Escuta até o final e deixa essa canção tocar sua alma. ✨ Anna Lumi — Canções para sentir Deus perto. #Músicaféadoraçãolouvorgospelworshipannalumipresençadedeus</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394464/3394464_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-01T20:35:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>📖 মন দেখে ভালোবাসো, রূপ দেখে নয় ❤️ https://youtube.com/shorts/5th7b4WPYRw?feature=share</video:title>
      <video:description>&quot;সৌন্দর্য দেখে জীবনসঙ্গী বাছিস না, মন দেখে বাছিস...&quot; — মায়ের এই একটা কথাই বদলে দিতে পারে ভালোবাসা সম্পর্কে তোমার পুরো ধারণা। এই ভিডিওতে থাকছে এমন কিছু কথা, যা সত্যিকারের ভালোবাসা কী, বিশ্বাস কী, আর একজন মানুষের ভেতরের সৌন্দর্য কতটা গুরুত্বপূর্ণ— তা নিয়ে গভীর কিছু উপলব্ধি। যদি তুমি এমন কাউকে খুঁজছো, যে সুখে ভালোবাসবে আর দুঃখে পাশে থাকবে— এই ভিডিওটা তোমার জন্যই। 💬 কমেন্টে জানাও, এই কথাগুলো তোমার মনে কেমন প্রভাব ফেলল। ❤️ ভিডিওটা ভালো লাগলে লাইক করো আর চ্যানেলে সাবস্ক্রাইব করে রাখো, এমন আরও হৃদয়ছোঁয়া কথা পেতে। 🔔 নোটিফিকেশন বেল বাটনটা অন করে রাখো, যাতে নতুন ভিডিও মিস না হয়। #বাংলাকবিতাভালোবাসারকথামনদেখেভালোবাসোসম্পর্কজীবনসঙ্গীবাংলাউক্তিEmotionalQuotesBengaliPoetryLoveQuotesTrustAndLove</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394463/3394463_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-01T20:34:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia de cortar grama</video:title>
      <video:description>Eu corto grama tbem viu .. não pense que não ... #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394462/3394462_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:34:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Agro no sul</video:title>
      <video:description>Agro no sul estamos passando veneno para controlar as pragas na lavoura pesquisa no YouTube agro no sul siga nois #Agro</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394461/3394461_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T20:34:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anime 313</video:title>
      <video:description>#Anime #world #Japão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394460/3394460_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T20:34:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394458</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394458/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What did you think of this house? You&apos;ll be surprised by the garden inside the living room.</video:title>
      <video:description>If you liked the house, like the video and comment what you thought of the house, or just comment one: hi. #Home</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394458/3394458_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T20:34:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394457</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394457/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox Master Chef 2 👨‍🍳🔥 | Crazy Kitchen Challenge!</video:title>
      <video:description>👨‍🍳🔥 Welcome to the craziest kitchen in Roblox! In this AI-generated Roblox game concept, Master Chefs face crazy cooking challenges, prepare delicious dishes and compete to become the ultimate chef! 🍔 Roblox Cooking Game 👨‍🍳 Master Chef Challenge 🔥 Crazy Kitchen 🤖 AI Game Concept 🎮 Roblox Gaming #Roblox #RobloxMasterChef #MasterChefRoblox #RobloxCookingGame #CookingGame #ChefGame #AIGame #AIGeneratedGame #RobloxGameIdea #RobloxGameConcept #CookingChallenge #CrazyKitchen #RestaurantGame #FunnyRoblox #AIGaming #FoodGame #ChefChallenge #AIVideo #AIAnimation #GamingShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394457/3394457_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:34:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394456</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394456/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The King of Prehistoric Skies</video:title>
      <video:description>The King of Prehistoric Skies #TheKingofPrehistoricSkies</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394456/3394456_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-01T20:34:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394455</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394455/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>La respuesta del MONO fue perfecta.🤣😂</video:title>
      <video:description>¿Estás de acuerdo con el mono?🤣 Deja tu comentario y síguenos para más chistes rápidos. #risaschisteshumorcomediaanimales</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394455/3394455_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:34:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394454</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394454/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Butterfly, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Butterfly, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394454/3394454_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:34:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Duas irmãs</video:title>
      <video:description>Dia na roça com ela ... #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394453/3394453_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T20:33:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394452</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394452/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pintura a Lápis: Da Arte à Realidade! 🎨✨</video:title>
      <video:description>✏️ Pintura a Lápis: Da Arte à Realidade! 🎨✨ Neste vídeo, um simples desenho feito a lápis ganha vida e se transforma em realidade! 🖼️➡️🌎 Acompanhe cada detalhe dessa transformação e veja como a criatividade pode transformar um desenho em algo surpreendente. ❤️ Do lápis para a realidade — onde a imaginação ganha vida! #DesenhoPinturaALápisDoDesenhoARealidadeArteDesenhoRealistaTransformaçãoCriatividadeArteBrasileiraYouTubeShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394452/3394452_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T20:33:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394451</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394451/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Charity Never Decrease Wealth</video:title>
      <video:description>Do not fear that charity will make you poor.Give from what Allah has given you. Give to the poor. Support the needy. Feed the hungry. Help an orphan. Support students seeking beneficial knowledge. And remember: the value of your charity is not measured only by its amount, but by the sincerity of your heart. #Charity #Poor #Orphan #Decrease</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394451/3394451_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:33:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394450</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394450/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon Ball Symphonic Adventure ~ Vegeta Sacrifice</video:title>
      <video:description>Experience the emotional power of Vegeta’s sacrifice in Dragon Ball Symphonic Adventure. A breathtaking orchestral performance that captures his courage, redemption, determination, and unforgettable warrior spirit. #DragonBallVegetaVegetaSacrificeDragonBallSymphonicAdventureEpicOrchestraAnimeMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394450/3394450_720p.mp4</video:content_loc>
      <video:duration>282</video:duration>
      <video:publication_date>2026-09-01T20:33:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dela apostolska 130</video:title>
      <video:description>Dela apostolska 130</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394449/3394449_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T20:33:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤯 5 Mind-Blowing Facts You Won&apos;t Believe Are True! #shorts</video:title>
      <video:description>Did you know these incredible facts? Like and subscribe for more amazing content every day! #facts #mindblowing #science #interesting #mindblowingfacts #didyouknow #amazingfacts #sciencefacts #interestingfacts #randomfacts #shorts #viralfacts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394448/3394448_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T20:33:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Red Panda, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Red Panda, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394447/3394447_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:33:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394446</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394446/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Velhinho cheio de saúde 😄</video:title>
      <video:description>Olá pessoal mais um vídeo curto e engraçado vamos rir, Rir é o melhor remédio, se inscreva e curta o vídeo e compartilha. #comédia #Brasil #vídeo #engraçado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394446/3394446_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T20:33:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ipê roxo muito lindo 💜💜</video:title>
      <video:description>Floração do ipê roxo aqui onde moro, estado do Paraná Brasil 🙌🙌💜</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394445/3394445_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T20:33:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Foto Live Core #fotive #coreid #warga62 #wargaindo #random #fyp #viral #fypシ゚viral</video:title>
      <video:description>Foto Live Core #fotive #coreid #warga62 #wargaindo #random #fyp #viral #fypシ゚viral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394443/3394443_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T20:32:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia d pescaria</video:title>
      <video:description>Olha que peixe lindo Lilica pegou . #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394442/3394442_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:32:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox Master Chef Game 👨‍🍳🔥 | Ultimate Cooking Challenge!</video:title>
      <video:description>👨‍🍳🔥 What if AI created the ultimate Roblox Master Chef game? Enter the kitchen, cook amazing dishes and compete in crazy cooking challenges in this fun AI-generated game concept! 🍳 Master Chef Game 🎮 Roblox Style 🔥 Cooking Challenge 🤖 AI Generated 🍔 Restaurant Adventure #Roblox #RobloxCooking #MasterChef #CookingGame #RobloxGame #AIGame #AIGeneratedGame #RobloxGameIdea #CookingChallenge #ChefGame #RestaurantGame #FunnyRoblox #AIGaming #Gaming #FoodGame #ChefChallenge #GameConcept #AIVideo #AIAnimation #GamingShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394441/3394441_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:32:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mini dorama da tah #8</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394440/3394440_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:32:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>THIS TUNNEL HAS BEEN SEALED FOR YEARS — HERE&apos;S WHY  이 터널은 수년간 봉쇄되어 있었습니다 — 그 이유는 이렇습니다</video:title>
      <video:description>I walked all the way through this abandoned tunnel and what was waiting at the end left me speechless 😨 Would you make it to the end? #abandonedtunnel #urbanexploration #scarystories #realhorror #creepy #mystery #urbex #hiddenurban #darkexploration #truestory 이 폐터널을 끝까지 걸었는데 끝에서 기다리고 있던 것 때문에 말을 잃었습니다 😨 당신이라면 끝까지 갈 수 있나요? #폐터널 #도시탐험 #무서운이야기 #진짜공포 #소름 #미스터리 #urbex #실화 #어둠속탐험 #perigotunelmisteriodark</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394439/3394439_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-01T20:32:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dangdut 55</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. enjoy! #Dangdutmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394438/3394438_720p.mp4</video:content_loc>
      <video:duration>355</video:duration>
      <video:publication_date>2026-09-01T20:32:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Origami Crane, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Origami Crane, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394437/3394437_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:32:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mini dorama da tah #7</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394436/3394436_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:32:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lavando roupa no rio</video:title>
      <video:description>Dia de lavar roupa no rio #Lilica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394435/3394435_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:32:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AJUDANDO HOMENS CASADOS ESQUECER SEUS PROBLEMAS.</video:title>
      <video:description>Ajudo homens casados a esquecer seus problemas. #memeshumor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394434/3394434_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:31:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mini dorama da tah #6</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394433/3394433_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:31:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ronaldinho gaúcho ✨</video:title>
      <video:description>Um bailarino em campo, com sua magia fazia TDS se encantar ao vê-lo jogar bola #R10ronaldinhoronaldinhogauchobrazilbrasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394432/3394432_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T20:31:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>adivinha</video:title>
      <video:description>&quot;Consegue olhar para isso sem rir?&quot; / &quot;Tente não se surpreender&quot; / &quot;Adivinhe o que é isso em 5 segundos&quot; muito engraçado #indoparaapraiaconfusãohumorcomedia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394431/3394431_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:31:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chyren, o persa</video:title>
      <video:description>Chyren, a essência de Ciro !! #ciro #chyren</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394430/3394430_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-01T20:31:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🥨 Crunchy Food ASMR 🤤 | Satisfying Sounds That Make You Hungry!</video:title>
      <video:description>Get your headphones ready! 🎧🔥 In this video, you’ll dive into a delightful ASMR experience featuring crunchy food sounds. Every bite, every crunch, and every texture has been captured to deliver that satisfying, mouth-watering sensation! 🤤🥨 🔊 Turn up the volume, relax, and enjoy the sounds! 🍿 Crunchy, satisfying sounds 🥨 Amazing textures 😴 Perfect for relaxing and relieving stress 🤤 Warning: this video might make you really hungry! #UnitedStates #Philippines #UnitedKingdom #England #Paris #France #Canada</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394428/3394428_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T20:30:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ela saber tocar berrante...</video:title>
      <video:description>Passeio na roça e a tocada do berrante... #Lilica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394427/3394427_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:30:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO , QUE SONINHO BOM</video:title>
      <video:description>CACHORRINHO GUERREIRO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394426/3394426_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T20:30:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox Pizza Game 🍕🔥 | Crazy Pizza Restaurant Adventure!</video:title>
      <video:description>🍕🎮 What if AI created the craziest pizza game on Roblox? A fun AI-generated game concept where players make pizzas, run a crazy restaurant and face unexpected challenges! 🍕 Pizza Game 🎮 Roblox Style 🔥 Restaurant Adventure 🤖 AI Generated 😂 Funny Gaming #Roblox #RobloxPizza #PizzaGame #RobloxGame #PizzaRestaurant #AIGame #AIGeneratedGame #RobloxGameIdea #GameConcept #FunnyRoblox #AIGaming #Gaming #RestaurantGame #PizzaChallenge #CookingGame #FoodGame #AIVideo #AIAnimation #VirtualRestaurant #GamingShorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394425/3394425_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:30:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sagawa1gou funny video 😂😂😂</video:title>
      <video:description>funny #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394424/3394424_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:30:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hino Oficial do Corinthians</video:title>
      <video:description>O time do povo! Nosso site. https://radiocajaesportes.webradios.net/ #futebol</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394423/3394423_720p.mp4</video:content_loc>
      <video:duration>112</video:duration>
      <video:publication_date>2026-09-01T20:30:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Do Desenho a Realidade Comida Nordestina</video:title>
      <video:description>🍛 Comida Nordestina — Do Desenho à Realidade! 🌵❤️ Neste vídeo, a arte ganha vida! O que começa como um simples desenho de uma deliciosa comida nordestina se transforma em uma cena realista, cheia de cores, sabores e tradição. 🌽 🫘 🍖 Uma homenagem à riqueza da culinária nordestina e às receitas que carregam histórias, cultura e muito carinho. ✨ Do lápis para a realidade: a magia da arte encontrando a cultura nordestina! #ComidaNordestinaCulináriaNordestinaNordesteArteDesenhoDoDesenhoARealidadeCulturaBrasileiraComidaBrasileiraYouTubeShorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394422/3394422_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T20:29:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher denuncia patrão após descobrir que era gravada escondida em banheiro</video:title>
      <video:description>Mulher denuncia patrão após descobrir que era gravada escondida em banheiro</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394421/3394421_720p.mp4</video:content_loc>
      <video:duration>283</video:duration>
      <video:publication_date>2026-09-01T20:29:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neural Bleed - Dark Forest</video:title>
      <video:description>Enjoy it while working, exercising, during your leisure time, or while traveling—wherever it brings you happy moments. #Dancemusic #eltromusic #cyberpunk #futuristicmusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394420/3394420_720p.mp4</video:content_loc>
      <video:duration>328</video:duration>
      <video:publication_date>2026-09-01T20:29:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Água limpa da fazenda</video:title>
      <video:description>Bebendo a água limpa e cristalina da fazenda #Lilica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394419/3394419_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T20:29:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 minuto animal - parece mentira...#animais</video:title>
      <video:description>1 minuto animal - parece mentira...#animais #AnimaisCuriosidades</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394418/3394418_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T20:29:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lanterns S01 | HINDI 1080P | Episode 3</video:title>
      <video:description>Upload By RJ Soumen Official</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394417/3394417_720p.mp4</video:content_loc>
      <video:duration>3219</video:duration>
      <video:publication_date>2026-09-01T20:28:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Passeio na roça com seu cavalo</video:title>
      <video:description>Ela e seu amigo que ela ama.. #Lilica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394416/3394416_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:28:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394415</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394415/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lanterns S01 | HINDI 1080P | Episode 2</video:title>
      <video:description>Upload By RJ Soumen Official</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394415/3394415_720p.mp4</video:content_loc>
      <video:duration>3094</video:duration>
      <video:publication_date>2026-09-01T20:28:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lanterns S01 | HINDI 1080P | Episode 1</video:title>
      <video:description>Upload By RJ Soumen Official</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394414/3394414_720p.mp4</video:content_loc>
      <video:duration>3390</video:duration>
      <video:publication_date>2026-09-01T20:28:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That cat of mine</video:title>
      <video:description>#Cat #game #anime</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394413/3394413_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T20:28:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sign of the times</video:title>
      <video:description>Músic sign of the times</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394412/3394412_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T20:27:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia dia na sua casa</video:title>
      <video:description>Ela adora posar para vídeos em sua casa . #Lilica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394411/3394411_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:27:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Would you eat these fruits?</video:title>
      <video:description>Would you eat these fruits?</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394410/3394410_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T20:27:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorrinha querendo carinho 😂</video:title>
      <video:description>Minha cachorrinha querendo carinho #Brasil #EUA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394408/3394408_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T20:26:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DANGDUT 7</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. enjoy! #Dangdut</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394407/3394407_720p.mp4</video:content_loc>
      <video:duration>391</video:duration>
      <video:publication_date>2026-09-01T20:26:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vestido rosa</video:title>
      <video:description>Ela adora esse vestido rosa... #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394406/3394406_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:26:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO APRONTANDO</video:title>
      <video:description>CHICO DEPOIS DE PASSAR POR PLOBLEMAS DE SAUDE</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394405/3394405_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T20:26:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox Burger Challenge 🍔😂 | Funniest Restaurant Moment!</video:title>
      <video:description>🍔😂 This Roblox-style restaurant visit went completely crazy! Watch this funny AI-generated gaming moment featuring a hungry character, a giant hamburger and an unexpected restaurant experience. 🍔 Burger Challenge 😂 Funny Moment 🎮 Roblox Style 🤖 AI Animation 🔥 Gaming Comedy #Roblox #RobloxFunny #RobloxRestaurant #Burger #Hamburger #BurgerChallenge #FunnyRoblox #AIVideo #AIAnimation #AIGenerated #RobloxCharacter #FunnyGaming #Gaming #RestaurantGame #RobloxFood #FunnyMoment #Comedy #ViralVideo #GamingShorts #AIGaming</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394404/3394404_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:26:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394403</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394403/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zumba - Cicih dancer</video:title>
      <video:description>#Zumba</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394403/3394403_720p.mp4</video:content_loc>
      <video:duration>202</video:duration>
      <video:publication_date>2026-09-01T20:26:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Protegendo a pele</video:title>
      <video:description>Produto para deixar pele bela. #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394402/3394402_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:25:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PHOENIX VALKYRIES - The Weight of the Allfather  (ODIN THEME) - Epic Power Metal | AI MUSIC VIDEO</video:title>
      <video:description>⚔️ About the song: The fate of the gods rests heavily on Odin’s shoulders — and in this music video, you witness the Allfather like never before. The Weight of the Allfather dives into the final nights of the Father of All, caught between sacrifice, silence, and shadowed visions in Asgard’s twilight. FREEBEAT.AI : Together, they merge myth and music in a storm of fire, light, and destiny — where every note becomes a strand in the grand tapestry of existence. ⚡ Support the band &amp; our partners! We created this project using incredible AI music tools like Freebeat AI — one of the best platforms for creating professional music videos, clips, and lyrics automatically. 🎧 Try it yourself and unlock your creativity! 👉https://freebeat.ai/#via=phoenixvalkyries 🎧 Listen on all platforms: 🔗 Spotify: https://open.spotify.com/intl-pt/artist/5g958TGeG5SVW2gB1K62QW 🔗 Apple Music: https://music.apple.com/br/artist/phoenix-valkyries/1797334032 🔗 Deezer: https://www.deezer.com/br/artist/303832291 📺 Watch more Phoenix Valkyries music videos: 🔹 [Hearts of Steel] - https://youtu.be/UTdj-0IY544?si=xgvla25xzdOznXdb 🔹 [The Call of Yggdrasil] - https://youtu.be/E067rwx4lIk?si=BbZPzIsDa0nxsbyn 🔹 [Echoes of Eternity] - https://youtu.be/W3iwu5Vjzdo?si=nbO2LqONSUm8pmlg 📲 Follow us on social media! 🔥 Instagram: https://www.instagram.com/phoenixvalkyriesofficial/ 🔥 TikTok: https://www.tiktok.com/@phoenix.valkyries 🛒 Buy official merchandise! 👕 T-shirts, posters and more: coming soon 📢 Support the band! Not subscribed? Consider subscribing, it&apos;s very important for the growth of the channel: https://www.youtube.com/channel/UC9xPktKI4AgryFA6_Fx1zOg?sub_confirmation=1 🔸 Leave a like 👍 🔸 Comment what you think of the song! ❄️🔥 🔸 Share with your friends who like epic metal! #PowerMetal #SymphonicMetal #Phoe</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394401/3394401_720p.mp4</video:content_loc>
      <video:duration>368</video:duration>
      <video:publication_date>2026-09-01T20:25:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Mentality That Separates the Rich from the Poor</video:title>
      <video:description>While some complain about life, others build empires. In this video you&apos;ll understand why the millionaire mindset is the true starting point before the money arrives — discipline, focus, and decisions that most avoid making. Part of the Millionaire Videos series. #Carros #luxu #milionários #mentalidade #ricos #bilionários</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394400/3394400_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T20:25:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pipas Nostalgia Da infância</video:title>
      <video:description>🪁 Pipas: A Arte da Infância ❤️ Uma viagem de volta aos tempos em que a diversão era simples: uma pipa no céu, um vento bom e a alegria de brincar na rua. 🪁☀️ Cada pipa carrega uma lembrança, uma história e um pedacinho da infância que permanece para sempre em nossa memória. ✨ Pipas são mais do que brinquedos… são memórias voando pelo céu! #PipasArteDaInfânciaInfânciaBrincadeirasAntigasNostalgiaMemóriasPipaYouTubeShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394399/3394399_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T20:25:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zumba - Coreografia by Cicih</video:title>
      <video:description>Anitta - Casí Casí #Zumba #fitness #dança</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394398/3394398_720p.mp4</video:content_loc>
      <video:duration>129</video:duration>
      <video:publication_date>2026-09-01T20:25:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394397</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394397/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amém? 🙏🏻🙏🏻</video:title>
      <video:description>🙏✨ Uma palavra de Deus pode mudar o seu dia. Que este versículo fortaleça sua fé, traga paz ao seu coração e lembre você de que Deus está sempre presente. ❤️ 📖 “Entrega o teu caminho ao Senhor; confia nele, e ele tudo fará.” — Salmos 37:5 Se essa mensagem falou com você, compartilhe com alguém que precisa ouvir isso hoje. 🙏 #DeusFéJesusVersiculoDoDiaBibliaPalavraDeDeusEvangelhoOraçãoDeusNoControleFéEmDeusJesusCristoBibliaSagradaVersiculosBiblicosMotivacaoPaz</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394397/3394397_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T20:24:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oração de terça feira</video:title>
      <video:description>oração de terça-feira, oração de hoje, oração de agradecimento, oração da manhã, oração para terça-feira, agradecimento a Deus, gratidão a Deus, oração poderosa, oração forte, oração de fé, mensagem de fé, Deus é bom, Deus no controle, bênçãos de Deus, oração para começar o dia, oração para hoje, palavra de Deus, oração diária, oração para família, oração com Deus, amém, fé em Deus #oraçãofe</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394396/3394396_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T20:24:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seu cachorro e amigo</video:title>
      <video:description>Ela passeando com.seu dog #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394395/3394395_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T20:24:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>quando a carroça não aguenta</video:title>
      <video:description>este é um canal de humor brasileiro, olá seus todos bem vindos a meu canal hora do humor #shorts #engraçados #vídeosfunny #comedy</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394394/3394394_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:24:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox Banana Slip 😂🍌 | Funniest Fail Ever!</video:title>
      <video:description>😂🍌 He was NOT ready for the banana peel! Watch this hilarious AI-generated Roblox-style gaming moment as a character slips on a banana peel in the funniest way possible. 🎮 Roblox Style 🍌 Banana Peel 😂 Funny Fail 🤖 AI Animation 🔥 Gaming Comedy #Roblox #RobloxFunny #RobloxFail #BananaSlip #BananaPeel #FunnyRoblox #FunnyGaming #AIVideo #AIAnimation #AIGenerated #RobloxCharacter #FunnyFail #CrazyFail #Comedy #Gaming #ViralVideo #GamingShorts #FunnyMoment #RobloxMeme #AIGaming</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394393/3394393_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:24:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>70s Funk Groove with Hot Hammond B3 🔥 | Hammond Heatwave</video:title>
      <video:description>🇺🇸 ENGLISH 70s funk groove, Hammond B3 and vintage instrumental funk come together in “Hammond Heatwave” — a warm, soulful groove inspired by the golden era of 1970s funk. Vintage funk, jazz-funk, soul-jazz, electric bass, guitar, vintage drums and trumpet meet the unmistakable sound of a hot Hammond B3. The night is warm. The hotel lights are glowing. And somewhere beside the pool, The Groovers have found another reason to play. Surrounded by friends, guests, tropical plants, colorful lights and reflections dancing across the water, the band settles into a deep instrumental groove. “Hammond Heatwave” is a celebration of everything that makes 70s funk feel alive: warm instruments, organic musicianship, deep grooves and the feeling of a band playing together in the same room. Or, in this case... Beside a swimming pool on a hot night. 🌴🔥 Turn up the volume and let the Hammond take over. 🎹 Which instrument stands out to you the most in “Hammond Heatwave”? Leave a comment below and tell us. If you enjoy 70s funk, Hammond B3, jazz-funk, soul-jazz and vintage instrumental grooves, subscribe to the channel and join the journey. Keep Spinning. Keep Grooving. / @marceloceloca1763 ------------------------ 🇧🇷 PORTUGUÊS Groove funk dos anos 70, Hammond B3 e funk instrumental vintage se encontram em “Hammond Heatwave” — um groove quente inspirado na era de ouro do funk dos anos 70. Funk vintage, jazz-funk, soul-jazz, baixo elétrico, guitarra, bateria vintage e trompete se unem ao som inconfundível de um Hammond B3 quente e cheio de personalidade. Cercada por amigos, convidados, plantas tropicais, luzes coloridas e reflexos dançando na água, a banda entra em um groove instrumental profundo. No centro de todo esse calor está o som inconfundível do Hammond B3. Aumente o volume e deixe </video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394392/3394392_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-01T20:24:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boa tarde com Jesus🙏🏻</video:title>
      <video:description>🙏✨ Uma palavra de Deus pode mudar o seu dia. Que este versículo fortaleça sua fé, traga paz ao seu coração e lembre você de que Deus está sempre presente. ❤️ 📖 “Entrega o teu caminho ao Senhor; confia nele, e ele tudo fará.” — Salmos 37:5 Se essa mensagem falou com você, compartilhe com alguém que precisa ouvir isso hoje. 🙏 #DeusFéJesusVersiculoDoDiaBibliaPalavraDeDeusEvangelhoOraçãoDeusNoControleFéEmDeusJesusCristoBibliaSagradaVersiculosBiblicosMotivacaoPaz</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394391/3394391_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-01T20:24:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pipas A Arte Da infância</video:title>
      <video:description>🪁 Pipas: A Arte da Infância ❤️ Uma viagem de volta aos tempos em que a diversão era simples: uma pipa no céu, um vento bom e a alegria de brincar na rua. 🪁☀️ Cada pipa carrega uma lembrança, uma história e um pedacinho da infância que permanece para sempre em nossa memória. ✨ Pipas são mais do que brinquedos… são memórias voando pelo céu! #PipasArteDaInfânciaInfânciaBrincadeirasAntigasNostalgiaMemóriasPipaYouTubeShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394390/3394390_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T20:23:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BALEIA JUBATE A EMOÇÃO TOMOU CONTA DOS 2 TRIPULANTES DO BARCO</video:title>
      <video:description>EM OUTUBRO ATÉ MEIO DE SETEMBRO AD BALEIAS JUBARTES VEM RUMO AO LITORAL SUL DA BAHIA PARA REPRODUZIREM SEUS FILHOTES E APROVEITAREM AS ÁGUAS QUENTES DO ATLÂNTICO SUL. #BALEIAJUBARTE #BALEIAS #MAR #ATLANTICOSUL #SUL #BAHIA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394389/3394389_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T20:23:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu pássaro lindo</video:title>
      <video:description>Ela ama bichos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394387/3394387_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:23:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Xi-jinping chegou</video:title>
      <video:description>RECÉM-CHEGADO - Xi Jinping chegou ao Cairo para sua primeira visita ao Egito em uma década. As discussões se concentrarão em laços militares e econômicos, investimento chinês na Zona Econômica do Canal de Suez e a proposta da Huawei de construir data centers de IA para o governo. #Economia #xijiping #china #negocios</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394386/3394386_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-01T20:23:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT WHAT (Minecraft) #2</video:title>
      <video:description>WAIT WHAT (Minecraft) #2 If you enjoy this type of content and want to see more crazy adventures, subscribe to the channel and activate the bell so you don&apos;t miss any videos! I&apos;m just starting out and your support means a lot to me. So leave a like and share with your friends to help the channel grow — that way I can bring even more insane videos for you! Thanks for watching and for all the support! Let&apos;s go together on this crazy journey through the world of Minecraft. #Minecraft</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394385/3394385_720p.mp4</video:content_loc>
      <video:duration>482</video:duration>
      <video:publication_date>2026-09-01T20:23:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Golpes que eu não cairia</video:title>
      <video:description>#humor #comedia #engraçado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394384/3394384_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T20:23:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fall Deeply in Love | Episode 03 (Full)</video:title>
      <video:description>In the height of summer, amidst the ceaseless singing of cicadas in the rainy southern city of Qingyi, Xu Zhi—the &quot;Dark Horse of Ruijun&quot;—met Chen Luzhou, the &quot;Nude Model No. 1.&quot; Sparked by a misunderstanding, the love story between the arrogant &quot;Zhi Zong&quot; and &quot;Chen the Great Poet&quot; began... https://www.tiktok.com/@clubedas.historinhas #falldeeplyinlove #lovestory #romanticstory #romanceepisode #fullepisode #episode01 #romanticdrama #emotionallovestory #relationshipstory #truelove #fallinginlove #beautifullovestory #romanticmoments #loveandemotions #hearttouchingstory #romanticseries #loveseries #emotionalromance #couplestory #inspirationallovestory</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394383/3394383_720p.mp4</video:content_loc>
      <video:duration>2596</video:duration>
      <video:publication_date>2026-09-01T20:23:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394382</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394382/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>World of Warcraft: Warlords of Draenor Cinematic</video:title>
      <video:description>Enter the epic world of Draenor in the Warlords of Draenor cinematic. Witness powerful warriors, legendary battles, and a dark fantasy atmosphere filled with action, honor, and adventure. #WorldOfWarcraftWarlordsOfDraenorDraenorWoWCinematicEpicFantasyBlizzard</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394382/3394382_720p.mp4</video:content_loc>
      <video:duration>293</video:duration>
      <video:publication_date>2026-09-01T20:23:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hino do Flamengo ( Hino Popular )</video:title>
      <video:description>O mais querido dobrasil! Nosso site. https://radiocajaesportes.webradios.net/ #Futebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394381/3394381_720p.mp4</video:content_loc>
      <video:duration>133</video:duration>
      <video:publication_date>2026-09-01T20:22:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Yo y mi amiga</video:title>
      <video:description>Es mi éxito y quedamos como buenos amigos y ahora estoy buscando alguien , una buena mujer con bueno sentimientos y humilde</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394380/3394380_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T20:22:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pôr do sol</video:title>
      <video:description>Lindo por do sol #solpordosol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394379/3394379_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T20:22:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia na obra</video:title>
      <video:description>Dia dia na obra #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394378/3394378_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:22:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot-Air Balloon, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Hot-Air Balloon, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394377/3394377_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:21:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394376</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394376/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Se não existisse humanos ?</video:title>
      <video:description>será q a terra sem os seres humanos seria assim ? #humanos #seres #animais #floresta #extinção</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394376/3394376_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T20:21:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seu cavalo</video:title>
      <video:description>Ela apresenta seu cavalo para público. #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394375/3394375_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:21:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox Game Concept 🚀 | The Ultimate Futuristic Adventure</video:title>
      <video:description>🚀🎮 What if AI created the next big Roblox adventure? Explore this futuristic AI-generated game concept featuring an incredible virtual world, epic adventures and a completely new gaming experience. 🔥 Futuristic World 🎮 Roblox Game Concept 🤖 AI Generated 🚀 Epic Adventure 🌎 Virtual Gaming World #Roblox #RobloxGame #AIGame #AIGeneratedGame #GameConcept #RobloxConcept #FuturisticGame #AdventureGame #AIGaming #Gaming #VideoGame #VirtualWorld #EpicAdventure #FutureWorld #AIVideo #AIAnimation #CreativeAI #RobloxAdventure #GamingVideo #GameIdea</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394374/3394374_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:21:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deliciosa Sobremesa De Coco Cremosa</video:title>
      <video:description>Veja como você pode fazer em casa uma apetitosa sobremesa cremosa de coco #docedecoco #cocada #sobremesadecoco</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394372/3394372_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T20:21:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394371</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394371/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Pai encontrou a sua filha Perdida 😿</video:title>
      <video:description>O Pai encontrou a sua filha Perdida 😿</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394371/3394371_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T20:21:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394370</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394370/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sandália Modare Feminina</video:title>
      <video:description>O vídeo é sobre uma sandália que é muito elegante e confortável #VIAGENS</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394370/3394370_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T20:21:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mini dorama da tah #5</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394369/3394369_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:21:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Manda do meu pomar</video:title>
      <video:description>Ela.mostra a manda do pomar dela #Lilica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394368/3394368_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:20:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Facta unik</video:title>
      <video:description>a beautiful and resounding ravine #Use #read #fypp</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394367/3394367_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-01T20:20:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fennec Fox, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Fennec Fox, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394366/3394366_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:20:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mini dorama da tah #4</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394365/3394365_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:20:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia de capina</video:title>
      <video:description>Não é fácil Dia da roça.. #Lilica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394364/3394364_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:20:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394363</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394363/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mini dorama da tah #2</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394363/3394363_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:20:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DANGDUT 6</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. enjoy! #Dangdutmuaic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394362/3394362_720p.mp4</video:content_loc>
      <video:duration>420</video:duration>
      <video:publication_date>2026-09-01T20:20:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox Robot Dance 🤖😂 | Funniest Dance Ever!</video:title>
      <video:description>🤖😂 This AI Roblox robot just started dancing! A funny AI-generated gaming concept featuring a crazy dancing robot, Roblox-inspired characters and an unexpected dance moment. 🎮 Roblox Style 🤖 Dancing Robot 😂 Funny AI Video 🔥 Crazy Dance 🎨 AI Animation #Roblox #RobloxDance #RobotDance #AIRobot #AIRoblox #FunnyRoblox #FunnyDance #AIVideo #AIAnimation #AIGenerated #Gaming #RobloxCharacter #DancingRobot #CrazyDance #ViralDance #GamingShorts #FunnyGaming #RobotAnimation #GameConcept #VirtualCharacter</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394361/3394361_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T20:19:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TREME A ESTRUTURA - PAREDÃO PRIME / PISEIRO &amp; GRAVE PESADO DAQUELE JEITO</video:title>
      <video:description>TREME A ESTRUTURA - PAREDÃO PRIME / PISEIRO &amp; GRAVE PESADO DAQUELE JEITO / REPERTÓRIO NOVO | Top Só as Melhores |⏱️PISEIRO ESTOURADO O melhor do Piseiro, Forró e Beats Automotivos com grave pesado e sub bass de verdade! 🚀 O PAREDÃO PRIME Vol. 1 foi produzido para transformar qualquer ambiente em festa. Dá o play e deixa o som rolar no churrasco, no carro, na academia ou no rolê com os amigos! 🎧 Músicas 100% autorais e livres de direitos autorais para criadores de conteúdo (Stream Safe). 🔥 INSCREVA-SE NO CANAL: Acompanhe os melhores lançamentos semanais de Piseiro, Forró e Som Automotivo! 🔔 Ative o sininho para não perder nenhum set! #Paredao #music #forro #musicbrazil #dance</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394360/3394360_720p.mp4</video:content_loc>
      <video:duration>241</video:duration>
      <video:publication_date>2026-09-01T20:19:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mini dorama   da tah</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394359/3394359_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:19:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394358</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394358/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arrumando cama</video:title>
      <video:description>Jeito da roça de arrumar cama #Lilica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394358/3394358_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:19:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seahorse, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Seahorse, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394357/3394357_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:19:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Mom Has Superpowers! ✨</video:title>
      <video:description>In this fun and heartwarming kids&apos; song, follow a little girl as she discovers her mom’s ultimate secret: she’s actually a real-life superhero! From healing scrapes with magic kisses to giving the warmest hugs in the universe, moms truly have superpowers. #mom #music #children #cantatoon</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394356/3394356_720p.mp4</video:content_loc>
      <video:duration>122</video:duration>
      <video:publication_date>2026-09-01T20:19:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394355</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394355/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia de caminhada na roça</video:title>
      <video:description>Ela passeando com sua amiga pipoca .. #Lilica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394355/3394355_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:18:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ela cortou a bicicleta... Mas tinha uma surpresa!</video:title>
      <video:description>#Kpopdemonhunters</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394354/3394354_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-01T20:18:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby Otter, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Baby Otter, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394353/3394353_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:18:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazing Olympic Goal in International Superstar Soccer (SNES)</video:title>
      <video:description>Direct corner kick goal (Gol Olímpico) scored in International Superstar Soccer Deluxe on SNES! Retro soccer gameplay highlights. #snes #internationalsuperstarsoccer #gololimpico #retrogaming #snesgameplay #soccergame #cornerkickgoal #issdeluxe #konamiretro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394352/3394352_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-01T20:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia de trabalho</video:title>
      <video:description>Lilica tá construindo na roça.. #Lilica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394351/3394351_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:17:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Roblox Dinosaur Game 🦖🔥 | Epic Dino Adventure</video:title>
      <video:description>🦖🔥 What if Roblox had an epic dinosaur adventure? An AI-generated game concept featuring giant dinosaurs, an exciting virtual world and an epic prehistoric adventure. 🎮 AI Game Concept 🦖 Dinosaur Adventure 🔥 Roblox Style 🤖 AI Gaming 🌎 Virtual World #Roblox #RobloxGame #DinosaurGame #RobloxDinosaur #Dinosaurs #DinoGame #AIGame #AIGeneratedGame #AIVideo #AIAnimation #Gaming #VideoGame #GameConcept #DinoAdventure #Jurassic #DinosaurAdventure #EpicGame #SurvivalGame #VirtualWorld #AIGaming #GamingVideo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394350/3394350_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T20:17:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fall Madly in Love | Episode 02 (Full)</video:title>
      <video:description>비가 잦은 남쪽 도시 칭이(Qingyi), 매미 소리가 끊이지 않는 한여름. &apos;루이쥔(Ruijun)의 다크호스&apos;라 불리는 쉬즈(Xu Zhi)는 &apos;누드 모델 1호&apos; 천루저우(Chen Luzhou)와 마주칩니다. 사소한 오해로 시작된 인연, 오만한 &apos;즈 총(Zhi Zong)&apos;과 &apos;위대한 시인 천(Chen the Great Poet)&apos; 사이에 사랑 이야기가 피어나기 시작하는데... #falldeeplyinlove #lovestory #romanticstory #romanceepisode #fullepisode #episode01 #romanticdrama #emotionallovestory #relationshipstory #truelove #fallinginlove #beautifullovestory #romanticmoments #loveandemotions #hearttouchingstory #romanticseries #loveseries #emotionalromance #couplestory #inspirationallovestory</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394348/3394348_720p.mp4</video:content_loc>
      <video:duration>2814</video:duration>
      <video:publication_date>2026-09-01T20:17:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lilica e sua irmã helena</video:title>
      <video:description>O dia que elas estão juntas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394347/3394347_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:16:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394346</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394346/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>South Korea history train running status Evolution projection elevation</video:title>
      <video:description>South Korea #SouthKorea</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394346/3394346_720p.mp4</video:content_loc>
      <video:duration>395</video:duration>
      <video:publication_date>2026-09-01T20:16:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394345</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394345/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NOVO DORAMA: “MEU NOIVO MORREU… MAS ME MANDOU UMA MENSAGEM”   parte 1</video:title>
      <video:description>mini dorama parte 1 #dorama #kdrama #cdrama #jdrama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394345/3394345_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:16:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sweet templation 2</video:title>
      <video:description>Episode 2</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394344/3394344_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-09-01T20:16:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394342</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394342/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goiaba da roça</video:title>
      <video:description>Lilica tirando uma goiaba do pé, fruta maravilhosa #Lilica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394342/3394342_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:16:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jiu-jitsu A Arte Contemporanea</video:title>
      <video:description>É uma breve apresentação do projeto Jiu-jitsu que tem crescido diariamente, inúmeros adeptos com os mais váriados objetivos, buscam uma forma disciplinar de ter uma auto defesa, tonus muscular adequado , perda de peso , auto confiança e muito mais, nos siga que vamos mudar nossas mentes... #jiu-jitsu #perdadepeso #defesapessoal #autocontrole #forçamuscular #posiçõesdejiu-jitsu</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394341/3394341_720p.mp4</video:content_loc>
      <video:duration>253</video:duration>
      <video:publication_date>2026-09-01T20:16:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pois então</video:title>
      <video:description>Tapa</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394340/3394340_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-01T20:15:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby Elephant, GEL FORM</video:title>
      <video:description>A realistic hand slowly squeezes a sleek metallic tube with a polished nozzle. Instead of ordinary paste, a crystal-clear, softly glowing gel smoothly flows out. As the material emerges, it organically transforms into a tiny, beautifully sculpted Baby Elephant, taking shape layer by layer in one continuous motion. #AICREATIVECONTENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394339/3394339_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:15:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Elder Scrolls V: Skyrim - Official Trailer</video:title>
      <video:description>Enter the legendary world of Skyrim through its official trailer. Epic landscapes, ancient dragons, powerful warriors, and unforgettable music reveal the breathtaking atmosphere of The Elder Scrolls V: Skyrim. #SkyrimTheElderScrollsVSkyrimOfficialTrailerDragonbornEpicFantasyBethesda</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394338/3394338_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-09-01T20:15:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Asirlik Gece Episode 11</video:title>
      <video:description>Asirlik Gece Episode 11 #drama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394337/3394337_720p.mp4</video:content_loc>
      <video:duration>2965</video:duration>
      <video:publication_date>2026-09-01T20:15:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>해외여행에서 절대 하면 안 되는 행동 50가지</video:title>
      <video:description>해외여행을 떠나기 전에 꼭 알아야 할 50가지 행동을 소개합니다. 🌍✈️ 나라에 따라 평범한 행동도 실례가 되거나 문제가 될 수 있습니다. 일본 🇯🇵, 싱가포르 🇸🇬, 태국 🇹🇭, 미국 🇺🇸, 호주 🇦🇺 등 50개 국가의 문화와 여행 예절을 알아보세요! 여러분이 알고 있던 내용은 몇 가지인가요? 🤔 가장 놀라웠던 나라는 댓글로 알려주세요! 👇 #한국어키워드해외여행 #여행상식 #여행팁 #해외여행팁 #여행예절 #나라별예절 #세계문화 #문화차이 #나라별문화 #해외문화 #세계여행 #여행정보 #여행주의사항 #해외여행주의사항 #여행할때주의할점 #외국여행 #국가별정보 #세계정보 #재미있는상식 #흥미로운사실 #일본여행 #싱가포르여행 #태국여행 #미국여행 #호주여행 #유럽여행 #여행꿀팁 #문화예절 #글로벌상식 #세계의문화</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394336/3394336_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-01T20:15:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden depois do desafio lição do mestre</video:title>
      <video:description>Ninja Gaiden depois do desafio lição do mestre, sabias pakavras #Ninja</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394335/3394335_720p.mp4</video:content_loc>
      <video:duration>241</video:duration>
      <video:publication_date>2026-09-01T20:15:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lilica e pipoca</video:title>
      <video:description>Ela tem um onça de estimação linda . #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394334/3394334_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:14:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Guitarist vs Dubstep 🔥🎸 | Epic Guitar &amp; Bass Drop</video:title>
      <video:description>🎸🔥 What happens when an AI guitarist meets an insane dubstep bass drop? An original AI-generated music concept combining electric guitar, powerful riffs, electronic sounds and an epic dubstep drop. 🤖 AI Guitarist 🎸 Electric Guitar 🔥 Dubstep Drop 🎵 AI Music ⚡ Electronic Music #AIGuitarist #AIGuitar #Dubstep #GuitarDubstep #AIMusic #AIGeneratedMusic #GuitarSolo #ElectricGuitar #BassDrop #DubstepMusic #EpicGuitar #RockGuitar #ElectronicMusic #AIVideo #AIAnimation #MusicVideo #FutureMusic #GamingMusic #GuitarPlayer #ArtificialIntelligence</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394333/3394333_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:14:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂😂😂😂 6</video:title>
      <video:description>😂😂😂😂😂😂😂 #Franceestadosunidosangola</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394332/3394332_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-01T20:14:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WAIT WHAT - Minecraft #1</video:title>
      <video:description>WAIT WHAT - Minecraft #1 If you enjoy this type of content and want to see more crazy adventures, subscribe to the channel and activate the bell so you don&apos;t miss any videos! I&apos;m just starting out and your support means a lot to me. So leave a like and share with your friends to help the channel grow — that way I can bring even more insane videos for you! Thanks for watching and for all the support! Let&apos;s go together on this crazy journey through the world of Minecraft. #Minecraft</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394331/3394331_720p.mp4</video:content_loc>
      <video:duration>245</video:duration>
      <video:publication_date>2026-09-01T20:14:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394330</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394330/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Maritacas no coqueiro</video:title>
      <video:description>Maritacas no coqueiro #Brasil #EUA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394330/3394330_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T20:14:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Segredo de baixo da mesa</video:title>
      <video:description>Conto erótico sobre pés</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394329/3394329_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-09-01T20:13:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DORADO 👑</video:title>
      <video:description>DORADO 👑 DOS RIOS #UNITEDSTATES</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394328/3394328_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T20:13:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mostrando uma das frutas da roça</video:title>
      <video:description>Lilica cortando uma melancia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394327/3394327_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:13:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lot&apos;s wife who became a stone of salt.</video:title>
      <video:description>Lot&apos;s wife missed the city where God was burning due to sin, and God told Lot to get your family out of the city and don&apos;t look back, but Lot&apos;s wife looked and turned it over a stone of salt. #GodpunishmentLotsfamily</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394326/3394326_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T20:13:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus Cristo 6</video:title>
      <video:description>Jesus Cristo andando sobre águas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394325/3394325_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T20:13:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Especialmente pra você!</video:title>
      <video:description>Reflexão forte! #Reflexão #pensamento #autoestima</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394324/3394324_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T20:12:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As aventuras de brizu</video:title>
      <video:description>Beloca fazendo visitas #comediarisadasdiverção</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394323/3394323_720p.mp4</video:content_loc>
      <video:duration>379</video:duration>
      <video:publication_date>2026-09-01T20:12:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ Lobão estava brigando mais a sua mulher sua mulher tava dando carona no Lobão</video:title>
      <video:description>GTA mulher de Lobão estava dando uns conselhos nele para ele não sair mais seus amigos #gtahistóriaGTASanAndreasLobãoCJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394322/3394322_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T20:12:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorrinha brincando</video:title>
      <video:description>Cachorrinha brincando com seu brinquedo #Brasil #EUA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394321/3394321_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T20:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um forro miudo</video:title>
      <video:description>#forro</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394320/3394320_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T20:12:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394319</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394319/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny AI Roblox Dance 😂🔥 | Craziest Dance Ever!</video:title>
      <video:description>😂🔥 This AI Roblox character just went completely crazy with this dance! A funny and unexpected AI gaming moment featuring a crazy dance, virtual characters and Roblox-inspired action. 🎮 AI Gaming 😂 Funny Dance 🔥 Roblox Style 🤖 AI Animation #Roblox #RobloxDance #FunnyRoblox #FunnyVideo #AIVideo #AIAnimation #AIGenerated #FunnyDance #CrazyDance #Gaming #GameVideo #RobloxFunnyMoments #ViralVideo #Meme #GamingShorts #FunnyGaming #AIGaming #DanceChallenge #VirtualCharacter #Comedy</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394319/3394319_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:11:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vacas</video:title>
      <video:description>Quem gosta de animais #Leite #vacas #animais #carnê</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394318/3394318_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T20:11:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pramugari Cantik Wings Air Menyambut Penumpang Masuk Pesawat</video:title>
      <video:description>Pramugari Cantik Wings Air Menyambut Penumpang Masuk Pesawat 🥰🥰🙏🙏.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394317/3394317_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T20:11:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lilica da roça</video:title>
      <video:description>Retrata do dia dia da menina da roça como é o seu dia dia na roça. #Lilica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394315/3394315_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:11:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ Lobão e sua mulher estava muito desconfiado e fugiram</video:title>
      <video:description>GTA Lobão e sua mulher estava fugindo de fusca #gtahistóriaLobãoGTASanAndreacj</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394314/3394314_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T20:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Music indonesia 2</video:title>
      <video:description>Music is everything we do to please ourselves #Indonesia #musik #fyppp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394313/3394313_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T20:10:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A cidadania por nascimento deve ACABAR</video:title>
      <video:description>Essa troca DIZ TUDO Dep. Brandon Gill: &quot;É verdade que seu negócio &apos;Tenha Meu Bebê em Miami&apos; facilitou a entrada de estrangeiros que buscavam vir para os Estados Unidos para dar à luz e obter cidadania por nascimento para seus filhos?&quot; Dr. Lorentz: &quot;Eu invoco meus direitos da 5ª Emenda.&quot; A cidadania por nascimento deve ACABAR https://t.co/QI7GvVW5JG</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394312/3394312_720p.mp4</video:content_loc>
      <video:duration>139</video:duration>
      <video:publication_date>2026-09-01T20:10:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fall Deeply in Love | Episode 01 (Full)</video:title>
      <video:description>비가 잦은 남쪽 도시 칭이(Qingyi), 매미 소리가 끊이지 않는 한여름. &apos;루이쥔(Ruijun)의 다크호스&apos;라 불리는 쉬즈(Xu Zhi)는 &apos;누드 모델 1호&apos; 천루저우(Chen Luzhou)와 마주칩니다. 사소한 오해로 시작된 인연, 오만한 &apos;즈 총(Zhi Zong)&apos;과 &apos;위대한 시인 천(Chen the Great Poet)&apos; 사이에 사랑 이야기가 피어나기 시작하는데... #falldeeplyinlove #lovestory #romanticstory #romanceepisode #fullepisode #episode01 #romanticdrama #emotionallovestory #relationshipstory #truelove #fallinginlove #beautifullovestory #romanticmoments #loveandemotions #hearttouchingstory #romanticseries #loveseries #emotionalromance #couplestory #inspirationallovestory</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394311/3394311_720p.mp4</video:content_loc>
      <video:duration>2643</video:duration>
      <video:publication_date>2026-09-01T20:10:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394310</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394310/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pramugari hitung jumlah penumpang.mp4</video:title>
      <video:description>Pramugari hitung jumlah penumpang.mp4 #Pramugarihitungjumlahpenumpangmp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394310/3394310_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T20:10:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teachers of Arambagh Madrasah Aminia Islamia #madrasah #madrasalife #arambagh</video:title>
      <video:description>Teachers of Arambagh Madrasah Aminia Islamia #madrasah #madrasalife #arambagh #TeachersofArambaghMadrasahAminiaIslamiamadrasahmadrasalifearambagh</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394309/3394309_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T20:10:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ louvai sua mulher estavam desconfiando o restaurante</video:title>
      <video:description>GTA roubam e sua mulher estavam desconfiando do restaurante #gtahistóriaGTASanAndreasLobãocj</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394308/3394308_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T20:10:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DANGDUT 5</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. enjoy! #Dangdutmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394307/3394307_720p.mp4</video:content_loc>
      <video:duration>499</video:duration>
      <video:publication_date>2026-09-01T20:09:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jogo de passadeira em crochê</video:title>
      <video:description>Jogo de passadeira em crochê, ideal para usar na cozinha, quarto ou onde vc preferir🥰 #Crochê #artesanato #artesanal #tapedecrochê🧶</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394306/3394306_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T20:09:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Guitarist From The Future 🤖🎸 | Insane Rock Guitar Game Concept</video:title>
      <video:description>🤖🎸 Meet the guitarist from the future! An original AI-generated concept combining futuristic gaming, rock music, electric guitar and an epic virtual guitarist. Would you play a game like this? 🎮🔥 AI Guitarist • Future Game • Rock Guitar • AI Music • Gaming • Guitar Game • AI Animation #AIGuitarist #FutureGuitarist #AIMusic #AIRock #GuitarPlayer #GuitarSolo #RockMusic #AIAnimation #AIVideo #MusicGame #GuitarGame #FutureGame #SciFiGame #Gaming #VideoGameConcept #EpicGuitar #RockGuitar #VirtualGuitarist #ArtificialIntelligence #CreativeAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394305/3394305_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:09:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alinhamento Único de planetas no Brasil</video:title>
      <video:description>Evento Celestial Único no Brasil - um dos maiores segredos da história! Brasil. O papel do Cruzeiro do Sul nesta revelação, uma cronologia fascinante que vai mudar sua perspectiva #cruzeirodosul #brasil #jotaelbatista #ahistoriadoservo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394304/3394304_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-01T20:09:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Our Sticky Love Episode 01 | Hindi Dubbed | Full Episode | 720p HD</video:title>
      <video:description>Our Sticky Love – Episode 01 | Hindi Dubbed | 720p HD Watch Episode 01 of Our Sticky Love in Hindi. Enjoy the story, romance, emotions, and memorable moments in HD quality. 🎬 Series: Our Sticky Love 📺 Episode: 01 🗣️ Language: Hindi 🎥 Quality: 720p HD If you enjoy the episode, like 👍, Comment 💬, and Follow/Subscribe 🔔 for more episodes. #OurStickyLoveOurStickyLoveEpisode01OurStickyLoveHindiOurStickyLoveHindiDubbedOurStickyLoveEpisode1OurStickyLovefullepisodeOurStickyLove720pOurStickyLoveHDOurStickyLoveHindiepisodeHindidubbedseriesHindidubbeddramaHindiromanticdramaromanticseriesHindiepisode1HindinewHindidubbedseriesHindiseriesromancedramaOurStickyLovedrama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394303/3394303_720p.mp4</video:content_loc>
      <video:duration>3097</video:duration>
      <video:publication_date>2026-09-01T20:08:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Escute Este Som e Algo Vai Acontecer nas Próximas Horas!</video:title>
      <video:description>Escute Este Som e Algo Vai Acontecer nas Próximas Horas #meditação #meditation #relax #power brain #mind #meditação #meditation #relax #powerbrain #mind</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394300/3394300_720p.mp4</video:content_loc>
      <video:duration>2405</video:duration>
      <video:publication_date>2026-09-01T20:08:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pramugara Ganteng sedang Sibuk Kerja 😁👍👍.mp4</video:title>
      <video:description>Pramugara Ganteng sedang Sibuk Kerja 😁👍👍.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394299/3394299_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T20:08:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SKYRIM Dragonborn Theme CHOIR &amp; ORCHESTRA CONCERT | Music from OST Soundtrack(Dovahkiin)</video:title>
      <video:description>Experience the legendary Dragonborn Theme from Skyrim in a powerful choir and full orchestra concert. Epic vocals, massive orchestral arrangements, and cinematic energy bring the world of Dovahkiin to life. #SkyrimDragonbornDovahkiinChoirOrchestraSkyrimSoundtrackEpicFantasyMusicCinematicOrchestra</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394298/3394298_720p.mp4</video:content_loc>
      <video:duration>237</video:duration>
      <video:publication_date>2026-09-01T20:08:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dios te saca de lugares Podridos</video:title>
      <video:description>Este vídeo nos enseña que Dios nos saca de cualquier situación, para él no hay nada imposible #Reflexión</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394297/3394297_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T20:07:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lanterns_(2026)_S01_Ep_02_Hindi_Dubbed_Series_</video:title>
      <video:description>Lanterns_(2026)_S01_Ep_02_Hindi_Dubbed_Series_ Lanterns_(2026)_S01_Ep_02_Hindi_Dubbed_Series_Lanterns_(2026)_S01_Ep_02_Hindi_Dubbed_Series_Lanterns_(2026)_S01_Ep_02_Hindi_Dubbed_Series_Lanterns_(2026)_S01_Ep_02_Hindi_Dubbed_Series_Lanterns_(2026)_S01_Ep_02_Hindi_Dubbed_Series #Lanterns_2026_S01_Ep_02_Hindi_Dubbed_Series</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394295/3394295_720p.mp4</video:content_loc>
      <video:duration>3105</video:duration>
      <video:publication_date>2026-09-01T20:07:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OS PREDADORES MAIS MORTAIS QUE JÁ DOMINARAM OS OCEANOS</video:title>
      <video:description>🌊 Antes dos grandes tubarões, monstros gigantes já dominavam os oceanos. Alguns eram tão assustadores que quase nenhum animal conseguia enfrentá-los. 🦈 #predadoresdooceano #predadoresmarinhos #monstrosmarinhos #oceanoantigo #animaispré-históricos #predadorespré-históricos #criaturasmarinhas #tubarõesgigantes #megalodonte #oceanosantigos #animaisgigantes #vidamarinha #históriadosoceanos #criaturasantigas #evoluçãodosanimais #mistériosdooceano #animaisassustadores #mundopré-histórico</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394293/3394293_720p.mp4</video:content_loc>
      <video:duration>458</video:duration>
      <video:publication_date>2026-09-01T20:07:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Price of Confession EP 9 Hindi Sub Dub</video:title>
      <video:description>Watch The Price of Confession Episode 9 in Hindi dubbed. Enjoy this amazing mystery Korean drama series and subscribe for more episodes #​KdramaHindiDubbedThePriceOfConfessionKoreanDramaMysterySeries</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394292/3394292_720p.mp4</video:content_loc>
      <video:duration>2467</video:duration>
      <video:publication_date>2026-09-01T20:06:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#humor#dante#corts</video:title>
      <video:description>#Dante🤣</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394291/3394291_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-01T20:06:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GAME HOLOLIVE DREAMS</video:title>
      <video:description>MUSIC AND RPG - HOLOLIVE DREAMS #GAME</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394290/3394290_720p.mp4</video:content_loc>
      <video:duration>392</video:duration>
      <video:publication_date>2026-09-01T20:05:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PSALM 8</video:title>
      <video:description>Psalm 8 was written by King David. It is a song of praise to God, exalting His creation and the special position of humanity within it. As a shepherd before becoming king, David likely wrote this psalm inspired by his reflections on the heavens and the natural world. #ChristianFaith #GodsWord #Inspiration #FaithOverFear #BibleVerse #HopeInGod #FaithInAction #GospelTruth #WalkByFaith #BibleStories #BibleLessons #BiblicalTeachings #StoriesOfFaith #ScriptureStories #BibleStudy #FaithJourney #BibleTruth #JesusStories #Prayer #Faith #ChristianPrayer #DailyPrayer #PrayerLife #PrayersOfFaith #PrayerForToday #GodsPlan #PrayerWarrior #PrayWithMe #Psalms #TrustInGod #JesusSaves #ChristianLife #DailyScripture #BibleQuotes #WorshipGod #PraiseTheLord #GodIsGood</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394288/3394288_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T20:05:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AI Guitar Hero Game Concept 🎸 | Epic Guitarist Battle &amp; Music Game</video:title>
      <video:description>🎸 What if an AI created the ultimate guitar game? Watch this epic AI-generated game concept featuring a powerful guitarist, intense music, virtual guitar battles and a futuristic gaming experience. If you enjoy AI videos, music games, guitar, gaming concepts and creative technology, this video is for you! 🎮 AI Game Concept 🎸 Guitarist Battle 🎵 Music Game 🤖 AI Generated Video 🔥 Epic Guitar Performance Follow for more AI-generated gaming ideas and creative videos! #AIGame #AIGeneratedGame #GuitarGame #GuitaristGame #MusicGame #GuitarHero #GuitarBattle #EpicGuitarist #AIAnimation #AIVideo #Gaming #VideoGameConcept #GameConcept #MusicGaming #RockGuitar #GuitarSolo #VirtualGuitarist #FutureGame #CreativeAI #ArtificialIntelligence</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394287/3394287_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T20:05:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ikatan Darah (2026)</video:title>
      <video:description>A former martial artist must confront a network of loan sharks to save his younger brother, who is trapped in online gambling debt and endangering their family&apos;s safety. #filmhorror #filmcomedy #filmwar #filmadventure #filmfamily #filmanima #filmfantasy #filmaction #drama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394286/3394286_720p.mp4</video:content_loc>
      <video:duration>7176</video:duration>
      <video:publication_date>2026-09-01T20:05:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Te hice mal</video:title>
      <video:description>Te Hice Mal – Reguetón Romántico Una canción sobre el arrepentimiento de perder a la persona que amabas por no saber valorar su amor. 💔 A veces nos damos cuenta demasiado tarde de que nuestras decisiones lastimaron a alguien que solo quería quedarse a nuestro lado. 🎤 Voz masculina y femenina 🔥 Reguetón romántico 💔 Amor • arrepentimiento • desamor 🎶 Una historia para quienes alguna vez dijeron: “Perdón, te hice mal.” Si esta canción te llegó al corazón, suscríbete, dale 👍 y compártela con esa persona que necesita escucharla. ❤️‍🩹</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394285/3394285_720p.mp4</video:content_loc>
      <video:duration>217</video:duration>
      <video:publication_date>2026-09-01T20:04:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>when a puppy is waiting to be adopted.</video:title>
      <video:description>The video shows the joy of seeing a happy dog ​​upon being noticed. #Dog #adoption #happiness</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394284/3394284_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T20:04:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What Was That? 😂</video:title>
      <video:description>#funny #comedy #animation #funnydog #giantdog #viralcomedy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394283/3394283_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T20:04:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PSALM 7</video:title>
      <video:description>Psalm 7 was written by King David. This psalm is a plea to God for justice against his enemies. It is also described as a &quot;Shiggaion of David,&quot; which may refer to a song or poem of intense emotion, written by the author during a time of unjust accusations. #ChristianFaith #GodsWord #Inspiration #FaithOverFear #BibleVerse #HopeInGod #JesusChrist #FaithInAction #GospelTruth #WalkByFaith #BibleStories #BibleLessons #BiblicalTeachings #StoriesOfFaith #ScriptureStories #BibleStudy #FaithJourney #BibleTruth #JesusStories #Prayer #Faith #ChristianPrayer #DailyPrayer #PrayerLife #PrayersOfFaith #PrayerForToday #GodsPlan #PrayerWarrior #PrayWithMe #psalm #psalm7 #psalms</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394282/3394282_720p.mp4</video:content_loc>
      <video:duration>129</video:duration>
      <video:publication_date>2026-09-01T20:03:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Most Expensive Key I&apos;ve Ever Held</video:title>
      <video:description>Ever wondered what it feels like to hold the key to one of the most exclusive cars in the world? In this video, I show up close the key to the Bugatti Chiron Pur Sport, a hypercar that represents the pinnacle of automotive engineering. Only a handful of units exist on the planet, and every detail — even the key — carries the exclusivity of the French brand. If you&apos;re into luxury cars, hypercars, and automotive curiosities, subscribe to the channel to catch more content like this! #PurSport #hypercar #luxurycar #exoticcars #supercar #expensivecarkey #luxurydealership #dreamcars #automotive #luxurycars #mostexpensivecarintheworld #carreveal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394280/3394280_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T20:03:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Historia de terror &quot; la isla de los lamentos&quot;</video:title>
      <video:description>Un grupo de amigos viaja a la isla de los lamentos donde poco a poco ,cada uno de ellos va desapareciendo hasta solo quedar un solo sobreviviente. #Terroroscuro #leyendasurbanas #misterio #terrorpsicologico #supernatural #miedo #historiadeterror</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394279/3394279_720p.mp4</video:content_loc>
      <video:duration>361</video:duration>
      <video:publication_date>2026-09-01T20:02:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LULA COMPARA CASO DO FILHO À LAVA JATO!!!</video:title>
      <video:description>🚨 LULA COMPARA CASO DO FILHO À LAVA JATO O presidente Lula fez uma comparação entre as investigações envolvendo seu filho, Fábio Luís Lula da Silva (Lulinha), e o que ocorreu durante a Operação Lava Jato. A declaração reacendeu o debate sobre investigações, exposição pública e o impacto político de casos envolvendo familiares de autoridades. 🔎 O que Lula quis dizer com a comparação? 👉 Assista ao vídeo e confira a declaração completa. #Lula #Lulinha #LavaJato #Política #Brasil #STF #Justiça #Notícias</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394278/3394278_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T20:01:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394277</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394277/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boa tarrde</video:title>
      <video:description>Deus faz a obra</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394277/3394277_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T20:01:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Try NOT to Laugh Episode 2! Top 7 funniest</video:title>
      <video:description>Funny #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394276/3394276_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T20:01:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O FAROESTE EM 1880: A ÉPOCA EM QUE UM ERRO PODIA CUSTAR A VIDA</video:title>
      <video:description>🏜️ Em 1880, o Velho Oeste escondia histórias que quase ninguém ousava contar. Xerifes, pistoleiros, cidades sem lei e segredos enterrados no deserto. Você teria sobrevivido a essa época? #faroeste #velhooeste #1880 #históriasdefaroeste #oesteamericano #pistoleiros #xerife #cowboys #cidadesdovelhooeste #históriasocultas #mistériosdovelhooeste #lendasdofaroeste #históriaamericana #vidanovelhooeste #armasdofaroeste #históriasantigas #oesteselvagem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394275/3394275_720p.mp4</video:content_loc>
      <video:duration>397</video:duration>
      <video:publication_date>2026-09-01T20:01:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PSALM 6</video:title>
      <video:description>Psalm 6 was written by King David. He is traditionally recognized as the author of many of the psalms in the Book of Psalms, including this one, which reflects a time of deep distress and a plea to God for mercy and healing. #ChristianFaith #GodsWord #Inspiration #FaithOverFear #BibleVerse #HopeInGod #JesusChrist #FaithInAction #GospelTruth #WalkByFaith #BibleStories #BibleLessons #BiblicalTeachings #StoriesOfFaith #ScriptureStories #BibleStudy #FaithJourney #BibleTruth #JesusStories #Prayer #Faith #ChristianPrayer #DailyPrayer #PrayerLife #PrayersOfFaith #PrayerForToday #GodsPlan #PrayerWarrior #PrayWithMe #psalm6 #psalm</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394274/3394274_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T20:01:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Une promenade au bord du lac, entre rêve et aventure</video:title>
      <video:description>Dans un village pittoresque niché entre les montagnes, un jeune aventurier avance paisiblement le long du port, accompagné d’un curieux canard. Entre les maisons colorées, les bateaux paisiblement amarrés et les eaux scintillantes, cette promenade offre une parenthèse chaleureuse et poétique, comme une scène sortie d’un conte.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394273/3394273_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T20:01:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Sheer Chic Lace Thong Try-On Showcase! ✨ Tap &apos;Follow&apos; for more looks.</video:title>
      <video:description>Trying on the ultimate sexy, sheer, and chic lace thong today! Absolutely obsessed with how elegant and gorgeous these details look. ✨🖤 ✨ Tap the &quot;Follow&quot; button right now to support my channel and stay updated with my daily fashion drops! Let me know your thoughts in the comments below! 👇 #lingerietryonhaullacesetsheerthongchiclondonfashioninspousagorgeousbeautyforyou</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394272/3394272_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T20:01:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deus faz a obra</video:title>
      <video:description>Deus é fiell</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394271/3394271_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T20:01:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prank Gone Wrong 2</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394270/3394270_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T20:00:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time to Fall in Love EP04 Exchange identity to become CEO’s gf Luo Zheng, Lin Xinyi.mp4</video:title>
      <video:description>*Time to Fall in Love* is a Chinese romantic comedy centering on Su Yan Xi, an optimistic and independent livestreamer. To help cover her ailing mother&apos;s medical expenses, she accepts a risky proposition: assuming her twin sister&apos;s identity and signing a contract to become the girlfriend of Gu Xi Cheng, the CEO of a major corporation. Gu Xi Cheng is a cold, methodical man who sought this fake relationship solely to fulfill his sick grandmother&apos;s wish. However, living together and Su Yan Xi&apos;s vibrant personality begin to melt the executive&apos;s icy exterior, transforming the charade into a genuine, sweeping romance. #TimetoFallinLove #C-Drama #ChineseDrama #Romance #RomanticComedy #ContractRelationship #FakeDating #ContractGirlfriend #CEORomance #MistakenIdentity #TwinSisters #LuoZheng #LinXinyi #FakeLove #ForcedProximity #RichCEO #OppositesAttract</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394268/3394268_720p.mp4</video:content_loc>
      <video:duration>2592</video:duration>
      <video:publication_date>2026-09-01T20:00:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MONTAGEM ELDER</video:title>
      <video:description>#abdodata</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394267/3394267_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T19:59:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Que delícia</video:title>
      <video:description>Quem já provou se escreve e comenta que delícia #Euquero #quedelícia #comfaço</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394266/3394266_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T19:59:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;Pink Panther&quot; never disappoints me 😂</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394265/3394265_720p.mp4</video:content_loc>
      <video:duration>145</video:duration>
      <video:publication_date>2026-09-01T19:59:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎸🔥 THE ULTIMATE AI GUITAR GAME!</video:title>
      <video:description>What if you could become a legendary guitarist inside an epic video game? 🎮🎸 Rock the stage, master insane guitar solos, unlock powerful guitars and build your own music career! 🤘🔥 This is an AI-generated game concept — would you play it? 🎸 Epic guitar battles 🔥 Insane solos 🎮 AI game concept 🏆 Become a rock legend! Watch until the end and tell me: WOULD YOU PLAY THIS GAME? 👇 #Guitar #GuitarGame #RockMusic #AIGaming #AI #Gaming #MusicGame #Guitarist #Rock #Gameplay #GameConcept #Viral #Trending #Febspot</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394264/3394264_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:59:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sintonia ritmica</video:title>
      <video:description>sua sonora diária para focar relaxar estudar seleções exclusivas com os melhores da música instrumental lofi e beats relaxante para acalmar a mente #Músicaparaestudarrelaxarinstrumentalfocoplaylistrelaxaafundomusical</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394263/3394263_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T19:59:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Was Sick… But What Happened Next Was HILARIOUS 😂🤣</video:title>
      <video:description>He Was Sick… But What Happened Next Was HILARIOUS 😂🤣 📝 He looked like he was having a really bad day… 😭😂 But what happens next completely changes the situation! Watch until the end to see the unexpected twist. 🤣🔥 If you enjoy funny videos, hilarious moments, unexpected twists, comedy clips, and viral videos, follow for more entertaining content! 👍 Like • 🔄 Share • ❤️ Follow for more! 🏷️ funny video, funny moments, hilarious, comedy, comedy video, funny clips, viral video, viral clips, unexpected moment, unexpected twist, funny reaction, hilarious reaction, crazy moment, entertaining video, funny scene, comedy clips, funny short video, viral funny video, laugh, funniest moments, humor, funny content, trending video, funny people, shocking twist, watch until the end, you wont believe what happens, febspot, viral video 2026 🚀 #funnyvideo #funnymoments #hilarious #comedy #comedyvideo #funnyclips #viralvideo #viralclips #unexpectedmoment #unexpectedtwist #funnyreaction #hilariousreaction #crazymoment #entertainingvideo #funnyscene #comedyclips #funnyshortvideo #viralfunnyvideo #laugh #funniestmoments #humor #funnycontent #trendingvideo #funnypeople #shockingtwist #watchuntiltheend #youwontbelievewhathappens #febspot #viralvideo2026🚀FunnyComedyFunnyVideoHilariousViralFunnyMomentsUnexpectedComedyClipsViralVideoTrendingLaughFebspo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394262/3394262_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T19:59:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME AZUR LANE BISOKU KENSHIN</video:title>
      <video:description>AZUR LANE #ANIME</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394261/3394261_720p.mp4</video:content_loc>
      <video:duration>488</video:duration>
      <video:publication_date>2026-09-01T19:58:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ya no te creo</video:title>
      <video:description>YA NO TE CREO — Reguetón romántico Una historia de amor, mentiras y decepción. ❤️‍🩹 Dos personas que todavía sienten algo, pero después de tantas heridas ya no pueden volver a ser los mismos. Una canción para quienes alguna vez dijeron: “Te amo, pero ya no te creo.” 🎤 Voces masculina y femenina 🔥 Reguetón romántico urbano 💔 Amor, desamor y traición Si alguna vez te rompieron el corazón, esta canción es para ti. 👍 Dale Like 💬 Comenta qué parte de la canción te representa 🔔 Suscríbete para escuchar más música</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394260/3394260_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-09-01T19:58:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sonho realizado</video:title>
      <video:description>Nunca desista dos seus sonhos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394258/3394258_720p.mp4</video:content_loc>
      <video:duration>277</video:duration>
      <video:publication_date>2026-09-01T19:58:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lindinho</video:title>
      <video:description>Gato falante</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394257/3394257_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T19:58:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Casa de pano</video:title>
      <video:description>Semente de construcasa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394256/3394256_720p.mp4</video:content_loc>
      <video:duration>308</video:duration>
      <video:publication_date>2026-09-01T19:57:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vamos Vencer,🇧🇷🇧🇷 22</video:title>
      <video:description>Flavio Bolsonaro nosso Presidente #Eleição #voto #urnas #22 #pl #AndréGaspar #andremendonca</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394255/3394255_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T19:57:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🙏 WHAT IS THE REQUEST YOU ARE MAKING TO GOD?</video:title>
      <video:description>🙏 WHAT IS THE REQUEST YOU ARE MAKING TO GOD? #faith #prayer #prayer Subscribe to our Channel #Fe</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394254/3394254_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:57:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Konosuba</video:title>
      <video:description>#Anime #wolrd #konosuba</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394253/3394253_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T19:57:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;His friends came to rescue him.&quot; 🛟</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394252/3394252_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T19:57:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ROCKY BALBOA BSO FULL ORCHESTRA</video:title>
      <video:description>Experience the legendary Rocky Balboa soundtrack in a powerful full-orchestra performance. Epic melodies, emotional arrangements, and inspiring orchestral energy capture the spirit of determination, resilience, and victory. #RockyBalboaRockySoundtrackFullOrchestraMotivationalMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394251/3394251_720p.mp4</video:content_loc>
      <video:duration>280</video:duration>
      <video:publication_date>2026-09-01T19:57:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PSALM 5</video:title>
      <video:description>Psalm 5 is traditionally attributed to King David, as stated in its title: &quot;To the chief Musician upon Nehiloth, A Psalm of David.&quot; It is a prayer for guidance, protection, and justice, emphasizing David&apos;s reliance on God while contrasting the righteous with the wicked. #ChristianFaith #GodsWord #Inspiration #FaithOverFear #BibleVerse #HopeInGod #JesusChrist #FaithInAction #GospelTruth #WalkByFaith #BibleStories #BibleLessons #BiblicalTeachings #StoriesOfFaith #ScriptureStories #BibleStudy #FaithJourney #BibleTruth #JesusStories #Prayer #Faith #ChristianPrayer #DailyPrayer #PrayerLife #PrayersOfFaith #PrayerForToday #GodsPlan #PrayerWarrior #PrayWithMe #Psalm5 #Psalms #Thebookofpsalms</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394250/3394250_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-01T19:57:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comédia brasileira</video:title>
      <video:description>Comédia stand up</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394249/3394249_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T19:56:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral Islamic Song- Melodious Praise for Prophet Muhammad#songislamic #shorts.mp4</video:title>
      <video:description>Viral Islamic Song- Melodious Praise for Prophet Muhammad#songislamic #shorts.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394248/3394248_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T19:56:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I want it 4</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394247/3394247_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T19:56:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eternal - Mark Nadilo</video:title>
      <video:description>&quot;Eternal&quot; is a Mark Nadilo song from his earlier catalog, released in 2025. Listen to &amp; download &quot;Eternal&quot;: Official discography: https://marknadilo.bandcamp.com/music Credits: ℗ Eternal ℗ Mark Nadilo Original year: 2011 Release year: 2025 and 2026 #eternal #marknadilo #poprock #music #romanticworldmusic #eternalloveworld</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394246/3394246_720p.mp4</video:content_loc>
      <video:duration>243</video:duration>
      <video:publication_date>2026-09-01T19:55:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SE VOCÊ QUER MUDANÇA OUÇA ESSA ORAÇÃO</video:title>
      <video:description>ORAÇÃO FORTE PRA QUEM QUER UMA MUDANÇA EM SUA VIDA #Oração #fé #Deus #salmos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394245/3394245_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-01T19:55:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PSALM 4</video:title>
      <video:description>Psalm 4 is traditionally attributed to King David, as indicated in the psalm&apos;s title: &quot;To the chief Musician on Neginoth, A Psalm of David.&quot; While the exact context of its composition is not specified, it reflects David&apos;s trust in God during times of distress and his reliance on divine righteousness and peace. #psalmsofdavid #psalm #psalm 4 #holybible #thebookofpsalms #ChristianFaith #GodsWord #Inspiration #FaithOverFear #BibleVerse #HopeInGod #JesusChrist #FaithInAction #GospelTruth #WalkByFaith #BibleStories #BibleLessons #BiblicalTeachings #StoriesOfFaith #ScriptureStories #BibleStudy #FaithJourney #BibleTruth #JesusStories #Prayer #Faith #ChristianPrayer #DailyPrayer #PrayerLife #PrayersOfFaith #PrayerForToday #GodsPlan #PrayerWarrior #PrayWithMe #Psalm4 #Psalms #TheBookofpsalms</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394243/3394243_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T19:55:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ready for Takeoff to Saudi Arabia! ✈️🇸🇦 #shorts #pilot #airindia #saudiarabia.mp4</video:title>
      <video:description>Ready for Takeoff to Saudi Arabia! ✈️🇸🇦 #shorts #pilot #airindia #saudiarabia.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394242/3394242_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T19:55:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Rebellion of the Angels</video:title>
      <video:description>The Rebellion of the Angels</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394241/3394241_720p.mp4</video:content_loc>
      <video:duration>187</video:duration>
      <video:publication_date>2026-09-01T19:54:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394240</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394240/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não desanime no meio do processo: quanto maior a prensa, maior o óleo derramado sobre a sua vida!</video:title>
      <video:description>Não desanime no meio do processo: quanto maior a prensa, maior o óleo derramado sobre a sua vida! Compartilhe com quem precisa ouvir isso hoje! #louvor , #adoração ,#ministração , #fé, #milagre @CarolBraga #louvor #adoração #ministração #fé #milagre</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394240/3394240_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T19:54:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394239</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394239/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pramugara Ganteng lagi Menyambut Penumpang Masuk Pesawat 💪💪👍👍.mp4</video:title>
      <video:description>Pramugara Ganteng lagi Menyambut Penumpang Masuk Pesawat 💪💪👍👍.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394239/3394239_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T19:54:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Poetry write by Ab</video:title>
      <video:description>Poetry write by Ab for more poetry follow me Facebook 🙏 #Poetryquotesshayariviralnewvideo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394238/3394238_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T19:54:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394237</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394237/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>👑 The King of Skills – Neymar Jr🇧🇷👑🏆✅</video:title>
      <video:description>👑 The King of Skills – Neymar Jr🇧🇷👑🏆✅ Brazil Super Star 🇧🇷🫶❤️ #NeymarJrTagsNeymarJrNeymarFootballSkillsGoalsBrazilFootballShortsSoccerShortsFIFAGamingViralTrending</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394237/3394237_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T19:54:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dietas e suplemento para emagrecer</video:title>
      <video:description>OFERTA ESPECIAL MONJA GOTAS suplemento alimentar que te ajuda e acelera o seu emagrecimento. PEÇA JÁ O SEU E PAGUE SOMENTE QUANDO O PRODUTO CHEGA NA SUA CASA! LINK AZUL FIXADO NO MEU PERFIL. https://app.coinzz.com.br/checkout/1-unidade-dkrcp-0 #emagrecimento #dietas #receitas #saúde #fitness</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394236/3394236_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:54:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quedate conmigo</video:title>
      <video:description>“Quédate Conmigo” es un reguetón romántico para dedicarle a esa persona que hace que todo tenga sentido. Una canción llena de amor, deseo y promesas, perfecta para quienes quieren amar sin miedo. 🥰❤️ 🎶 Dale play, compártela y dedícasela a esa persona especial. 💬 ¿A quién le dedicarías “Quédate Conmigo”?</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394235/3394235_720p.mp4</video:content_loc>
      <video:duration>227</video:duration>
      <video:publication_date>2026-09-01T19:54:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Júri condena empresário corintiano por matar esposa palmeirense</video:title>
      <video:description>Júri condena empresário corintiano por matar esposa palmeirense</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394234/3394234_720p.mp4</video:content_loc>
      <video:duration>165</video:duration>
      <video:publication_date>2026-09-01T19:54:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Scientist 🧬🥼 🤣🤣</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394233/3394233_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-01T19:54:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, VALE DE OSSOS SECOS.</video:title>
      <video:description>#Louvorgospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394232/3394232_720p.mp4</video:content_loc>
      <video:duration>331</video:duration>
      <video:publication_date>2026-09-01T19:54:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why Is Obeying Important?</video:title>
      <video:description>Obeying is not simply about following rules. It is about learning to listen, understand guidance, and make choices that keep us safe and help us grow. ❤️ When children learn to obey their parents, teachers, and those who care for them, they develop important values such as respect, responsibility, discipline, and self-control. Sometimes, we may not understand why a rule exists, but following good guidance can protect us from mistakes and help us become wiser and more responsible. ✨ Obedience today can help build wisdom, responsibility, and a better future tomorrow. #importanceofobedience #importanceofobeying #teachingchildrenobedience #obedienceforkids #listeningtoparents #followingrules #respectandobedience #disciplineforchildren #responsibilityforkids #goodchoices #lifelessonsforchildren #childrenseducation #moralvalues #positivebehavior #selfdiscipline #respectforparents #kidslearning #familyvalues #characterdevelopment #educationalvideo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394231/3394231_720p.mp4</video:content_loc>
      <video:duration>409</video:duration>
      <video:publication_date>2026-09-01T19:54:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teaser: kpop academy</video:title>
      <video:description>#Anime</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394230/3394230_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-09-01T19:54:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Way Ticket - Tanja Thomas - bye bye love - Lyrics #music #lyricsvideo #shorts.mp4</video:title>
      <video:description>One Way Ticket - Tanja Thomas - bye bye love - Lyrics #music #lyricsvideo #shorts.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394229/3394229_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T19:53:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piscina limpa agua perfeita</video:title>
      <video:description>Hora de fechar a piscina #Piscina #agualimpaproficional</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394228/3394228_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T19:53:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME SKELETON KNIGHT SEASON 2</video:title>
      <video:description>SKELETON KNIGHT #ANIME</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394226/3394226_720p.mp4</video:content_loc>
      <video:duration>447</video:duration>
      <video:publication_date>2026-09-01T19:52:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trailer – REBORN ROOKIE / 예고편 – 리본 루키</video:title>
      <video:description>Trailer – REBORN ROOKIE / 예고편 – 리본 루키 #dorama #doramas #dorama2022 #dorama2023 #doonadorama #doramabrasil #doramanetflix #doramadublado #doramacoreano #resumendedorama #doramasnetflix #melhoresdoramas #kdrama #doramasenespanol #doramasenminutos #resumendedoramas #doramasdubladosem #drama #ondeassistirdoramas #cdrama #belezaverdadeiradorama #jdrama #shortdrama #koreandrama #dramadeamor #shortsdrama #melhoresdoramasdanetflix #shortdramas #newdrama #dramacoreano #kdramashorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394225/3394225_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-01T19:52:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pramugari cantik announcment sebelum take off.mp4</video:title>
      <video:description>Pramugari cantik announcment sebelum take off.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394224/3394224_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T19:51:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PSALM 3</video:title>
      <video:description>Psalm 3 was written by King David. The psalm&apos;s title explicitly attributes it to him and provides context: &quot;A Psalm of David, when he fled from Absalom his son.&quot; This refers to the time when David fled Jerusalem to escape the rebellion led by his son Absalom, as recorded in 2 Samuel 15–18. The psalm expresses David&apos;s trust in God amidst the distress and danger of that situation. #holybiblepsalmpsalmsofdavidpsalm3thebookofpsalms #FaithOverFear #BibleVerse</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394223/3394223_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T19:51:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny</video:title>
      <video:description>Funny videos #funny #viral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394222/3394222_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:51:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394221</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394221/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden primeiro desafio difícil</video:title>
      <video:description>Ninja Gaiden primeiro desafio difícil , mais passei dele com dificuldades... #Ninja</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394221/3394221_720p.mp4</video:content_loc>
      <video:duration>241</video:duration>
      <video:publication_date>2026-09-01T19:50:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHAVES - EPISÓDIO PERDIDO parte 2</video:title>
      <video:description>#chaves3dmemeschaves</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394220/3394220_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-01T19:50:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dangdut 54</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. enjoy! #Dangdutmusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394219/3394219_720p.mp4</video:content_loc>
      <video:duration>495</video:duration>
      <video:publication_date>2026-09-01T19:50:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afraid of what the day holds? Listen to this prayer.</video:title>
      <video:description>Before leaving home, place your entire day in God&apos;s hands. This morning prayer combines Psalm 91 (protection) and Psalm 23 (peace and provision) for anyone who wakes up anxious about what the day might bring—work, bills, difficult decisions, or family concerns. If this prayer spoke to your heart, leave an &quot;Amen&quot; in the comments and share it with someone else who needs to start their day in peace. 📖 Biblical basis: Psalm 91 and Psalm 23 (faithful devotional paraphrase) 🙏 For those who: wake up anxious, fear what the day holds, or need a moment of peace before leaving home 🌙 Didn&apos;t sleep peacefully last night? Watch the Night Prayer based on Psalm 23. #Psalm91 #Psalm23 #God</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394218/3394218_720p.mp4</video:content_loc>
      <video:duration>312</video:duration>
      <video:publication_date>2026-09-01T19:50:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resolução de questões de Matemática Básica</video:title>
      <video:description>Resolução de questões de Porcentagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394217/3394217_720p.mp4</video:content_loc>
      <video:duration>191</video:duration>
      <video:publication_date>2026-09-01T19:49:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ele ia terminar com ela</video:title>
      <video:description>dorama mini #dorama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394215/3394215_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T19:49:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ToyotaSupra Smoke Nagata</video:title>
      <video:description>#ToyotaSupraCarroSmokeNagata</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394214/3394214_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T19:49:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PEGOU UM PEIXE NO MAR</video:title>
      <video:description>PESCADORA PEGOU UM NO MAR #UNITEDSTATES</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394213/3394213_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T19:49:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PSALM 2</video:title>
      <video:description>Psalm 2 is traditionally attributed to King David, as suggested in the New Testament. In Acts 4:25, it is stated: &quot;You spoke by the Holy Spirit through the mouth of your servant, our father David: &apos;Why do the nations rage and the peoples plot in vain?&apos;&quot; While the psalm itself does not explicitly name David as the author, this New Testament reference supports the traditional view that David wrote it. Psalm 2 is considered a royal psalm and is often seen as messianic, pointing to the reign of God&apos;s anointed king. #ChristianFaith #GodsWord #Inspiration #FaithOverFear #BibleVerse #HopeInGod #JesusChrist #FaithInAction #GospelTruth #WalkByFaith #BibleStories #BibleLessons #BiblicalTeachings #StoriesOfFaith #ScriptureStories #BibleStudy #FaithJourney #BibleTruth #JesusStories #Prayer #Faith #ChristianPrayer #DailyPrayer #PrayerLife #PrayersOfFaith #PrayerForToday #GodsPlan #PrayerWarrior #PrayWithMe #Psalm2 #Psalms #Thebookofpsalms</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394212/3394212_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-01T19:48:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>trabalho com Exu</video:title>
      <video:description>Oferenda com Exu #Exucapapreta #Exucaveira</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394211/3394211_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-01T19:48:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Earthquake in Indonesia</video:title>
      <video:description>News #world #top1</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394210/3394210_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T19:48:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meus animais</video:title>
      <video:description>Olha que porcos bonitos #Animais</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394209/3394209_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T19:48:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Construindo uma Churrasqueira de Blocos no Quintal! #diy</video:title>
      <video:description>diy #backyard #bbq #building #CinderBlock #DIYProject #OutdoorGrill</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394208/3394208_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T19:48:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My few long time less song</video:title>
      <video:description>Music not a song this is a emotion 💕 #Song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394207/3394207_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T19:48:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🙏✨ A MÃO DE NOSSA SENHORA — VEJA AGORA! ✨🙏</video:title>
      <video:description>🙏✨ A MÃO DE NOSSA SENHORA — VEJA AGORA! ✨🙏 Você já imaginou receber um sinal de Nossa Senhora justamente quando mais precisa? Neste vídeo, você verá uma imagem que pode despertar sua fé, sua esperança e sua reflexão. 🙏💙 Assista até o final e observe com atenção A MÃO DE NOSSA SENHORA. Para muitas pessoas, momentos como este são vistos como sinais de proteção, acolhimento e esperança. Independentemente da sua interpretação, permita-se viver este momento com o coração aberto e cheio de fé. 🕊️ Nossa Senhora, cubra nossas vidas com seu manto, proteja nossas famílias, ilumine nossos caminhos e fortaleça aqueles que estão passando por momentos difíceis. Se esta mensagem tocou seu coração, deixe seu LIKE 👍, inscreva-se no canal 🔔 e compartilhe este vídeo com alguém que precisa de uma palavra de fé e esperança hoje. 💬 COMENTE: “Nossa Senhora, proteja a mim e minha família.” 🙏 ❤️ AJUDE O CANAL A CONTINUAR Se você deseja contribuir para que o canal Oração em sua Vida continue produzindo orações, mensagens de fé e conteúdos para levar esperança a mais pessoas, você pode ajudar através do PIX: 📲 PIX: 55.84-98883-7426 Toda ajuda é recebida com gratidão e contribui para a continuidade do nosso trabalho. 🙏❤️ 🔔 Inscreva-se no canal Oração em sua Vida e acompanhe nossas próximas mensagens, orações e conteúdos de fé.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394206/3394206_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-09-01T19:48:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Power of Sharing: Why Sharing Makes Us Better</video:title>
      <video:description>Sharing is more than giving something away — it’s a way of showing kindness, generosity, and love. ❤️ When we learn to share, we discover that happiness becomes even more meaningful when it is shared with others. Whether it’s a toy, a meal, our time, or simply a smile, even the smallest gesture can make someone’s day brighter. Teaching children the importance of sharing helps them develop empathy, compassion, friendship, and respect. 🌱 ✨ When we share what we have, we don’t lose — we create something greater together. #importanceofsharing #sharingiscaring #teachingchildrentoshare #kindnessforkids #generosity #empathy #compassion #friendship #sharingwithothers #lifelessonsforchildren #positivevalues #kindnessandlove #childrenseducation #moralvalues #inspirationalmessage #kidslearning #socialskills #caringforothers</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394205/3394205_720p.mp4</video:content_loc>
      <video:duration>189</video:duration>
      <video:publication_date>2026-09-01T19:47:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lancer evo</video:title>
      <video:description>#lancercarrovelozesefuriosos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394204/3394204_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:47:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PSALM 1</video:title>
      <video:description>The author of Psalm 1 is traditionally believed to be King David, although the text itself does not explicitly name him as the writer. Many psalms are attributed to David, but some scholars suggest that Psalm 1 may have been written by an anonymous author and later included as an introduction to the Book of Psalms, emphasizing the contrast between the righteous and the wicked. #holybible #psalm #psalm 1 #thebookofpsalms #prayers #psalmofdavid #ChristianFaith #GodsWord #Inspiration #FaithOverFear #BibleVerse #HopeInGod #JesusChrist #FaithInAction #GospelTruth #WalkByFaith #BibleStories #BibleLessons #BiblicalTeachings #StoriesOfFaith #ScriptureStories #BibleStudy #FaithJourney #BibleTruth #JesusStories #Prayer #Faith #ChristianPrayer #DailyPrayer #PrayerLife #PrayersOfFaith #PrayerForToday #GodsPlan #PrayerWarrior #PrayWithMe #Psalms #Psalm1 #Thebookofpsalms #Holybible</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394203/3394203_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T19:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juego de amor</video:title>
      <video:description>❤️🎶 JUEGO DE AMOR 🎶❤️ Un reguetón romántico lleno de pasión, deseo y sentimientos encontrados. 💔🔥 Esta canción habla de ese amor donde dos personas se atraen, se buscan y juegan con sus emociones, sin saber quién terminará enamorándose primero. 🎵 “Juego de Amor” — cuando amar se convierte en un juego… pero el corazón no sabe jugar. ❤️ Dale play, comparte y déjate llevar por el flow latino y romántico. 🔥🎧 #estaspalabrasclavejuegodeamor #reguetónromántico #reggaetonromántico #músicaromántica #músicalatina #flowlatino #cancióndeamor #amorypasión #historiadeamor #enamorados #desamor #relaciones #corazón #sentimientos #músicanueva #reguetón2026 #músicaurbana #músicaparadedicar #canciónromántica #latinmusic #romantic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394202/3394202_720p.mp4</video:content_loc>
      <video:duration>183</video:duration>
      <video:publication_date>2026-09-01T19:47:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chama na bota</video:title>
      <video:description>Gato dançante #Gatodebotas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394201/3394201_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T19:47:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bolsa Feminina Acolchoada</video:title>
      <video:description>O vídeo é sobre uma Bolsa Feminina Acolchoada que você coloca seus pertences pessoais #Viagens</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394200/3394200_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T19:47:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Namorada só queria ganhar flores 😥🌹</video:title>
      <video:description>A Namorada só queria ganhar flores 😥🌹</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394198/3394198_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T19:46:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden o jogo é bom e  difícil</video:title>
      <video:description>Ninja Gaiden o jogo é bom e difícil , mais tou gostando de jogar.. #Ninja</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394197/3394197_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T19:46:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ni money no life</video:title>
      <video:description>He #Welcome</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394196/3394196_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T19:46:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Medite e ore o Pai Nosso Original em Aramaico e Tradução em portugues - momento de paz experimente!</video:title>
      <video:description>Original em Aramaico: Abwun d’bwashmaya Nethqadash shmakh Teytey malkuthakh Nehwey tzevyanach ayakanna d’bwashmaya aph b’arha. Hawvlan lachma d’sunqanan yaomana. Washboqlan khaubayn (wakhtahayn) aykana daph khnan shbwoqan l’khayyabayn. Wela tahlan l’nesyuna Ela patzan min bisha. Metol dilakhie malkutha wahayla wateshbukhta l’ahlam almin. Ameyn. Tradução para o português: Ó Força Procriadora! Ó Pai-Mãe do cosmo, origem nossa,que tudo dás a luz. Direcione tua luz dentro de nós, tornando-a útil. Cria Teu reino de unidade agora O Teu desejo Uno atue então com o nosso, assim como em toda luz e em todas as formas. Dá-nos, cada dia, tudo o que necessitamos em pão e entendimento. Desfaz os laços dos erros que nos prendem, assim como nós liberamos as amarras com que aprisionamos os erros de nossos irmãos. Não permitas que a superfície e a aparência das coisas do mundo possam iludir-nos e libera-nos de tudo o que nos detém. De Ti nasce toda a vontade reinante o poder e a força viva da ação, a canção que se renova de idade a idade e a tudo embeleza. Possam a Tua vontade, poder e canção afirmamos com viva força ser o solo fecundo de onde crescem todas as nossas ações. Amém! Oração versão atual em Aramaico traduzida: Avun d’vashmaya (Pai nosso, que estás nos céus) Netqadash shmach (Santificado é o teu nome) Titê malkutach (Venha o teu Reino) Nehuê ssevyanach (Seja feita a tua vontade) Aykana d’vashmaya (tal como nos céus) Af ba’rá (também [seja feita] na terra) Hav lan lachma (Dá-nos o pão) d’sunqanan yaumana (de nossa necessidade neste dia) uashvuq lan chaubayin (E perdoa-nos as nossas dívidas) aykana d’af ch’nan sh’vakan l’chayavayin (tal como também nós perdoamos os nossos devedores) ula taalan l’nesyuna (E não nos deixes entrar em tentação) ela passan men bisha (mas livra-nos do</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394195/3394195_720p.mp4</video:content_loc>
      <video:duration>333</video:duration>
      <video:publication_date>2026-09-01T19:45:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mehndi designs 21</video:title>
      <video:description>Beautiful mehndi designs please like and follow #foryoupage #mehndidesignsyfp</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394194/3394194_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T19:45:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Festa de Zé pilintra rei da malandragem -  Rio de janeiro</video:title>
      <video:description>Incorporação de Zé pilintra</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394193/3394193_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T19:45:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CORINTHIANS 0X1 SANTOS</video:title>
      <video:description>CAMPEONATO BRASILEIRO #SOCCER</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394192/3394192_720p.mp4</video:content_loc>
      <video:duration>426</video:duration>
      <video:publication_date>2026-09-01T19:45:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PESCADORA PEGOU UM PEIXE MUITO TOP</video:title>
      <video:description>PESCADORA PEGOU UM PEIXE MUITO TOP #FRANÇA</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394191/3394191_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T19:45:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OS DONS DO ESPIRITO.</video:title>
      <video:description>Saiba como obter os dons do espirito. #donsdoespirito</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394190/3394190_720p.mp4</video:content_loc>
      <video:duration>1988</video:duration>
      <video:publication_date>2026-09-01T19:45:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Diya Bihani Dance 14</video:title>
      <video:description>Indian Girl Diya Bihani Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394189/3394189_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T19:45:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MÚSICA NOVA NA ÁREA! 🎶 Tá viralizando e promete fazer todo mundo cantar! 😍🔥 Dá o play, compartilha e</video:title>
      <video:description>MÚSICA NOVA NA ÁREA! 🎶 Tá viralizando e promete fazer todo mundo cantar! 😍🔥 Dá o play, compartilha e marca quem precisa ouvir! 🚀🎧</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394188/3394188_720p.mp4</video:content_loc>
      <video:duration>143</video:duration>
      <video:publication_date>2026-09-01T19:44:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Crispy Honey Garlic Chicken Is INSANE 🤤🔥</video:title>
      <video:description>Crispy chicken bites coated in a sticky honey-garlic glaze. 🍯🧄🍗 Golden, juicy, and made with halal ingredients. Would you try this for dinner? #honeygarlicchicken #crispychicken #chickenbites #easychickenrecipe #chickendinner #crispychickenrecipe #foodrecipe #viralfood #halalfood #halalchicken #easydinner #comfortfood</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394187/3394187_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:44:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coinpayu do tasks and earn fractions</video:title>
      <video:description>It&apos;s about watching ads or doing other tasks and you earn fractions of cryptocurrencies. There are also surveys where you can earn more. Link to enter the site, great for those who like cryptocurrencies https://www.coinpayu.com/?r=wagnerj</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394185/3394185_720p.mp4</video:content_loc>
      <video:duration>139</video:duration>
      <video:publication_date>2026-09-01T19:44:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394184</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394184/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moonlit Reunion (Hindi) - Season 01 Episode 34</video:title>
      <video:description>#MoonlitReunion #MoonlitReuniondrama #Chinesedrama #C-drama #fantasyromance #historicalfantasy #costumedrama #supernaturalromance #demonslayer #halfdemon #WuZhen #MeiZhuyu #XuKai #TianXiwei #ancientChina #forbiddenlove #enemiestolovers #secretidentity #supernaturalmystery #romancedrama #fantasydrama #perioddrama #Chinesefantasyseries #mysticaladventure #demonsandspirits</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394184/3394184_720p.mp4</video:content_loc>
      <video:duration>2526</video:duration>
      <video:publication_date>2026-09-01T19:44:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The old man who learned to apologize</video:title>
      <video:description>💛 The Importance of Saying “I’m Sorry” Sometimes, the hardest words to say are the simplest: “I’m sorry.” Apologizing doesn’t mean you are weak. It means you are mature enough to recognize your mistakes, take responsibility, and value the people in your life. A sincere apology can heal wounds, rebuild trust, and give relationships a chance to begin again. It may not change the past, but it can change what happens next. Remember: pride can keep people apart, but a sincere apology can bring them back together. ❤️ If someone matters to you, don’t let pride stop you from saying those two powerful words: I’m sorry. #importanceofsayingsorry #importanceofapologizing #howtoapologize #sincereapology #askingforforgiveness #powerofforgiveness #forgivenessandhealing #relationshipadvice #lifelessons #emotionalintelligence #personalgrowth #empathy #loveandrespect #healthyrelationships #motivationalvideo #inspirationalmessage #meaningfulrelationships #learningfrommistakes #takingresponsibility #sayingIamsorry</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394183/3394183_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-09-01T19:43:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394181</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394181/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Canecas para dia dos pais</video:title>
      <video:description>de filho para pai</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394181/3394181_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T19:43:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gadjet 30</video:title>
      <video:description>Gadjet #Gadjet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394180/3394180_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T19:43:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Salmo 119_105 - Luz No Meu Caminho</video:title>
      <video:description>Salmo 119_105 - Luz No Meu Caminho #gospel #oração #rezar #Cristo #Deus</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394179/3394179_720p.mp4</video:content_loc>
      <video:duration>204</video:duration>
      <video:publication_date>2026-09-01T19:43:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 sites freelancer</video:title>
      <video:description>Money speed #3sitesfreelancer</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394178/3394178_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T19:43:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394177</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394177/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HIGHLANDER COM HENRY CAVILL</video:title>
      <video:description>HIGHLANDER #MOVIE</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394177/3394177_720p.mp4</video:content_loc>
      <video:duration>483</video:duration>
      <video:publication_date>2026-09-01T19:43:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394176</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394176/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“EU DESCOBRI A TRAIÇÃO NO MEU PRÓPRIO ANIVERSÁRIO” parte 3</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394176/3394176_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:43:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“EU DESCOBRI A TRAIÇÃO NO MEU PRÓPRIO ANIVERSÁRIO”   parte 2</video:title>
      <video:description>mini dorama parte 2 #dorama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394174/3394174_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:42:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>como fazer uma enbuzada muito boa</video:title>
      <video:description>você já provou uma umbuzada bem cremosa e com aquele sabor de infância espera até ver como eu faço essa delícia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394173/3394173_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-09-01T19:42:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394172</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394172/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏎️🔥 The CRAZIEST Roblox-Style Race Ever! 😱 | AI Racing Game</video:title>
      <video:description>🏎️🔥 Get ready for the craziest AI racing challenge ever! Watch these insane cars compete in a Roblox-style racing world filled with crazy tracks, unexpected obstacles, insane speed and epic moments! 🏁💨 Who do you think will cross the finish line first? 🏆😱 Watch until the end to see the winner! 🎮 AI-generated gaming concept 🚗 Crazy racing action 🔥 Epic challenges 🏆 One winner! #RobloxStyle #RacingGame #AIGame #AIGaming #Viral #Trending #Funny #Race #CarGame #Gameplay #GamingCommunity #USA #UK #Canada #Australia #Worldwide #Febspot</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394172/3394172_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T19:42:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394171</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394171/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gadjet 29</video:title>
      <video:description>Gadjet #Gadgets</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394171/3394171_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T19:42:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>7 mistakes that made youtube stop recommending me</video:title>
      <video:description>Discover the 7 YouTube mistakes that can make your videos stop getting recommended — and what you can do to fix them. If your views suddenly dropped, impressions are low, or YouTube is no longer recommending your videos, these common mistakes could be the reason. In this video, we break down the biggest YouTube mistakes creators make and practical ways to improve your YouTube recommendations, reach, CTR, watch time, and channel growth. Whether you&apos;re a beginner or an experienced content creator, these tips can help you build a stronger YouTube strategy and reach more viewers in the US, UK, Europe, and worldwide. Subscribe for more YouTube tips, creator strategies, AI tools, tech updates, and content growth tips. #YouTubeTips #YouTubeAlgorithm #YouTubeGrowth #YouTubeRecommendations #YouTubeSEO #ContentCreator #YouTubeCreator #YouTubeViews #YouTubeStrategy #GrowOnYouTube #YouTubeTips2026 #YouTubeAlgorithm2026 #CreatorTips #ContentCreation #YouTubeChannelGrowth #ViralYouTube #YouTubeMistakes #SmallYouTuber #YouTubeForBeginners</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394170/3394170_720p.mp4</video:content_loc>
      <video:duration>587</video:duration>
      <video:publication_date>2026-09-01T19:42:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“EU DESCOBRI A TRAIÇÃO NO MEU PRÓPRIO ANIVERSÁRIO”</video:title>
      <video:description>mini dorama parte 1 #dorama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394169/3394169_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:42:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spider and Rope SHORT MOVIE - Eng Sub</video:title>
      <video:description>[UNCUT] 𝐒 𝐏 𝐈 𝐃 𝐄 𝐑 . 𝐀𝐍𝐃 . 𝐑 𝐎 𝐏 𝐄 _ SHORT</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394168/3394168_720p.mp4</video:content_loc>
      <video:duration>2024</video:duration>
      <video:publication_date>2026-09-01T19:42:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHAVES PERDIDO</video:title>
      <video:description>#chavesmemes3dchaves</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394167/3394167_720p.mp4</video:content_loc>
      <video:duration>152</video:duration>
      <video:publication_date>2026-09-01T19:41:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Child Phonics 8</video:title>
      <video:description>#childphonics #phonicslearning #learntoread #preschoollearning #toddleractivities #earlyliteracy #kidseducation #homeschool #teacher #kidslearning #alphabetlearning #lettersounds #phonicsforkids #preschooleducation #learningactivities #educationalvideos #childrenlearning</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394163/3394163_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:40:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&quot;Incredible egg recipe</video:title>
      <video:description>&quot;Incredible egg recipe.&quot; &quot;Incredible egg recipe.&quot; Receita fácil de ovo #Incredibleeggrecipeeggeggeggreceita</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394162/3394162_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T19:40:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394161</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394161/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GAME BLOOD OF DAWNWALKER</video:title>
      <video:description>VAMPIRE #GAME</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394161/3394161_720p.mp4</video:content_loc>
      <video:duration>543</video:duration>
      <video:publication_date>2026-09-01T19:40:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tribal Nanny Tames Wolf Kings Twin Cubs</video:title>
      <video:description>An innocent young woman wants to save her child’s life with nothing but the king’s blood. Curious to know what happens? Don’t forget to subscribe if you want to hear the rest of the story #shortvideo #romance #wolf #fyp</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394160/3394160_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-01T19:40:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Child Phonics 7</video:title>
      <video:description>#childphonics #phonicslearning #learntoread #preschoollearning #toddleractivities #earlyliteracy #kidseducation #homeschool #teacher #kidslearning #alphabetlearning #lettersounds #phonicsforkids #preschooleducation #learningactivities #educationalvideos #childrenlearning</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394159/3394159_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T19:40:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não existe país livre onde a família não pode deixar o filho ir à escola.</video:title>
      <video:description>Não existe país livre onde a família não pode deixar o filho ir à escola. Não existe país livre quando o cidadão abre o comércio de manhã sem saber se vai conseguir voltar em segurança para casa. A lei vai voltar a valer no Brasil e o país vai ser nosso, do cidadão de bem. O Brasil vai vencer! Vote 2️⃣2️⃣🇧🇷 Compartilhe! #Brasil #ditadura #STF #Borçato #ministros #lixocareca</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394158/3394158_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T19:40:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394156</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394156/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Child Phonics 6</video:title>
      <video:description>#childphonics #phonicslearning #learntoread #preschoollearning #toddleractivities #earlyliteracy #kidseducation #homeschool #teacher #kidslearning #alphabetlearning #lettersounds #phonicsforkids #preschooleducation #learningactivities #educationalvideos #childrenlearning</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394156/3394156_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T19:39:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394155</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394155/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>United State train running status Evolution of transformation</video:title>
      <video:description>United States and company network train running status Evolution of transformation model for digital company network #UnitedState</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394155/3394155_720p.mp4</video:content_loc>
      <video:duration>252</video:duration>
      <video:publication_date>2026-09-01T19:39:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Child Phonics 5</video:title>
      <video:description>#childphonics #phonicslearning #learntoread #preschoollearning #toddleractivities #earlyliteracy #kidseducation #homeschool #teacher #kidslearning #alphabetlearning #lettersounds #phonicsforkids #preschooleducation #learningactivities #educationalvideos #childrenlearning</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394153/3394153_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T19:39:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>o segredo</video:title>
      <video:description>mini dorama #dorama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394152/3394152_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:39:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Football feels like a martial art</video:title>
      <video:description>Football feels like a martial art. #worldcupvibes​football​ishowspeedwannabe​soccer​futbol​footballvideo​footballhighlights​footballedits​sports​fifa​championsleague​premierleague​laliga​seriea​calcio​ucl​bundesliga​goalkeeper​freestyle​motivation​skills​training​footballplayer​footballlife​footballislife​footballlover​footballers​footballseason​instagood​viral​trending​lovefootball​footballculture​footballmatch​footballgame​footballfans​footballmoments​footballpassion​footballfamily​footballgoals​footballworld​footballclub​footballteam​profootball​like​followme​youtube​youtubefootball​footballvideo​funny​youthfootball​soccerskills​soccerlife​neymar​ronaldo​cr7​messi​mbappe​erlinghaaland​vinijr​salah​kante​modric​bellingham​lewandowski​benzema​griezmann​kane​rashford​sterling​fati​gavi​pedri​hakimi​osimhen​son​debruyne​pogba​courtois​alisson​ederson​robertson​trentalexanderarnold​martinez​tadic​vlahovic​vardy​grealish​martial​sancho​julianalvarez​musiala​hectorherrera​olmo​upamecano​camavinga​ansu​neymarjr​joaofelix​rodrygo​masonmount​chilwell​dembele​joaocancelo​gabrieljesus​matthijsdeligt​raphinha​militao​casemiro​mourinho​guardiola​klopp​ancelotti​xavi​barcelona​realmadrid​psg​chelsea​liverpool​manunited​mancity​juventus​acmilan​intermilan​atleticomadrid​tottenham​arsenal​bayernmünchen​ajax​porto​benfica​sporting​flamengo​palmeiras​brasileirao​england​france​germany​italy​portugal​argentina​</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394151/3394151_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T19:38:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ana Lima</video:title>
      <video:description>Acompanhem minha Rotina de vida. Meus amores ❤️💗💗</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394150/3394150_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T19:38:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YOUNG LADIES DON&apos;T PLAY FIGHTING GAMES</video:title>
      <video:description>YOUNG LADIES #ANIME</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394149/3394149_720p.mp4</video:content_loc>
      <video:duration>584</video:duration>
      <video:publication_date>2026-09-01T19:38:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tilawat 40</video:title>
      <video:description>islamic Vedio</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394148/3394148_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-01T19:37:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394147</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394147/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>[CUT] KNOT THE SERIES EPISODE 10 - Eng Sub</video:title>
      <video:description>KNOT THE SERIES _ EPISODE 10</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394147/3394147_720p.mp4</video:content_loc>
      <video:duration>2465</video:duration>
      <video:publication_date>2026-09-01T19:37:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>flight of a drone</video:title>
      <video:description>flight of a drone controlled by Mario #Flight #drone #controlled</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394146/3394146_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T19:36:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bill Gates: Keep learning and turn knowledge into action. 011</video:title>
      <video:description>Oprah Winfrey: Your mindset can change the direction of your life. #music #audio #sons #som #canção</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394145/3394145_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-09-01T19:36:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novela anjo mau 5</video:title>
      <video:description>Rodrigo e Nice juntos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394144/3394144_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-09-01T19:36:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu namorado é uma super estrela</video:title>
      <video:description>Filmes romance #Meunamoradoéumasuperestrela</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394143/3394143_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-09-01T19:36:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nissan 350z</video:title>
      <video:description>carros #carronissanvelozesefuriosos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394142/3394142_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T19:36:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden continuando a história do Ninja</video:title>
      <video:description>Ninja Gaiden continuando a história do Ninja, impressionante esse jogo #Ninja</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394141/3394141_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T19:36:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 How Much Tape Does It Take to Stop a Lamborghini?! 🏎️💨</video:title>
      <video:description>Can a simple roll of tape actually stop a Lamborghini? 😱 We put it to the ultimate test to find out just how much tape it takes to stop this supercar! Watch until the end to see the unbelievable result! 👀🔥 #LamborghiniLamborghiniChallengeSupercarCarChallengeTapeChallengeCrazyExperimentCarTestViralInsaneShortsYouTubeShorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394140/3394140_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T19:36:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dudinha.</video:title>
      <video:description>Bora fazer essa receita 🤤😍❤️</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394139/3394139_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-01T19:36:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DANGDUT 4</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. enjoy! #Dangdut</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394138/3394138_720p.mp4</video:content_loc>
      <video:duration>414</video:duration>
      <video:publication_date>2026-09-01T19:36:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>10 Formas de Ganhar Dinheiro com TikTok Shop em 2026</video:title>
      <video:description>renda extra on line #rendaextra</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394137/3394137_720p.mp4</video:content_loc>
      <video:duration>525</video:duration>
      <video:publication_date>2026-09-01T19:36:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eles pediram Eduardo Costa no karaokê e deu Nisso... #AldemirMelo #Cover</video:title>
      <video:description>Interpretando esse clássico do Eduardo Costa! Assista até o fim e deixe a sua nota nos comentários! #EduardoCosta #CoverEduardoCosta #AldemirMelo #AldemirMeloCantando #EduardoCostaCover #CantandoEduardoCosta #KaraokêEduardoCosta #MusicaSertaneja #SertanejoRomântico #VozeViolão #SertanejoAoVivo #CantandoSertanejo #ModãoSertanejo #CoverSertanejo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394135/3394135_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-01T19:35:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Qari sahab 2</video:title>
      <video:description>Sleeping</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394134/3394134_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-01T19:35:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>itro na caragen carro pesonalizados need for spdenn</video:title>
      <video:description>nfs heat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394133/3394133_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-01T19:35:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dwayne Johnson: Discipline today creates strength tomorrow. 010</video:title>
      <video:description>Cristiano Ronaldo: Talent helps, but dedication makes the difference. #music #melo #audio #sons #som</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394132/3394132_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-09-01T19:35:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DO NOT WATCH ALONE — THIS CAVE WILL SHOCK YOU / 혼자 보지 마세요 — 이 동굴은 충격적입니다</video:title>
      <video:description>I explored this abandoned cave alone and what I found still gives me chills 😱 Would you dare to go inside? #abandonedcave #urbanexploration #scarystories #realhorror #creepy #mystery #urbex #hiddenurban #darkexploration #truestory 이 폐동굴을 혼자 탐험했는데 발견한 것 때문에 아직도 소름이 돋습니다 😱 당신이라면 들어갈 용기가 있나요? #폐동굴 #도시탐험 #무서운이야기 #진짜공포 #소름 #미스터리 #urbex #실화 #어둠속탐험 #darkcavernamisterio</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394131/3394131_720p.mp4</video:content_loc>
      <video:duration>188</video:duration>
      <video:publication_date>2026-09-01T19:34:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kodi Slow and Buffering? Fix It with This Simple Tweak! ⚡</video:title>
      <video:description>Kodi Slow and Buffering? Fix It with This Simple Tweak! ⚡ Is your Kodi running slow, freezing, buffering, or constantly crashing? In this video, you&apos;ll discover a simple and effective fix that can dramatically improve Kodi&apos;s performance on Android TV, TV Box, Fire TV Stick, Windows PC, Linux, and macOS. Learn how to optimize Kodi settings, clear unnecessary cache, reduce buffering, improve streaming speed, and make your media center run faster than ever. Whether you&apos;re using Kodi 21 Omega, Kodi 22, or a previous version, these optimization tips can help deliver a smoother and more stable experience. 🔥 In this video you&apos;ll learn: How to speed up Kodi instantly Best Kodi performance settings Fix buffering and freezing issues Clear cache and temporary files Improve streaming quality Optimize Kodi for low-end devices Reduce lag and increase stability Make Kodi run faster on Android TV, TV Box, Firestick, and PC If this tutorial helps you, don&apos;t forget to Like 👍, Subscribe 🔔, and Share 📲 so you never miss the latest Kodi tips, tutorials, updates, and optimization guides. Kodi, Kodi slow, Kodi buffering, Kodi lag fix, Kodi optimization, Kodi performance, Kodi cache cleaner, Kodi freezing fix, Kodi tutorial, Kodi settings, Kodi tips, Kodi 2026, Kodi 22, Kodi 21 Omega, Kodi Android TV, Kodi TV Box, Firestick Kodi, Kodi streaming fix, speed up Kodi, Kodi media center, Kodi setup, Kodi maintenance, Kodi performance boost, fix Kodi buffering, Kodi troubleshooting. #KodiKodiTipsKodiTutorialKodi2026Kodi22Kodi21AndroidTVTVBoxFirestickStreamingMediaCenterBufferingFixKodiFixTechTipsKodiOptimizationKodiPerformanceStreamingTipsTechTutorialAndroidWindows</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394130/3394130_720p.mp4</video:content_loc>
      <video:duration>362</video:duration>
      <video:publication_date>2026-09-01T19:34:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sol nascendo</video:title>
      <video:description>Sol #solfebspot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394129/3394129_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T19:34:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PHOENIX VALKYRIES  The Wanderer&apos;s Path - Epic Power Metal | AI MUSIC VIDEO Cinematic</video:title>
      <video:description>⚔️ About the song: Embark on a journey through fire, shadow, and fate in “The Wanderer’s Path”, the new epic music video by Phoenix Valkyries. This song tells the story of a lone warrior walking across a world consumed by chaos, guided only by strength, memory, and the will to endure. 🔥 Expect a cinematic blend of powerful symphonic metal, haunting melodies, and striking visuals that bring mythology and raw emotion to life. ⚔️ Witness battles, storms, and moments of calm beauty as the wanderer forges his destiny. 🎶 Stream our music on Spotify, Apple Music, and all platforms. 🖤 If you enjoy our work, don’t forget to like, comment, and subscribe to support the rise of Phoenix Valkyries! #PhoenixValkyries #TheWanderersPath #SymphonicMetal #PowerMetal #MusicVideo --------------------------------------------------------------------------------------------------------------- Freebeat.AI is a next-generation AI video creator that turns your ideas into stunning visuals in just minutes. Whether you’re a musician, content creator, gamer, or entrepreneur, Freebeat helps you bring imagination to life with cinematic quality and zero editing skills required. ✅ Create music videos, trailers, ads, reels &amp; more ✅ Easy and fast — professional results in one click ✅ Perfect for YouTube, Instagram, TikTok, and beyond ✅ 10% OFF with code PHOENIX10 Unleash your creativity. Transform your content with AI. 👉 Try now: https://freebeat.ai/#via=phoenixvalkyries ---------------------------------------------------------------------------------------------------------------- 🎧 Listen on all platforms: 🔗 Spotify: https://open.spotify.com/intl-pt/artist/5g958TGeG5SVW2gB1K62QW 🔗 Apple Music: https://music.apple.com/br/artist/phoenix-valkyries/1797334032 🔗 Deezer: https://www.deezer.com/br/artist/303832</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394127/3394127_720p.mp4</video:content_loc>
      <video:duration>360</video:duration>
      <video:publication_date>2026-09-01T19:34:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Elon Musk: Dream big, work hard, and keep moving forward. 009</video:title>
      <video:description>Steve Jobs: Stay hungry, stay curious, and follow your vision. #music #melo #audio #sons #som</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394126/3394126_720p.mp4</video:content_loc>
      <video:duration>148</video:duration>
      <video:publication_date>2026-09-01T19:33:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Halping Women</video:title>
      <video:description>Good Man</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394125/3394125_720p.mp4</video:content_loc>
      <video:duration>117</video:duration>
      <video:publication_date>2026-09-01T19:33:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_550.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_550.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394124/3394124_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:33:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NOAH’S ARK 🌊 | The Great Flood | A Cinematic Bible Story in 3D</video:title>
      <video:description>NOAH’S ARK 🌊 | THE GREAT FLOOD A world had forgotten kindness. But one man chose to remain faithful. This cinematic 3D animated Bible story brings the story of Noah’s Ark to life — from God’s warning and the construction of the Ark to the arrival of the animals, the Great Flood, and the promise of hope represented by the rainbow. Experience this emotional biblical story through stunning cinematic animation, expressive characters, dramatic music, and powerful storytelling. 🙏 A story about faith, obedience, perseverance, and hope. 🎬 Watch until the end to witness the promise after the storm. If you enjoyed this biblical cinematic story, subscribe for more epic Bible stories brought to life through animation. #NoahsArk #BibleStory #GreatFlood #BiblicalStories #ChristianAnimation 🔥 Hashtags #NoahsArk #NoahArk #GreatFlood #BibleStory #NoahBibleStory #biblicalstories #Bibleanimation #Christiananimation #biblicalanimation #NoahandtheArk #OldTestament #Biblestoriesforadults #cinematicBiblestory #Christianstorytelling #God #faith #Noah #floodstory #animatedBiblestory #3DBibleanimation</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394123/3394123_720p.mp4</video:content_loc>
      <video:duration>89</video:duration>
      <video:publication_date>2026-09-01T19:33:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_549.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_549.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394122/3394122_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:32:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moonlit Reunion (Hindi) - Season 01 Episode 31</video:title>
      <video:description>#MoonlitReunion #MoonlitReuniondrama #Chinesedrama #C-drama #fantasyromance #historicalfantasy #costumedrama #supernaturalromance #demonslayer #halfdemon #WuZhen #MeiZhuyu #XuKai #TianXiwei #ancientChina #forbiddenlove #enemiestolovers #secretidentity #supernaturalmystery #romancedrama #fantasydrama #perioddrama #Chinesefantasyseries #mysticaladventure #demonsandspirits</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394121/3394121_720p.mp4</video:content_loc>
      <video:duration>2537</video:duration>
      <video:publication_date>2026-09-01T19:32:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_548.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_548.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394120/3394120_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:32:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden um jogão impressionante</video:title>
      <video:description>Ninja Gaiden um jogão impressionante, gostando do jogo muito bom #ninjagaiden</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394119/3394119_720p.mp4</video:content_loc>
      <video:duration>241</video:duration>
      <video:publication_date>2026-09-01T19:32:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_547.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_547.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394118/3394118_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:32:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comédia 17</video:title>
      <video:description>Eu amo esses dingo e muito engraçado!! #Usa #franca</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394117/3394117_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-01T19:32:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_546.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_546.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394116/3394116_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:31:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatinhas engraçadas 😻🤣</video:title>
      <video:description>Essas duas gatinhas ,Sophie Rajadinha e Pandora pretinha ,estão aqui com o objetivo de trazer bom humor e leveza para as nossas vidas.✨ Elas são brasileiras e sarcásticas além de serem uma fofura. Curtam, comentem e compartilhe para o mundo inteiro conhecer essas gracinhas ✨ Gratidão a todos que assistirem 😻✨ #gatinhasgatinhasfofassophieepandoraBrasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394115/3394115_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T19:31:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bien voir des gens.</video:title>
      <video:description>Tellement que c&apos;est bien</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394114/3394114_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T19:31:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Do you like crab???...</video:title>
      <video:description>Straight from Brazil, from the city of Canguaretama, in Rio Grande do Norte!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394113/3394113_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T19:31:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tapioca recheada verdadeira delícia</video:title>
      <video:description>você nunca mais vai querer comer tapioca dó mesmo jeito depois de ver esse recheio</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394112/3394112_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T19:31:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PHOENIX VALKYRIES - Queen of The Unseen - AI Music Video (Tales of Asgard) Power Metal</video:title>
      <video:description>⚔️ About the song: Enter the realm of shadows with Phoenix Valkyries in their new epic music video &quot;Queen of the Unseen&quot;. Dark, powerful and cinematic, this track summons the essence of gothic fantasy and symphonic power metal, blending haunting melodies with crushing riffs. 👑 In this tale, the Queen of the Unseen rises from her throne of bones, ruling over a kingdom lost between life and death. A hymn of power, mystery, and eternal darkness. #PhoenixValkyries #QueenOfTheUnseen #SymphonicMetal #PowerMetal #MusicVideo 🎧 Listen on all platforms: 🔗 Spotify: https://open.spotify.com/intl-pt/artist/5g958TGeG5SVW2gB1K62QW 🔗 Apple Music: https://music.apple.com/br/artist/phoenix-valkyries/1797334032 🔗 Deezer: https://www.deezer.com/br/artist/303832291 📺 Watch more Phoenix Valkyries music videos: 🔹 [Hearts of Steel] - https://youtu.be/UTdj-0IY544?si=xgvla25xzdOznXdb 🔹 [The Call of Yggdrasil] - https://youtu.be/E067rwx4lIk?si=BbZPzIsDa0nxsbyn 🔹 [Echoes of Eternity] - https://youtu.be/W3iwu5Vjzdo?si=nbO2LqONSUm8pmlg 📲 Follow us on social media! 🔥 Instagram: https://www.instagram.com/phoenixvalkyriesofficial/ 🔥 TikTok: https://www.tiktok.com/@phoenix.valkyries 🛒 Buy official merchandise! 👕 T-shirts, posters and more: coming soon 📢 Support the band! Not subscribed? Consider subscribing, it&apos;s very important for the growth of the channel: https://www.youtube.com/channel/UC9xPktKI4AgryFA6_Fx1zOg?sub_confirmation=1 🔸 Leave a like 👍 🔸 Comment what you think of the song! ❄️🔥 🔸 Share with your friends who like epic metal! #PowerMetal #SymphonicMetal #PhoenixValkyries #FrostKing #EpicMusic listen to our music and follow our profile on spotify: https://open.spotify.com/intl-pt/artist/5g958TGeG5SVW2gB1K62QW Not subscribed? Consider subscribing, this is very important for the growth of the ch</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394111/3394111_720p.mp4</video:content_loc>
      <video:duration>302</video:duration>
      <video:publication_date>2026-09-01T19:31:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_545.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_545.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394110/3394110_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:31:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_544.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_544.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394109/3394109_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:31:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_543.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_543.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394108/3394108_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:31:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_542.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_542.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394107/3394107_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:30:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_541.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_541.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394106/3394106_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:30:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sea enjoyment</video:title>
      <video:description>Enjoyment life</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394105/3394105_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T19:30:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 36</video:title>
      <video:description>#AÇÃO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394104/3394104_720p.mp4</video:content_loc>
      <video:duration>125</video:duration>
      <video:publication_date>2026-09-01T19:30:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_540.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_540.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394103/3394103_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:29:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CELEBRATION</video:title>
      <video:description>MUSICA ELETRONICA É AQUI !! #musicaeletronica24h #musicaseletronica #musicaelectronicamix #topmusicaseletronicas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394102/3394102_720p.mp4</video:content_loc>
      <video:duration>399</video:duration>
      <video:publication_date>2026-09-01T19:29:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_539.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_539.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394101/3394101_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:29:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_538.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_538.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394100/3394100_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:29:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>naruto shipudenn</video:title>
      <video:description>naruto na grade guerra</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394099/3394099_720p.mp4</video:content_loc>
      <video:duration>285</video:duration>
      <video:publication_date>2026-09-01T19:29:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kkkkk 11</video:title>
      <video:description>Kkkkk #frança #eus #shorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394098/3394098_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T19:29:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_537.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_537.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394097/3394097_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:29:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_536.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_536.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394096/3394096_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:28:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DANGDUT 3</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. #Dangdut</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394095/3394095_720p.mp4</video:content_loc>
      <video:duration>351</video:duration>
      <video:publication_date>2026-09-01T19:28:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_535.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_535.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394094/3394094_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:28:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Divya Ralhan Dance 35</video:title>
      <video:description>Indian Girl Divya Ralhan Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394093/3394093_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-01T19:28:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_534.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_534.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394092/3394092_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:28:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arco íris</video:title>
      <video:description>E um vídeo voltando para crianças com muito alegria e danças #Paris</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394091/3394091_720p.mp4</video:content_loc>
      <video:duration>143</video:duration>
      <video:publication_date>2026-09-01T19:28:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_533.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_533.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394090/3394090_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:27:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_532.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_532.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394088/3394088_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:27:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tráfico recruta droneiros para monitorar rivais no Rio</video:title>
      <video:description>Tráfico recruta droneiros para monitorar rivais no Rio</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394087/3394087_720p.mp4</video:content_loc>
      <video:duration>204</video:duration>
      <video:publication_date>2026-09-01T19:27:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_531.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_531.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394086/3394086_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:27:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Top most train running status Evolution of transformation model for india</video:title>
      <video:description>India India countries transformation model for 1886-2026 years back elevation video thumbnail #Canada</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394084/3394084_720p.mp4</video:content_loc>
      <video:duration>232</video:duration>
      <video:publication_date>2026-09-01T19:27:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_530.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_530.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394083/3394083_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:26:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394082</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394082/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHAVES PERDIDO - confusão na vila</video:title>
      <video:description>#chaves3dchaves</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394082/3394082_720p.mp4</video:content_loc>
      <video:duration>128</video:duration>
      <video:publication_date>2026-09-01T19:26:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Last Page</video:title>
      <video:description>#Trend</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394081/3394081_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T19:26:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você precisa assistir este filme..</video:title>
      <video:description>Você precisa assistir este filme.. #Filmes</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394080/3394080_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T19:26:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_529.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_529.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394079/3394079_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:26:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nissan Silvia 2</video:title>
      <video:description>carros #carroNissanSilviaVelozesefuriosos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394078/3394078_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T19:25:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_528.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_528.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394077/3394077_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:25:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Broforce gameplay - O puro suco dos anos 90</video:title>
      <video:description>Prepare-se para muita ação, explosões e momentos completamente insanos em Broforce! 💥 Hoje vamos encarar inimigos, destruir tudo pelo caminho e tentar sobreviver a um dos jogos mais caóticos e divertidos de ação. Será que conseguimos chegar ao final sem perder todas as vidas? 😂 Assista até o fim para conferir os melhores momentos dessa gameplay! 👍 Deixe o like, inscreva-se no canal e ative o sininho para acompanhar as próximas gameplays! #Broforce #gameplay #games #Gaming #jogos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394076/3394076_720p.mp4</video:content_loc>
      <video:duration>1422</video:duration>
      <video:publication_date>2026-09-01T19:25:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_527.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_527.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394075/3394075_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:25:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Teu Reino É Eterno</video:title>
      <video:description>“Teu Reino É Eterno” é uma adoração intensa e poderosa declarando que Jesus reina para sempre acima de toda a terra. #Worship​ #Jesus​ #Adoração #​Gospel​</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394074/3394074_720p.mp4</video:content_loc>
      <video:duration>439</video:duration>
      <video:publication_date>2026-09-01T19:25:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_526.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_526.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394073/3394073_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:25:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminho para trilha</video:title>
      <video:description>Bom pra fazer exercícios físicos. #Brasileiros</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394071/3394071_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T19:25:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_525.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_525.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394070/3394070_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:24:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_524.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_524.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394069/3394069_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:24:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Give thanks for life!!</video:title>
      <video:description>Agradeça pela vida!!Never forget that God always has a way out for your deliverance. Nunca se esqueça que Deus sempre tem a saída para sua libertação</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394068/3394068_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T19:24:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_523.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_523.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394067/3394067_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:24:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu primeiro banho</video:title>
      <video:description>O primeiro banho do bebê #Bainhopet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394066/3394066_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T19:24:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Funniest Videos on the Internet</video:title>
      <video:description>The Funniest Videos on the Internet #FunniestVideos #viral #meme #fundir</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394065/3394065_720p.mp4</video:content_loc>
      <video:duration>1607</video:duration>
      <video:publication_date>2026-09-01T19:24:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Phoenix Valkyries - Threads of fate - Nornas Music Video</video:title>
      <video:description>#AIBand #AIgenerated #ArtificialIntelligence #CinematicMetal #DigitalArtistry #DiscoverNewMusic #EpicMetal #FemaleVocalMetal #FollowForMore #FutureOfMusic #HeavyMetal #InnovativeMusic #LikeAndSubscribe #MetalCommunity #MetalHeadsUnite #MetalMusic #ModernRock #MusicVideoRelease #NewMusicVideo #PowerMetal #ShareTheMusic #SupportIndependentArtists #SymphonicMetal #SymphonicPower #TechAndArt #VirtualBand #YouTubeMusic #aimusic #aivideo #music #phoenixvalkyries #virtualmetal</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394063/3394063_720p.mp4</video:content_loc>
      <video:duration>424</video:duration>
      <video:publication_date>2026-09-01T19:23:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 HUMAN VS JET ENGINE ✈️💀 | O QUE ACONTECE QUANDO UM HOMEM DESAFIA UM MOTOR DE JATO?!</video:title>
      <video:description>Human vs Jet Engine #misrtv</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394062/3394062_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T19:23:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Maior Tigela de Macarrão do Mundo</video:title>
      <video:description>A Maior Tigela de Macarrão do Mundo #comida #mukbang #macarrão</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394061/3394061_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:23:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A farmer is farming very beautifully.</video:title>
      <video:description>Please everyone enjoy watching this video and like and share the following #🌳Garden🌿Nature🌸BeautifulGarden</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394060/3394060_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:23:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_522.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_522.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394059/3394059_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:23:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_521.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_521.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394057/3394057_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:22:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to car elevation countries transformation model service engineer</video:title>
      <video:description>Car elevation video total materials engine total car service videos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394056/3394056_720p.mp4</video:content_loc>
      <video:duration>501</video:duration>
      <video:publication_date>2026-09-01T19:22:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Os Trapalhões e os deputados</video:title>
      <video:description>Deputado nos Trapalhões</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394055/3394055_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T19:22:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A diva</video:title>
      <video:description>Shakira a melhor!! #francaalemanhausa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394054/3394054_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T19:22:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_520.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_520.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394053/3394053_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:22:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novelinha das frutas 🍎🍓🍒</video:title>
      <video:description>Só na malhação 🫩🫩</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394051/3394051_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-01T19:22:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatinhos lindos.</video:title>
      <video:description>Nossos gatinhos que amamos. #gato #gatinhos #cat</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394050/3394050_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T19:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_519.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_519.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394049/3394049_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_518.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_518.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394048/3394048_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:21:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Os Trapalhões 2</video:title>
      <video:description>Moço dos Trapalhões</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394047/3394047_720p.mp4</video:content_loc>
      <video:duration>122</video:duration>
      <video:publication_date>2026-09-01T19:21:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cuscuz recheado de da água na boca</video:title>
      <video:description>você nunca mais vai querer comer cuscuz simples depois de provar esse cuscuz recheado olha essa delícia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394046/3394046_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-09-01T19:21:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_517.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_517.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394045/3394045_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:21:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Performance 3</video:title>
      <video:description>Nora Actress</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394044/3394044_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-01T19:21:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_516.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_516.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394043/3394043_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:21:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Two Cats Dance</video:title>
      <video:description>Video for Kids</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394042/3394042_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T19:20:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_515.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_515.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394041/3394041_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:20:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Modern Decorative Vase in 3D printing</video:title>
      <video:description>ideias para impressao 3d #3DImpressao3D3DPrintingVasoDecorativoModernVase3DPrintedVase</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394040/3394040_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T19:20:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_514.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_514.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394039/3394039_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:20:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatinho marshmellow</video:title>
      <video:description>Marshmellow no seu dia a dia #gatogatinhos #felinos #gatoslindos #cat #catlove</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394038/3394038_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T19:20:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_513.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_513.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394037/3394037_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:20:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You found one of the most unique desert hotels in the worid.</video:title>
      <video:description>#OurHabitasAlUla #AlUla #SaudiArabia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394036/3394036_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:20:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Very good 29</video:title>
      <video:description>😃</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394035/3394035_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T19:20:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como os humanos antigos inventaram os reis</video:title>
      <video:description>Durante mais de 95% da nossa existência como espécie, o ser humano viveu sem reis, sem tronos e sem hierarquias permanentes. Pequenos bandos de caçadores-coletores vigiavam ativamente e puniam qualquer indivíduo que tentasse acumular poder excessivo. Neste ensaio visual, exploramos a antropologia, a arqueologia e a psicologia evolutiva por trás do nascimento da monarquia e como os mesmos instintos de deferência à autoridade e busca por figuras fortes em tempos de crise continuam moldando o comportamento humano moderno. Fontes principais do roteiro: Christopher Boehm (1999) — Hierarchy in the Forest → Igualitarismo e “hierarquia reversa” entre caçadores-coletores. Jared Diamond (1997) — Guns, Germs, and Steel → Agricultura, excedentes, armazenamento e surgimento de sociedades hierárquicas. Robin Dunbar (1992) — Neocortex size as a constraint on group size in primates → “Número de Dunbar” (~150 relações sociais). Estudos antropológicos sobre o “Big Man” → Liderança baseada em prestígio, generosidade e redistribuição na Melanésia/Nova Guiné. Arqueologia do Cemitério Real de Ur — Leonard Woolley → Sepultamentos coletivos e evidências associadas à elite da antiga Mesopotâmia. Estudos sobre religião e realeza no Egito e Mesopotâmia → Sacralização do governante e legitimidade divina. Stanley Milgram (1963) — Behavioral Study of Obedience → Obediência à autoridade. 📌 Neste episódio: A &quot;hierarquia reversa&quot; de Christopher Boehm e a vigilância contra tiranos ancestrais O papel dos excedentes agrícolas e a transição do Big Man para líderes permanentes O Limite de Dunbar e o colapso do monitoramento social em cidades como Uruk A sacralização do governante: Da tumba real de Ur ao Mandato do Céu na China O experimento de Milgram e por que crises modernas ainda ressuscitam o desejo por</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394034/3394034_720p.mp4</video:content_loc>
      <video:duration>954</video:duration>
      <video:publication_date>2026-09-01T19:19:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_512.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_512.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394033/3394033_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_511.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_511.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394031/3394031_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:19:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Two Chameleons Climbing a Vertical Cable Close Up 4K Vertical</video:title>
      <video:description>High-quality vertical footage of two chameleons climbing and balancing on a thin vertical cable indoors. Their distinctive body shapes, curled tails, gripping feet, and natural climbing movements create an interesting reptile wildlife scene. Ideal for reptiles, animal behavior, zoology, nature, wildlife documentaries, biology, education, and exotic animal projects. #chameleon #chameleons #twochameleons #reptile #reptiles #lizard #lizards #chameleonclimbing #climbingchameleon #reptileclimbing #lizardclimbing #verticalclimbing #climbinganimal #exoticreptile #exoticanimal #wildlife #animal #nature #reptilewildlife #animalbehavior #reptilebehavior #zoology #biology #animalcloseup #reptilecloseup #closeup #macro #curledtail #prehensiletail #grippingfeet #climbing #balancing #crawling #camouflage #patternedskin #brownchameleon #colorfulreptile #terrestrialanimal #smallreptile #wildanimal #exoticwildlife #naturedocumentary #wildlifedocumentary #education #science #research #indoorwildlife #4k #hdvideo #verticalvideo #reptilefootage</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394029/3394029_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T19:19:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_510.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_510.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394028/3394028_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:19:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novela anjo mau 4</video:title>
      <video:description>Ligia não acredita na paula</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394027/3394027_720p.mp4</video:content_loc>
      <video:duration>122</video:duration>
      <video:publication_date>2026-09-01T19:19:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_509.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_509.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394026/3394026_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:18:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>あらゆる追いかけっこを繰り広げる! 「トムとジェリ 7</video:title>
      <video:description>あらゆる追いかけっこを繰り広げる! 「トムとジェリー 公式Instagram です! Cartoon Network にて『まいにちトムとジェリー』放送中! 『映画トムとジェリー』デジタル配信中-ブルーレイ&amp;DVD 発売中TEC (s23).mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394025/3394025_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T19:18:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bean’s CRAZY Ferris Wheel Ride! 🎡😂 | Funny 3D Cartoon Comedy</video:title>
      <video:description>Bean’s CRAZY Ferris Wheel Ride! 🎡😂 | Funny 3D Cartoon Comedy Bean takes a Ferris wheel ride and turns a peaceful day at the park into hilarious chaos! Watch his funny reactions and crazy slapstick adventure. 😂🎡</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394024/3394024_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:18:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REAL GOLD LOOK IN BUDGET!</video:title>
      <video:description>✨ REAL GOLD LOOK IN BUDGET! ✨ Aaj ki video mein hum aapke sath share kar rahe hain latest trending Imitation &amp; Artificial Jewellery Sets (Kundan, Polki, Antique Gold, aur American Diamond designs). Agar aap bridal, wedding, ya festive wear ke liye designer jewellery budget mein chahte hain, toh ye video end tak lazmi dekhein! 📌 Timestamps / Video Chapters: 0:00 - Intro &amp; Latest Jewellery Overview 0:45 - Royal Bridal Kundan &amp; Polki Sets 2:15 - Lightweight Party Wear &amp; Choker Sets 3:50 - American Diamond (AD) &amp; Zircon Collection 5:10 - Price, Wholesale Details &amp; How to Order 6:30 - Outro &amp; Care Tips 🛒 How to Order / Contact Us: 📱 WhatsApp for Booking: +91-XXXXX-XXXXX / +92-XXXXX-XXXXX 🌐 Website / Instagram: @YourBrandName 🚚 Cash on Delivery Available / Worldwide Shipping --------------------------------------------------- 🔔 DON&apos;T FORGET TO: LIKE 👍 | SHARE 📲 | SUBSCRIBE 🔴 &amp; Press the Bell Icon for New Wholesale Updates! --------------------------------------------------- #imitationjewellery #artificialjewellerysets #latestkundanjewellery2026 #bridalartificialjewelleryset #wholesalejewellerymarket #sabyasachilookjewellery #artificialpolkiset #addiamondjewellery #lowpriceartificialjewellery #jewelleryhaul2026 #pakistanartificialjewellery #indianimitationjewellery #onlinejewelleryshopping #partywearchokersetsimitationjewellery #artificialjewellery #bridaljewellery #weddingjewellery #fashionjewellery #jewellerycollection #jewelleryhaul #jewellerymarket</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394023/3394023_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:18:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_508.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_508.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394021/3394021_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:18:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Palavra do dia</video:title>
      <video:description>#Oi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394020/3394020_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-01T19:18:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_507.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_507.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394019/3394019_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:18:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_506.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_506.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394017/3394017_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:18:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>بِسْمِ ٱللَّٰهِ ٱلرَّ #القرآن_الكريم #راحة_نفسية #trending #صدى_النجوم</video:title>
      <video:description>بِسْمِ ٱللَّٰهِ ٱلرَّ #القرآن_الكريم #راحة_نفسية #trending #صدى_النجوم #viral #سورة_الفاتحة.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394016/3394016_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T19:17:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394015</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394015/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não esperava por isso</video:title>
      <video:description>Apollo não esperava da capivara ser maior que ele #Apollo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394015/3394015_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T19:17:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Achei na shoppe</video:title>
      <video:description>Chinelo Asuna Super Confortável Nuvem Masculino Antiderrapante Nova Moda 2025</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394014/3394014_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:17:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sujeito folgado</video:title>
      <video:description>Essa pegadinha com Ivo Holanda é muito engraçada #comediahumorpegadinhasviraltiktokvideosengracados</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394012/3394012_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-01T19:17:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_505.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_505.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394011/3394011_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:17:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_504.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_504.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394010/3394010_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:17:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brincando</video:title>
      <video:description>Brincando com os meu filhos #Emcasa #nasferias #dotrabalho</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394009/3394009_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T19:17:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gold Lagay Ga! 😱 Latest Bridal Kundan Jewellery Haul 2026 | Budget Friendly Artificial Sets ✨</video:title>
      <video:description>✨ REAL GOLD LOOK IN BUDGET! ✨ Aaj ki video mein hum aapke sath share kar rahe hain latest trending Imitation &amp; Artificial Jewellery Sets (Kundan, Polki, Antique Gold, aur American Diamond designs). Agar aap bridal, wedding, ya festive wear ke liye designer jewellery budget mein chahte hain, toh ye video end tak lazmi dekhein! 📌 Timestamps / Video Chapters: 0:00 - Intro &amp; Latest Jewellery Overview 0:45 - Royal Bridal Kundan &amp; Polki Sets 2:15 - Lightweight Party Wear &amp; Choker Sets 3:50 - American Diamond (AD) &amp; Zircon Collection 5:10 - Price, Wholesale Details &amp; How to Order 6:30 - Outro &amp; Care Tips 🛒 How to Order / Contact Us: 📱 WhatsApp for Booking: +91-XXXXX-XXXXX / +92-XXXXX-XXXXX 🌐 Website / Instagram: @YourBrandName 🚚 Cash on Delivery Available / Worldwide Shipping --------------------------------------------------- 🔔 DON&apos;T FORGET TO: LIKE 👍 | SHARE 📲 | SUBSCRIBE 🔴 &amp; Press the Bell Icon for New Wholesale Updates! --------------------------------------------------- #imitationjewellery #artificialjewellery #kundanjewellery #bridaljewellery #wholesalejewellery #jewelleryhaul #trendingfashion2026 Ranking, aur Viral Reach paane ke liye Complete Kit: 1. High-CTR Catchy Headings (Choose One) Thumbnail aur Title mil kar click generate karte hain. Inme se apni video types ke mutabiq chunen: * Option 1 (For Bridal/Wedding Sets): Real Gold Lagay Ga! 😱 Latest Bridal Kundan Jewellery Haul 2026 | Budget Friendly Artificial Sets ✨ * Option 2 (For Wholesale/Low Price Focus): Saste Tareen Jewellery Market 💥 Latest Artificial Kundan &amp; Polki Sets Under ₹500/Rs1000! * Option 3 (For Modern/Daily Wear): Unboxing Latest Designer Imitation Jewellery Sets 😍 Sabyasachi Look in Budget! * Option 4 (Viral / Short Hook): Real Gold Chhoro! ❌ Try These Trending Artificial Sets 💫 Wholesale Rates! 2</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394008/3394008_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T19:17:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Colastei coração ❤️</video:title>
      <video:description>🌿 Você conhece essa planta? Uma planta linda e cheia de curiosidades! 🌱 Você já conhecia? Siga para mais vídeos sobre plantas e flores. #PlantasIncríveis</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394007/3394007_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T19:17:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_503.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_503.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394006/3394006_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:17:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Unexpected Tiger in the Garden! 😱🐅</video:title>
      <video:description>It&apos;s beautiful, everyone, watch the tiger video.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394005/3394005_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:16:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_502.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_502.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394004/3394004_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:16:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devil may cry.Dante</video:title>
      <video:description>Two brothers,one victor. dante on vergil #Danteorvergil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394003/3394003_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T19:16:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>哈哈，姨姨們感覺我跳舞的水平</video:title>
      <video:description>哈哈，姨姨們感覺我跳舞的水平，日漸增長 #騙你生女兒 #人類幼崽 #愛跳舞的小姑娘 #萌娃跳舞.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394002/3394002_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T19:16:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_501.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_501.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394001/3394001_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:16:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_500.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_500.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394000/3394000_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:16:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você_Não_Vai_Acreditar_Como_a_Justiça_é_Servida_Aqui!</video:title>
      <video:description>#Brasilmoçambique</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393999/3393999_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-01T19:15:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_499.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_499.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393998/3393998_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:15:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Latest imtation artificial jewelry jewelry heading batao</video:title>
      <video:description>Punjabi imitation aur artificial jewelry sets ke liye traditional, wedding, aur modern fusion headings: Traditional &amp; Heritage Sets * Royal Pippal Patti Masterpieces * Antique Jadau &amp; Kundan Heritage Sets * Authentic Punjabi Hasli &amp; Choker Sets * Virasat Gold-Look Patra Jewelry Collection Bridal &amp; Wedding Special * Punjabi Dulhan Royal Chooda &amp; Kaleera Sets * Royal Nizamia Kundan Bridal Sets * Grand Jaggo &amp; Sangeet Night Statement Sets * Sabyasachi-Style Heavy Polki Bridal Sets Festive &amp; Cultural (Giddha / Teeyan Specials) * Phulkari Match Festive Choker Sets * Royal Chandbali &amp; Maang Tikka Combo Sets * Traditional Jaggo &amp; Dholki Glam Sets * Modern Craft Sheesha &amp; Mirror Work Sets Indo-Western &amp; Daily Wear * Minimalist Pearl &amp; Kundan Fusion Sets * Boho Punjabi Oxidized Silver Collection * Lightweight Party Wear Jaggo Sets * Sleek Metallic Punjabi Suits Accessories Social Media Captions / Taglines * &quot;Pure Punjabi Swag, Budget-Friendly Price.&quot; * &quot;Bring Home the True Punjabi Virasat.&quot; * &quot;Royal Punjabi Elegance Without Gold Prices.&quot; #Punjabiimitationaurartificialjewelrysetskeliyetraditional #wedding #aurmodernfusionheadingsTraditionalHeritageSetsRoyalPippalPattiMasterpiecesAntiqueJadauKundanHeritageSetsAuthenticPunjabiHasliChokerSetsVirasatGold-LookPatraJewelryCollectionBridalWeddingSpecialPunjabiDulhanRoyalChoodaKaleeraSetsRoyalNizamiaKundanBridalSetsGrandJaggoSangeetNightStatementSetsSabyasachi-StyleHeavyPolkiBridalSetsFestiveCulturalGiddhaTeeyanSpecialsPhulkariMatchFestiveChokerSetsRoyalChandbaliMaangTikkaComboSetsTraditionalJaggoDholkiGlamSetsModernCraftSheeshaMirrorWorkSetsIndo-WesternDailyWearMinimalistPearlKundanFusionSetsBohoPunjabiOxidizedSilverCollectionLightweightPartyWearJaggoSetsSleekMetallicPunjabiSuitsAccessoriesSocialMediaCaptionsTaglinesPurePunjabiSwag #Bud</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393997/3393997_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T19:15:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_498.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_498.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393996/3393996_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:15:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Sky &amp; Nature View in Village Life..</video:title>
      <video:description>Experience the tranquil beauty of nature with dramatic clouds and scenic village landscapes. Watch the mesmerising sky, lush green fields, and calm rural environment. Relax and enjoy the peaceful vibes of countryside scenery. #sky #clouds #nature #village #landscape #beautifulsky #countryside #greenfields #rurallife #cloudformation #peaceful #travel #natureview #bluesky</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393994/3393994_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T19:15:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_497.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_497.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393993/3393993_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:14:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>é só crê no poder de Deus 🙏 2</video:title>
      <video:description>Vídeo relacionado a palavra de Deus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393992/3393992_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:14:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bonde do Vaqueiro !!</video:title>
      <video:description>Vaquejada das boas!!;</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393990/3393990_720p.mp4</video:content_loc>
      <video:duration>208</video:duration>
      <video:publication_date>2026-09-01T19:14:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hottie mini bunny</video:title>
      <video:description>tell my how #bodyslim #sexy #naked #bikini #hottes #boobs #pussy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393989/3393989_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T19:14:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_496.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_496.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393987/3393987_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:14:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Divisha Dance 2</video:title>
      <video:description>Indian Girl Divisha Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393985/3393985_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-01T19:14:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_495.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_495.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393984/3393984_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:14:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393983</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393983/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_494.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_494.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393983/3393983_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T19:13:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>é só crê no poder de Deus 🙏</video:title>
      <video:description>Vídeo relacionado a palavra de Deus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393982/3393982_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:13:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Multi-Million Dollar World of Indian Diamond Jewelry</video:title>
      <video:description>A complete SEO kit for your video on Fashion Life, tailored for maximum Click-Through Rate (CTR) and search ranking. High-CTR Video Titles * Option 1 (High CTR &amp; Brand Integration): Inside the Multi-Million Dollar World of Indian Diamond Jewelry | Fashion Life * Option 2 (Curiosity &amp; Luxury): The Most Extravagant Indian Diamond Jewelry Ever Made 💎 | Fashion Life * Option 3 (SEO Focused): Indian Royal Diamond Jewelry: Polki, Uncut Diamonds &amp; High Craftsmanship | Fashion Life SEO-Optimized YouTube Description Welcome back to Fashion Life! In today’s video, step inside the breathtaking and extravagant world of Indian diamond jewelry 💎✨ From ancient Nizam royal heritage to modern high-jewelry masterpieces worn on global red carpets, Indian diamond craftsmanship represents the peak of luxury, culture, and artistry. Discover how master artisans transform rare diamonds into heavy bridal chokers, heritage Polki sets, and timeless heirloom pieces. 📌 Key Highlights in This Video: * 00:00 - Welcome to Fashion Life | Indian Diamond Heritage * 01:30 - Polki vs. Modern Cut Diamonds: What Makes Them Royal? * 04:15 - Multi-Million Dollar Royal Indian Jewelry Sets * 07:00 - Modern Celebrity Trends &amp; Red Carpet Diamond Looks * 09:20 - Craftsmanship, Setting Techniques &amp; Buying Guide ✨ Why Indian Diamond Jewelry Stands Out: India&apos;s rich diamond history began with the legendary Golconda mines. Today, master jewelers combine ancient Kundan-Polki work with brilliant-cut diamonds to create statement designs for luxury collectors and royal weddings. 📲 Connect with Fashion Life: * Subscribe to Fashion Life: [Insert Your Channel Link] * Instagram: [Insert Instagram Handle] * TikTok / Shorts: [Insert Handle] 👍 Don&apos;t forget to LIKE, SHARE, and SUBSCRIBE for more luxury fashion, high-jewelry trends</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393981/3393981_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T19:13:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trump diz que não descarta &apos;rever&apos; posição dos EUA sobre Malvinas 2</video:title>
      <video:description>Trump diz que não descarta &apos;rever&apos; posição dos EUA sobre Malvinas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393980/3393980_720p.mp4</video:content_loc>
      <video:duration>159</video:duration>
      <video:publication_date>2026-09-01T19:13:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>La belle et la famille à la place.</video:title>
      <video:description>C&apos;est bien.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393979/3393979_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T19:13:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Black Thong Try-On Showcase! ✨ Tap &apos;Follow&apos; for more looks.</video:title>
      <video:description>Trying on this beautiful and sexy black thong set. Loving how confident and elegant the details make you feel! 🖤 ✨ Tap the &quot;Follow&quot; button to support my profile and catch all my daily updates and fashion inspo! Don&apos;t forget to drop a comment below and let me know your thoughts! 👇 #lingerietryonhaulblackthonggorgeousbeautyfashioninspooutfitofthedayusaaestheticforyou</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393978/3393978_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T19:12:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ela pegou a Cartão de sua mãe.</video:title>
      <video:description>Ela pegou o cartão de sua Mãe.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393976/3393976_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T19:12:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot 11</video:title>
      <video:description>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393975/3393975_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T19:12:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oops 😁🤣 2</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393974/3393974_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T19:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot 10</video:title>
      <video:description>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393973/3393973_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T19:12:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Barretos Cowboy Festival final 2026</video:title>
      <video:description>The Barretos festival 2016</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393972/3393972_720p.mp4</video:content_loc>
      <video:duration>178</video:duration>
      <video:publication_date>2026-09-01T19:12:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot 9</video:title>
      <video:description>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393971/3393971_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T19:12:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A verdadeira sabedoria não está nos livros | O que a vida não te ensinou</video:title>
      <video:description>A verdadeira sabedoria de vida não está em livros, mas nas marcas do tempo. Entenda por que o silêncio dos mais velhos guarda lições. Este vídeo reflete sobre onde reside o conhecimento real, distanciando-se dos monumentos e da teoria acadêmica. O conteúdo é voltado para quem busca compreender a profundidade das experiências humanas e o valor que o envelhecimento traz para a nossa percepção da realidade. Exploramos como as histórias pessoais moldam quem somos. Ao observar as marcas do tempo no rosto de quem viveu muito, encontramos verdades que nenhuma biblioteca poderia ensinar. As memórias carregam lições fundamentais que muitas vezes ignoramos na correria do dia a dia. Aprender a ouvir o silêncio de quem já experimentou tanto é um exercício de humildade e crescimento pessoal que todos deveriam praticar. Inscreva-se para reflexões semanais sobre comportamento humano e nos conte nos comentários: qual é a lição mais valiosa que você aprendeu com alguém mais velho? #sabedoriasegredo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393970/3393970_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T19:11:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trending &amp; Lifestyle jewelry set up for</video:title>
      <video:description>Top Hashtags for YouTube, Instagram, and Shorts/Reels Primary High-Traffic Hashtags * #FashionLife * #IndianDiamondJewelry * #HighJewelry * #LuxuryJewelry * #DiamondJewelry Niche &amp; Heritage Hashtags * #PolkiDiamonds * #RoyalIndianJewelry * #GolcondaDiamonds * #BridalJewelry * #UncutDiamonds Trending &amp; Lifestyle Hashtags * #LuxuryLifestyle * #JewelryDesign * #IndianBridal * #HauteJoaillerie * #JewelryTrends &gt; Tip: On YouTube, add the top 3-5 hashtags (e.g., #FashionLife #IndianDiamondJewelry #LuxuryJewelry) directly at the very bottom of your video description box so they appear above/below your video title. For Instagram or YouTube Shorts, use 8–12 relevant hashtags in your first comment or caption. &gt; #TopHashtagsforYouTube #Instagram #andShortsReelsPrimaryHigh-TrafficHashtagsFashionLifeIndianDiamondJewelryHighJewelryLuxuryJewelryDiamondJewelryNicheHeritageHashtagsPolkiDiamondsRoyalIndianJewelryGolcondaDiamondsBridalJewelryUncutDiamondsTrendingLifestyleHashtagsLuxuryLifestyleJewelryDesignIndianBridalHauteJoaillerieJewelryTrendsTipOnYouTube #addthetop3-5hashtagseg #FashionLifeIndianDiamondJewelryLuxuryJewelrydirectlyattheverybottomofyourvideodescriptionboxsotheyappearabovebelowyourvideotitleForInstagramorYouTubeShorts #use8–12relevanthashtagsinyourfirstcommentorcaption</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393968/3393968_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T19:11:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393967</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393967/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>funny bee</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393967/3393967_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T19:11:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DANGDUT 2</video:title>
      <video:description>SIMPATIK MUSIC Presenting melodious dangdut duets by authentic Indonesian singers. #Dangdut</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393966/3393966_720p.mp4</video:content_loc>
      <video:duration>455</video:duration>
      <video:publication_date>2026-09-01T19:11:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Star Wars – Jedi Padawans plays The Throne Room conducted by the Jedi Master Andrzej Kucybała</video:title>
      <video:description>Experience the legendary Star Wars theme, “The Throne Room,” performed by Jedi Padawans under the direction of Jedi Master Andrzej Kucybała. An epic orchestral performance filled with emotion, grandeur, and the unmistakable spirit of the galaxy far, far away. #StarWarsTheThroneRoomCinematicMusicJediPadawans</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393965/3393965_720p.mp4</video:content_loc>
      <video:duration>478</video:duration>
      <video:publication_date>2026-09-01T19:10:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happybirthday my love</video:title>
      <video:description>#Amor #namorados #relacionamento</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393964/3393964_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T19:10:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu lanche especial</video:title>
      <video:description>Vamos lanchar um lanche maravilhoso comigo #Lanche</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393963/3393963_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-01T19:10:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sagrada Palavra</video:title>
      <video:description>#thechosen #osescolhidos #deus #jesus #series #shorts #filmes #fe - Sagrada Palavra</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393962/3393962_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T19:10:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sweet templation</video:title>
      <video:description>Episode 1</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393961/3393961_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-09-01T19:10:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novo estratégia de ganhar dinheiro como afiliado da Shopee</video:title>
      <video:description>#Dinheiroafiliadosafiliadosshopeeganhardinheironaintetnet</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393960/3393960_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:10:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Men’s Herbal Vitality Supplement</video:title>
      <video:description>This herbal supplement is designed for adult men who want to maintain an active lifestyle and support their natural vitality. With carefully selected botanical ingredients, it can be a convenient addition to a balanced diet and healthy daily routine.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393959/3393959_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T19:10:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Instant Karma🤣🤣</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393958/3393958_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:10:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thalita canta emocionante Equivocada</video:title>
      <video:description>A maior cantora latina expressa sua canção #musicamusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393957/3393957_720p.mp4</video:content_loc>
      <video:duration>242</video:duration>
      <video:publication_date>2026-09-01T19:10:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Damon slayer- castelo infinito filme</video:title>
      <video:description>#Damonslayer</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393956/3393956_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-01T19:10:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>小馅饼</video:title>
      <video:description>收入 #收入</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393954/3393954_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T19:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐔🚨 SOCORRO, DONA MARIA, SOLTA O PINTO DO MOISÉS! 🚨🐔</video:title>
      <video:description>Quando a vizinhança vira um verdadeiro campo de guerra por causa de um pinto de estimação, a única saída é rir (ou chorar junto com o dono desesperado) 😂🌽. Aperte o play e venha conferir o clipe animado mais hilário e caipira da internet! Se o pinto tá preso, a gente tá chorando de rir. 👇 Deixe nos comentários: você acha que a Dona Maria tem coração duro ou o Moisés que lute? #HumorCaipiraAnimacao2DMusicaComediaRoçaDonaMariaRisadas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393953/3393953_720p.mp4</video:content_loc>
      <video:duration>130</video:duration>
      <video:publication_date>2026-09-01T19:09:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Iron Man Coming</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393952/3393952_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T19:09:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ultimate Luxury Party Sandals Guide (Elevate Your Style)</video:title>
      <video:description>Luxury Party Sandals to Elevate Your Evening Look 👠✨ Transform Your Evening Outfit: Luxury Party Sandals You Need! The Ultimate Luxury Party Sandals Guide (Elevate Your Style) Elevate your evening look instantly with the ultimate collection of luxury party sandals! Whether you&apos;re dressing up for a wedding, cocktail party, or a night out, the right pair of designer heels can completely transform your outfit. 👠 In this video, we showcase the top trending luxury sandals—featuring sparkling embellishments, sleek stilettos, elegant straps, and comfortable luxury heels that combine glamour with class. Subscribe for more luxury fashion, shoe styling, and outfit ideas! Like this video if you love high-end footwear, and drop a comment below on which pair was your favorite! 💬 #LuxurySandals #EveningLook #PartyWearShoes #DesignerHeels #FashionStyling #LuxuryFootwear #HighHeels #PartySandals Luxury party sandals, evening look heels, designer party shoes, stylish sandals for women, high heels for wedding party, luxury footwear styling. luxury party sandals evening footwear designer party heels elevate your evening look party heels for women luxury shoe haul high heels try on Style &amp; Trend Tags embellished heels metallic sandals sparkling heels ankle strap heels classy party outfit ideas evening gown shoes wedding guest heels Long-Tail &amp; Search-Focused Tags comfortable luxury party sandals how to style heels for evening look luxury sandals for night out best designer shoes for parties luxury shoe collection 2026 luxury party sandals, evening footwear, designer party heels, elevate your evening look, party heels for women, luxury shoe haul, high heels try on, embellished heels, metallic sandals, sparkling heels, ankle strap heels, classy party outfit ideas, evening gown shoes, wedding</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393951/3393951_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T19:09:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POV: You&apos;re 30 and you&apos;re a judoka.</video:title>
      <video:description>POV: You&apos;re 30 and you&apos;re a judoka. The real enemy isn&apos;t your opponent... it&apos;s the gi that never stays white 😂 Have you ever been thrown so hard you questioned your life choices? 👇 #judoka #pov #humor&quot;</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393950/3393950_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T19:09:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PHOENIX VALKYRIES - “The Mountain’s Cry”- Epic Power Metal | AI MUSIC VIDEO Cinematic</video:title>
      <video:description>⚔️ About the song: Step into the frozen realms of Norse legend with Phoenix Valkyries’ newest release, “The Mountain’s Cry”. This music video is inspired by Skadi, the Norse goddess of winter, mountains, and the untamed wild. Known as the Huntress of the North, Skadi chose the mountains over the sea, embodying independence, vengeance, and unbreakable strength. Through epic metal riffs, soaring vocals, and cinematic visuals, “The Mountain’s Cry” tells the story of her eternal bond with the snow-covered peaks — a hymn to solitude, resilience, and the power of nature itself. 🔥 Subscribe and join the Valkyries in their journey across myth, legend, and metal. ⚔️ Don’t forget to like, share, and let the mountain’s cry echo within you. 🎧 Listen on all platforms: 🔗 Spotify: https://open.spotify.com/intl-pt/artist/5g958TGeG5SVW2gB1K62QW 🔗 Apple Music: https://music.apple.com/br/artist/phoenix-valkyries/1797334032 🔗 Deezer: https://www.deezer.com/br/artist/303832291 📺 Watch more Phoenix Valkyries music videos: 🔹 [Hearts of Steel] - https://youtu.be/UTdj-0IY544?si=xgvla25xzdOznXdb 🔹 [The Call of Yggdrasil] - https://youtu.be/E067rwx4lIk?si=BbZPzIsDa0nxsbyn 🔹 [Echoes of Eternity] - https://youtu.be/W3iwu5Vjzdo?si=nbO2LqONSUm8pmlg 📲 Follow us on social media! 🔥 Instagram: https://www.instagram.com/phoenixvalkyriesofficial/ 🔥 TikTok: https://www.tiktok.com/@phoenix.valkyries 🛒 Buy official merchandise! 👕 T-shirts, posters and more: coming soon 📢 Support the band! Not subscribed? Consider subscribing, it&apos;s very important for the growth of the channel: https://www.youtube.com/channel/UC9xPktKI4AgryFA6_Fx1zOg?sub_confirmation=1 🔸 Leave a like 👍 🔸 Comment what you think of the song! ❄️🔥 🔸 Share with your friends who like epic metal! #PowerMetal #SymphonicMetal #PhoenixValkyries #FrostKin</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393949/3393949_720p.mp4</video:content_loc>
      <video:duration>250</video:duration>
      <video:publication_date>2026-09-01T19:08:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Little Piggy taking a walk in Crocodiles</video:title>
      <video:description>#Piggy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393948/3393948_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T19:08:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>柠檬挞</video:title>
      <video:description>收入 #收入</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393947/3393947_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T19:08:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Otra razón por la que las mujeres viven más que los hombres</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393946/3393946_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:08:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soap of fruits</video:title>
      <video:description>Soap of fruits</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393945/3393945_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-09-01T19:08:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Ultimate Luxury Party Sandals Guide (Elevate Your Style)</video:title>
      <video:description>Luxury Party Sandals to Elevate Your Evening Look 👠✨ Transform Your Evening Outfit: Luxury Party Sandals You Need! The Ultimate Luxury Party Sandals Guide (Elevate Your Style) Elevate your evening look instantly with the ultimate collection of luxury party sandals! Whether you&apos;re dressing up for a wedding, cocktail party, or a night out, the right pair of designer heels can completely transform your outfit. 👠 In this video, we showcase the top trending luxury sandals—featuring sparkling embellishments, sleek stilettos, elegant straps, and comfortable luxury heels that combine glamour with class. Subscribe for more luxury fashion, shoe styling, and outfit ideas! Like this video if you love high-end footwear, and drop a comment below on which pair was your favorite! 💬 #LuxurySandals #EveningLook #PartyWearShoes #DesignerHeels #FashionStyling #LuxuryFootwear #HighHeels #PartySandals Luxury party sandals, evening look heels, designer party shoes, stylish sandals for women, high heels for wedding party, luxury footwear styling. luxury party sandals evening footwear designer party heels elevate your evening look party heels for women luxury shoe haul high heels try on Style &amp; Trend Tags embellished heels metallic sandals sparkling heels ankle strap heels classy party outfit ideas evening gown shoes wedding guest heels Long-Tail &amp; Search-Focused Tags comfortable luxury party sandals how to style heels for evening look luxury sandals for night out best designer shoes for parties luxury shoe collection 2026 luxury party sandals, evening footwear, designer party heels, elevate your evening look, party heels for women, luxury shoe haul, high heels try on, embellished heels, metallic sandals, sparkling heels, ankle strap heels, classy party outfit ideas, evening gown shoes, wedding</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393944/3393944_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T19:07:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Women at Work. 🪵🪓</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393943/3393943_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T19:07:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HOMEM RAIZ - Mel com Abelha - Os Melhores Clipes</video:title>
      <video:description>O verdadeiro Homem Raiz: mel puro com abelha, direto da roca. Humor raiz e autentico para voce curtir. Se inscreva e ative o sininho para mais videos como este! #homemraiz #melcomabelha #humorraiz #roca #vidanocampo #videoengra�ado</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393942/3393942_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T19:06:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Transform Your Evening Outfit: Luxury Party Sandals You Need!</video:title>
      <video:description>Luxury Party Sandals to Elevate Your Evening Look 👠✨ Transform Your Evening Outfit: Luxury Party Sandals You Need! The Ultimate Luxury Party Sandals Guide (Elevate Your Style) Elevate your evening look instantly with the ultimate collection of luxury party sandals! Whether you&apos;re dressing up for a wedding, cocktail party, or a night out, the right pair of designer heels can completely transform your outfit. 👠 In this video, we showcase the top trending luxury sandals—featuring sparkling embellishments, sleek stilettos, elegant straps, and comfortable luxury heels that combine glamour with class. Subscribe for more luxury fashion, shoe styling, and outfit ideas! Like this video if you love high-end footwear, and drop a comment below on which pair was your favorite! 💬 #LuxurySandals #EveningLook #PartyWearShoes #DesignerHeels #FashionStyling #LuxuryFootwear #HighHeels #PartySandals Luxury party sandals, evening look heels, designer party shoes, stylish sandals for women, high heels for wedding party, luxury footwear styling. luxury party sandals evening footwear designer party heels elevate your evening look party heels for women luxury shoe haul high heels try on Style &amp; Trend Tags embellished heels metallic sandals sparkling heels ankle strap heels classy party outfit ideas evening gown shoes wedding guest heels Long-Tail &amp; Search-Focused Tags comfortable luxury party sandals how to style heels for evening look luxury sandals for night out best designer shoes for parties luxury shoe collection 2026 luxury party sandals, evening footwear, designer party heels, elevate your evening look, party heels for women, luxury shoe haul, high heels try on, embellished heels, metallic sandals, sparkling heels, ankle strap heels, classy party outfit ideas, evening gown shoes, wedding</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393941/3393941_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T19:06:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pão de batata</video:title>
      <video:description>Receita #Receita</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393940/3393940_720p.mp4</video:content_loc>
      <video:duration>126</video:duration>
      <video:publication_date>2026-09-01T19:06:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oops 😁🤣</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393939/3393939_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:06:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Luxury Party Sandals to Elevate Your Evening Look 👠✨</video:title>
      <video:description>Luxury Party Sandals to Elevate Your Evening Look 👠✨Luxury Party Sandals to Elevate Your Evening Look 👠✨ Transform Your Evening Outfit: Luxury Party Sandals You Need! The Ultimate Luxury Party Sandals Guide (Elevate Your Style) Elevate your evening look instantly with the ultimate collection of luxury party sandals! Whether you&apos;re dressing up for a wedding, cocktail party, or a night out, the right pair of designer heels can completely transform your outfit. 👠 In this video, we showcase the top trending luxury sandals—featuring sparkling embellishments, sleek stilettos, elegant straps, and comfortable luxury heels that combine glamour with class. Subscribe for more luxury fashion, shoe styling, and outfit ideas! Like this video if you love high-end footwear, and drop a comment below on which pair was your favorite! 💬 #LuxurySandals #EveningLook #PartyWearShoes #DesignerHeels #FashionStyling #LuxuryFootwear #HighHeels #PartySandals Luxury party sandals, evening look heels, designer party shoes, stylish sandals for women, high heels for wedding party, luxury footwear styling. luxury party sandals evening footwear designer party heels elevate your evening look party heels for women luxury shoe haul high heels try on Style &amp; Trend Tags embellished heels metallic sandals sparkling heels ankle strap heels classy party outfit ideas evening gown shoes wedding guest heels Long-Tail &amp; Search-Focused Tags comfortable luxury party sandals how to style heels for evening look luxury sandals for night out best designer shoes for parties luxury shoe collection 2026 luxury party sandals, evening footwear, designer party heels, elevate your evening look, party heels for women, luxury shoe haul, high heels try on, embellished heels, metallic sandals, sparkling heels, ankle strap heels, cl</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393938/3393938_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T19:05:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O MISTÉRIO DO CONCRETO ROMANO ( THE MISTERY OF ROMAN CONCRETE)</video:title>
      <video:description>O concreto romano é uma das grandes façanhas da engenharia da Antiguidade. Usado em portos, aquedutos, templos e outras construções, ele demonstrou uma durabilidade impressionante, permanecendo resistente por milhares de anos. Pesquisas modernas indicam que sua composição, especialmente o uso de cal e materiais vulcânicos, podia provocar reações que ajudavam a reparar pequenas fissuras ao longo do tempo. O segredo dessa antiga tecnologia ainda é estudado pela ciência. Roman concrete is one of the great achievements of ancient engineering. Used in ports, aqueducts, temples, and other structures, it has shown remarkable durability, surviving for thousands of years. Modern research suggests that its composition, particularly the use of lime and volcanic materials, could trigger reactions that helped repair small cracks over time. The secrets behind this ancient technology are still being studied by scientists today. #documentário #história #romaantiga #civilizaçãoantiga #entretenimento #educação #ciência #mistério</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393937/3393937_720p.mp4</video:content_loc>
      <video:duration>279</video:duration>
      <video:publication_date>2026-09-01T19:05:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belle&apos;s story</video:title>
      <video:description>Subscribe, hit the like button, and leave a comment #Brasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393936/3393936_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:05:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ikki ressurgiu insano cavaleiro de feliz</video:title>
      <video:description>#EntradaépicaIkkidefenix</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393935/3393935_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T19:05:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You want me? But take one more step toward my family.And you&apos;ll regret it.💀</video:title>
      <video:description>You want me? But take one more step toward my family.And you&apos;ll regret it.💀 #Viral #trending #ai #reaper</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393934/3393934_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T19:04:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seladora Rotativa</video:title>
      <video:description>Selagem ultrassônico de bisnaga de produtos. #Seladora</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393933/3393933_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T19:04:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivação do dia 3</video:title>
      <video:description>Motivação #Motivação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393931/3393931_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T19:04:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost In The Wool Blues</video:title>
      <video:description>A place where deep emotions meet soulful blues music. Discover relaxing blues playlists, romantic guitar melodies, smoky bar vibes, midnight blues sessions, rain atmosphere, vintage sounds and timeless soul. #Perfectforrelaxing #studying #latenights #emotionalmomentsandtrueblueslovers</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393930/3393930_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-09-01T19:04:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>跟著姐姐學了新舞蹈！姨姨 姐姐們我跳的好看嗎？</video:title>
      <video:description>跟著姐姐學了新舞蹈！姨姨 姐姐們我跳的好看嗎？ #萌娃跳舞 #愛跳舞的小姑娘 #姐姐怎麼都好看 #小雲雀AI #小雲雀seedance.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393929/3393929_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T19:04:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>é o Fusca 1959, um projeto especial restaurado completamente</video:title>
      <video:description>é o Fusca 1959, um projeto especial restaurado completamente de acordo com as exigências do cliente, pintado na icônica cor alemã Agave Green da linha Sikkens. Além da restauração impecável, esse clássico recebe.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393927/3393927_720p.mp4</video:content_loc>
      <video:duration>89</video:duration>
      <video:publication_date>2026-09-01T19:03:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus will teach you to forgive</video:title>
      <video:description>#thechosen #osescolhidos #deus #jesus #series #shorts #filmes #fe - Sagrada Palavra</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393926/3393926_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-01T19:03:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bolachinha de natal</video:title>
      <video:description>Receita Natalina #Receita</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393924/3393924_720p.mp4</video:content_loc>
      <video:duration>94</video:duration>
      <video:publication_date>2026-09-01T19:03:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meco - Star Wars and Other Galactic Funk - Star Wars (Vinyl Recording) 1977</video:title>
      <video:description>Star Wars and Other Galactic Funk é o álbum de estreia do músico americano Meco, lançado pela Millennium Records em 1977. Meco, que teve uma carreira estável como músico de estúdio e produtor, era um ávido fã de ficção científica.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393923/3393923_720p.mp4</video:content_loc>
      <video:duration>934</video:duration>
      <video:publication_date>2026-09-01T19:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SÃO ZENÃO DEFENSOR DA FÉ, ROGAI POR NÓS.</video:title>
      <video:description>Conheça a história impressionante de são Zenão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393921/3393921_720p.mp4</video:content_loc>
      <video:duration>234</video:duration>
      <video:publication_date>2026-09-01T19:03:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu almoço de hoje</video:title>
      <video:description>#Almoçar #comida #cozinhar #comer</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393920/3393920_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-01T19:02:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FLYING THROUGH THE RAIN 🌧️ #trackandfield #longjump #athletics.mp4</video:title>
      <video:description>FLYING THROUGH THE RAIN 🌧️ #trackandfield #longjump #athletics.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393919/3393919_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T19:02:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>&apos; VIBRATION &apos;  🎧 🔉 🔊</video:title>
      <video:description>APERTE O PLAY E SINTAM A VIBE !! #musicaeletronica #musicaeletronica24h #musicaeletronicaemingles #topmusicaseletronicas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393918/3393918_720p.mp4</video:content_loc>
      <video:duration>360</video:duration>
      <video:publication_date>2026-09-01T19:02:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Pirâmide Perdida do Deserto</video:title>
      <video:description>Os protagonistas seguram um antigo mapa dourado que aponta para uma gigantesca pirâmide escondida entre as dunas do deserto. A entrada da pirâmide possui uma enorme porta de pedra com um símbolo de cacto azul brilhante. #osmalucosdodeserto</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393917/3393917_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T19:01:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>OS 15 MINUTOS QUE MUDARAM OSIMHEN</video:title>
      <video:description>DA POBREZA A FAMA!! IMPRESSIONANTE A SUPERAÇÃO DESSE MENINO!!! #futebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393915/3393915_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-01T19:01:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Place Looks Like Another Planet! 🌋</video:title>
      <video:description>This Place Looks Like Another Planet! 🌋 #travel #mysteriousplaces #amazing</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393914/3393914_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T19:01:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Argyle Grant | Resort 2020 | Miami Swim Week - Art Hearts Fashion</video:title>
      <video:description>ArgyleGrant #Resort20 #ArtHeartsFashion #MiamiSwimWeek</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393913/3393913_720p.mp4</video:content_loc>
      <video:duration>287</video:duration>
      <video:publication_date>2026-09-01T19:01:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Try not to laugh 87</video:title>
      <video:description>Try not to laugh top 100</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393910/3393910_720p.mp4</video:content_loc>
      <video:duration>998</video:duration>
      <video:publication_date>2026-09-01T19:00:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cavaleiros dos zodíaco</video:title>
      <video:description>#Cavaleirodefenix</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393908/3393908_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T19:00:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JANELA PARA O INFERNO</video:title>
      <video:description>HUMOR NEGRO, VALE A PENA ASSISTIR!!! #HUMORNEGRO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393907/3393907_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T19:00:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Fast 2026 Is Passing By ⏳</video:title>
      <video:description>A relatable video featuring Leonardo DiCaprio showing how quickly time is flying through 2026. From the start of the year to September 1st, the calendar dates flash by in a blink of an eye.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393906/3393906_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T19:00:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>⚠️ YOU DIDN&apos;T FIND THIS VIDEO BY CHANCE</video:title>
      <video:description>⚠️ YOU DIDN&apos;T FIND THIS VIDEO BY CHANCE #faith #prayer #prayer Subscribe to our channel #Prayer #motivation #motivational #faith</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393904/3393904_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T19:00:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Lingerie &amp; Bikini Try-On! 🔥 USA Summer Style Showcase. 2</video:title>
      <video:description>Trying on the ultimate sexy lingerie and bikini pieces today! Obsessed with the fit and the hot summer vibes of this collection. ☀️👙 ✨ Tap &quot;Follow&quot; right now to support my channel and catch all my daily drops! Let me know your favorite look in the comments below! 👇 #lingeriebikinitryonhaulbikinimodelsummerstylefashioninspousagorgeousbeautyforyou</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393903/3393903_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T18:59:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A CIDADE DE UM PRÉDIO SÓ</video:title>
      <video:description>VOCÊ CONSEGUIRIA MORAR AE?</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393901/3393901_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T18:59:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NEVER LOVED ME</video:title>
      <video:description>Luma Valentina delivers emotional blues and soulful midnight vibes. Perfect for late nights, heartbreak moments and deep feelings. Subscribe for more soul and blues music.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393899/3393899_720p.mp4</video:content_loc>
      <video:duration>199</video:duration>
      <video:publication_date>2026-09-01T18:58:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O mandamento é o amor</video:title>
      <video:description>Vídeo gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393898/3393898_720p.mp4</video:content_loc>
      <video:duration>253</video:duration>
      <video:publication_date>2026-09-01T18:58:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time to Fall in Love EP03 Exchange identity to become CEO’s gf Luo Zheng, Lin Xinyi.mp4</video:title>
      <video:description>*Time to Fall in Love* is a Chinese romantic comedy centering on Su Yan Xi, an optimistic and independent livestreamer. To help cover her ailing mother&apos;s medical expenses, she accepts a risky proposition: assuming her twin sister&apos;s identity and signing a contract to become the girlfriend of Gu Xi Cheng, the CEO of a major corporation. Gu Xi Cheng is a cold, methodical man who sought this fake relationship solely to fulfill his sick grandmother&apos;s wish. However, living together and Su Yan Xi&apos;s vibrant personality begin to melt the executive&apos;s icy exterior, transforming the charade into a genuine, sweeping romance. #TimetoFallinLove #C-Drama #ChineseDrama #Romance #RomanticComedy #ContractRelationship #FakeDating #ContractGirlfriend #CEORomance #MistakenIdentity #TwinSisters #LuoZheng #LinXinyi #FakeLove #ForcedProximity #RichCEO #OppositesAttract</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393896/3393896_720p.mp4</video:content_loc>
      <video:duration>2129</video:duration>
      <video:publication_date>2026-09-01T18:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MODUS VIVENDI Organic Line Campaign by Gastohn Barrios (Full &amp; Uncensored Version)</video:title>
      <video:description>MODUS VIVENDI Organic Line Campaign by Gastohn Barrios (teaser) MODUS VIVENDI proudly presents the Organic Line, showing men on duty. It’s time for 100% sustainable underwear, made of organic cotton which is part of our responsible edit. And we couldn’t imagine this pair of undies but on men in nature. Retro aesthetic is mixed with a great dose of sexiness yet the kind of pure and effortless masculinity. VIDEO CREDITS: Models: Lucas Sabadini Pablo Garcilazo Photography: Gastohn Barrios Executive Production: Matías Santos General Production &amp; Video Edition: Gastohn Barrios www.gastohn.com Location: Buenos Aires Province, Argentina #USA #canada #france #argentina</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393895/3393895_720p.mp4</video:content_loc>
      <video:duration>354</video:duration>
      <video:publication_date>2026-09-01T18:58:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chaos 😁🤣</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393894/3393894_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T18:58:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden o começo</video:title>
      <video:description>Ninja Gaiden o começo da saga de um dos melhores jogos de ação e aventura... #Ninja</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393892/3393892_720p.mp4</video:content_loc>
      <video:duration>241</video:duration>
      <video:publication_date>2026-09-01T18:58:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Varguiña</video:title>
      <video:description>Ovnis,EEUU, #Ovnis #EEUU #misterios #viral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393891/3393891_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T18:58:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>História de Neymar Jr</video:title>
      <video:description>Jogos futebol #Jogos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393890/3393890_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-09-01T18:57:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gambit vs Wolverine</video:title>
      <video:description>Gambit vês Wolverine x-men origens #X-mennostalgia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393889/3393889_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T18:57:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 Would you have the courage to trust God right now?</video:title>
      <video:description>🔥 WOULD YOU HAVE THE COURAGE TO TRUST IN GOD NOW? #faith #prayer #prayer Adding Value to the YouTube Channel. Subscribe to our Channel #Prayer #faith #meme #memes #motivational</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393888/3393888_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:57:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Bias My Boss S01E09 | Hindi Dubbed | Full Episode | Korean Drama | K-Drama | HD</video:title>
      <video:description>My Bias My Boss S01E09 | Hindi Dubbed | Full Episode | Korean Drama | K-Drama | HD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393886/3393886_720p.mp4</video:content_loc>
      <video:duration>3915</video:duration>
      <video:publication_date>2026-09-01T18:57:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>oops 😁 what is this</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393883/3393883_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T18:56:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You Won’t Believe How Many People Are on This Motorcycle! 😳😂</video:title>
      <video:description>You Won’t Believe How Many People Are on This Motorcycle! 😳😂 📝 Have you ever seen something like this on the road? 😳 This unbelievable moment was caught on camera as a motorcycle carries an unexpected number of passengers — and there’s even a dog along for the ride! 🏍️🐕 Watch until the end and tell us what you think. 😂 If you enjoy crazy moments, unbelievable videos, funny moments, unexpected situations, and viral clips, follow for more! 🏷️ crazy motorcycle, overloaded motorcycle, motorcycle passengers, unbelievable moment, unbelievable video, caught on camera, crazy moments, funny moments, unexpected moment, viral video, viral clips, funny video, shocking moment, crazy traffic, road moments, motorcycle fail, funny motorcycle, dog on motorcycle, unusual moments, unbelievable things, amazing moments, crazy people, street moments, traffic video, funny shorts, viral shorts, youtube shorts, shorts, trending video, must watch 🚀 #crazymotorcycle #overloadedmotorcycle #motorcyclepassengers #unbelievablemoment #unbelievablevideo #caughtoncamera #crazymoments #funnymoments #unexpectedmoment #viralvideo #viralclips #funnyvideo #shockingmoment #crazytraffic #roadmoments #motorcyclefail #funnymotorcycle #dogonmotorcycle #unusualmoments #unbelievablethings #amazingmoments #crazypeople #streetmoments #trafficvideo #funnyshorts #viralshorts #youtubeshorts #shorts #trendingvideo #mustwatch</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393882/3393882_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T18:56:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>arroz carreteiro</video:title>
      <video:description>tem arroz e carne sobrando aí então não perder essa receita hoje eu vou ter ensinar um arroz carreteiro tão saboroso guê vai fazer tudo mundo pedir mais</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393881/3393881_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-01T18:56:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Servindo a Jesus</video:title>
      <video:description>Vídeo gospel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393880/3393880_720p.mp4</video:content_loc>
      <video:duration>243</video:duration>
      <video:publication_date>2026-09-01T18:56:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novidades por aii</video:title>
      <video:description>Games #Games</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393878/3393878_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T18:56:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oops kkk</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393876/3393876_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T18:55:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>👀 Do you think God isn&apos;t seeing your struggle?</video:title>
      <video:description>👀 DO YOU THINK GOD ISN&apos;T SEEING YOUR STRUGGLE? #faith #prayer Adding Value to the YouTube Channel. Subscribe to our Channel #Fe #memes #viral #prayer #motivation</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393875/3393875_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:55:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Sobrinha não cuidou dele 😢❤️</video:title>
      <video:description>A Sobrinha não cuidou dele 😢❤️ #viral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393873/3393873_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T18:55:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O que acontece nos primeiros minutos após a morte</video:title>
      <video:description>#Brazil #morte #alma #jesus #Deus</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393872/3393872_720p.mp4</video:content_loc>
      <video:duration>400</video:duration>
      <video:publication_date>2026-09-01T18:55:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>10..Abandoned 1972 Datsun 240Z Full Restoration - Rust to JDM Legend.mp4</video:title>
      <video:description>10..Abandoned 1972 Datsun 240Z Full Restoration - Rust to JDM Legend.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393869/3393869_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T18:55:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GTA 6 lançamento</video:title>
      <video:description>Games #Jogo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393868/3393868_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T18:55:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Mother&apos;s Love: Saving Her Kittens from Danger (Emotional Rescue)</video:title>
      <video:description>Watch this heartwarming moment as a brave mother cat moves her vulnerable kittens to a safe and secure shelter away from the harsh elements. Witness the incredible bond and instinct of a mother protecting her young. This video will surely melt your heart. Please like, comment, and subscribe for more animal rescue stories! Thanks for watching. #cat #kitten #cuteca #MotherCat #KittenRescue</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393867/3393867_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:55:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>See what God has for you today</video:title>
      <video:description>Veja o que Deus tem pra você hoje!!! encontre conforto com essa palavra de paz e amor pela sua vida #amorglobalWordofGod</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393866/3393866_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-09-01T18:55:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>teste 2</video:title>
      <video:description>teste de video #testevideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393865/3393865_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T18:54:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I WAS SHOCKED 🥵! We went to &quot;The Thong of the Year&quot; at Spartacus and the winner confessed his tricks</video:title>
      <video:description>Put down your fans and grab your wigs, you show-offs! 🚨 We went all the way inside the iconic Espartacus Disco in Neza to experience the most anticipated and dance-filled night of all: The Thong of the Year! 🍑🔥 We joined the 50 participants who gave it their ALL on stage, showcasing their bodies, boundless energy, and tons of attitude to take home the grand prize of $8,000 pesos in cash. We were front row judging (and giving them straight 10s, obviously!), and we had an exclusive chat with the night&apos;s big winner, the highly sought-after number 48. ✨🏆 The winner confessed to us the nerves of competing against such fierce rivals, the shaky legs on the dance floor, and what &quot;two or three tricks&quot; he&apos;s going to spend his winnings on. 💸🤫 Check out this video full of adrenaline, laughs, and lots of eye candy! #Spain #usa #canada #gay</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393864/3393864_720p.mp4</video:content_loc>
      <video:duration>332</video:duration>
      <video:publication_date>2026-09-01T18:54:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gambit vs vampira</video:title>
      <video:description>Anime x-men #X-mengambit</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393863/3393863_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T18:54:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BOY BRAZIL</video:title>
      <video:description>#boy #brasileiro #booty</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393861/3393861_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T18:54:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Phoenix Valkyries – Fenrir’s Wrath - Official Music Video</video:title>
      <video:description>⚔️ About the song: Unleash the fury of the beast! ⚔️🐺 This is “Fenrir’s Wrath”, the newest official music video by Phoenix Valkyries, taken from our album “Tales of Asgard”. A tale of chaos, destiny, and power inspired by Norse mythology — where the mighty wolf Fenrir rises in the twilight of the gods. 🔥 Watch the saga unfold with epic symphonic power metal visuals and sound. 🎵 Listen to the full album Tales of Asgard on all streaming platforms. 🔔 Don’t forget to subscribe and join the Valkyries on our journey through myth and metal! #FenrirsWrath #PhoenixValkyries #TalesOfAsgard #SymphonicMetal #PowerMetal #NorseMythology #HeavyMetal 🎧 Listen on all platforms: 🔗 Spotify: https://open.spotify.com/intl-pt/artist/5g958TGeG5SVW2gB1K62QW 🔗 Apple Music: https://music.apple.com/br/artist/phoenix-valkyries/1797334032 🔗 Deezer: https://www.deezer.com/br/artist/303832291 #music #ModernRock #HeavyMetal #aivideo #powermetal #phoenixvalkyries #SymphonicMetal #MetalMusic #AIgenerated #ArtificialIntelligence #NewMusicVideo #MetalCommunity #YouTubeMusic #SubscribeOnYouTube #MusicVideoRelease #SupportIndependentArtists #MetalHeadsUnite #AIBand #FutureOfMusic #TechAndArt #DigitalArtistry #VirtualBand #FollowForMore #LikeAndSubscribe #ShareTheMusic #EpicMetal #SymphonicPower #FemaleVocalMetal #FenrirsWrath #TalesOfAsgard #NorseMythology</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393860/3393860_720p.mp4</video:content_loc>
      <video:duration>400</video:duration>
      <video:publication_date>2026-09-01T18:54:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perfect 24</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393858/3393858_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T18:53:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❓ Did you ask God for an answer? Then listen to this! 🙏</video:title>
      <video:description>❓ DID YOU ASK GOD FOR AN ANSWER? THEN LISTEN TO THIS! 🙏 #faith #prayer #prayer Adding Value to the YouTube Channel. Subscribe to our Channel #Prayer #faith #hope #goodmorning #goodnight</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393857/3393857_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:53:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Potemin B12 - Suplemento Vitaminico E Mineral 120ml</video:title>
      <video:description>Saiba mais: https://s.shopee.com.br/4qFIuH499y Potemin B12 - Suplemento Vitaminico E Mineral 120ml #Achadinhos #AchadinhosAgro #ProdutosAgro #OfertasAgro #Oferta #Promocao #Compreaqui #AchadosDoAgro #Suplementoanimal #agronegocio #agronegócio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393856/3393856_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T18:53:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boca Juniors - Hinchada en la Bombonera</video:title>
      <video:description>Boca Juniors - Hinchada en la Bombonera #LaBombonera #Bombonera #Argentina #BocaJuniors #Maradona #Messi</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393855/3393855_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T18:53:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vem ver o melhor jogo</video:title>
      <video:description>Games gta #Jogo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393854/3393854_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T18:53:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Evelyn Cross – WHEN THE LIGHTS FIND US ✨ | Official Music Video</video:title>
      <video:description>Sometimes the smallest light is the one we don’t forget. ✨ “WHEN THE LIGHTS FIND US” is a cinematic story about loneliness, hope, kindness — and the invisible connections that can bring us back to one another. A woman alone in the night. A photograph. A stranger waiting for morning. A simple message: “Fique bem.” — “Be well.” One small gesture becomes another. One light finds another. Until an entire city begins to glow. Maybe we were never lost. Just too far apart. 🎵 WHEN THE LIGHTS FIND US 🎤 Evelyn Cross 🎬 Official Music Video If this song found you at the right moment, leave a ✨ in the comments. And maybe… leave a little light for someone else today. #EvelynCross #WhenTheLightsFindUs #EvelynCrossWhenTheLightsFindUs #WhenTheLightsFindUsofficialmusicvideo #EvelynCrossofficialmusicvideo #newmusic2026 #cinematicmusic #cinematicmusicvideo #emotionalmusic #emotionalsong #inspirationalsong #hopefulsong #beautifulmusicvideo #storytellingmusicvideo #cinematicpop #emotionalpop #pianoballad #orchestralpop #femalevocalist #powerfulfemalevocals #inspirationalmusic #songsabouthope #songsaboutkindness #songsaboutloneliness #songsaboutconnection #musicthatmakesyoufeel #newfemaleartist #Fiquebem #officialmusicvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393853/3393853_720p.mp4</video:content_loc>
      <video:duration>355</video:duration>
      <video:publication_date>2026-09-01T18:53:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FERRARI WITH EXTREMELY LOUD F1 EXHAUST - INSANE REACTIONS | FERRARI CON ESCAPE F1 EXTREMADAMENTE RUI</video:title>
      <video:description>FERRARI WITH EXTREMELY LOUD F1 EXHAUST - INSANE REACTIONS | FERRARI CON ESCAPE F1 EXTREMADAMENTE RUIDOSO - REACCIONES ALUCINANTES | INDIA #Ferrari #F1exhaust #loudexhaust #FerrariF1sound #screamingF1exhaust #extremelyloudcar #supercarsound #insanereactions #carreactions #Ferrariacceleration #straightpipeFerrari #loudFerrarisound #FerrariV12 #supercarexhaust #Ferrarisoundcheck #FerrariescapeF1 #sonidoFerrari #escaperuidoso #reaccionesdeautos #sonidomotorF1 #aceleracionFerrari #escapelibre #FerrariescapamentoF1 #escapamentoalto #barulhodeFerrari #somdeF1 #reacoescarros #escapeesportivo #supercar #hypercar #soundtest #revbattle</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393851/3393851_720p.mp4</video:content_loc>
      <video:duration>249</video:duration>
      <video:publication_date>2026-09-01T18:53:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quem curte música 🎸</video:title>
      <video:description>Música #Música</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393849/3393849_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T18:53:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I WASN&apos;T SUPPOSED TO FIND THIS INSIDE THE MINE  이 광산 안에서 이걸 발견해서는 안 됐다</video:title>
      <video:description>Exploring an abandoned mine and found something I still can&apos;t explain 😨 Would you go inside? #abandonedmine #urbanexploration #scarystories #realhorror #exploringabandonedplaces #creepy #mystery #urbex #hiddenurban #truestory 폐광을 탐험하다가 설명할 수 없는 것을 발견했습니다 😨 당신이라면 들어갈 수 있나요? #폐광 #도시탐험 #무서운이야기 #진짜공포 #폐허탐방 #소름 #미스터리 #urbex #실화 #reinounidocavernaterrormistério</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393848/3393848_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T18:52:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cordeiro Nobre 2kg Suplemento Sal Mineral Caprino Ovino e PotenVet 100ml Vitamina B12</video:title>
      <video:description>Saiba mais: https://s.shopee.com.br/1gIH8H7Vxp Cordeiro Nobre 2kg Suplemento Sal Mineral Caprino Ovino e PotenVet 100ml Vitamina B12 #Achadinhos #AchadinhosAgro #ProdutosAgro #OfertasAgro #Oferta #Promocao #Compreaqui #AchadosDoAgro #Suplementoanimal #agronegocio #agronegócio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393847/3393847_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T18:52:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>姨姨們好呀，我又來跳舞啦～ #騙你生女兒 #人類幼崽 #愛跳舞的小姑娘</video:title>
      <video:description>姨姨們好呀，我又來跳舞啦～ #騙你生女兒 #人類幼崽 #愛跳舞的小姑娘 #古靈࿆精࿆怪࿆小࿆可࿆愛࿆ #萌娃跳舞.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393845/3393845_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T18:52:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time to Fall in Love EP02 Exchange identity to become CEO’s gf Luo Zheng, Lin Xinyi.mp4</video:title>
      <video:description>*Time to Fall in Love* is a Chinese romantic comedy centering on Su Yan Xi, an optimistic and independent livestreamer. To help cover her ailing mother&apos;s medical expenses, she accepts a risky proposition: assuming her twin sister&apos;s identity and signing a contract to become the girlfriend of Gu Xi Cheng, the CEO of a major corporation. Gu Xi Cheng is a cold, methodical man who sought this fake relationship solely to fulfill his sick grandmother&apos;s wish. However, living together and Su Yan Xi&apos;s vibrant personality begin to melt the executive&apos;s icy exterior, transforming the charade into a genuine, sweeping romance. #TimetoFallinLove #C-Drama #ChineseDrama #Romance #RomanticComedy #ContractRelationship #FakeDating #ContractGirlfriend #CEORomance #MistakenIdentity #TwinSisters #LuoZheng #LinXinyi #FakeLove #ForcedProximity #RichCEO #OppositesAttract</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393843/3393843_720p.mp4</video:content_loc>
      <video:duration>2180</video:duration>
      <video:publication_date>2026-09-01T18:52:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rambo 5</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393842/3393842_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T18:52:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Guia do cabeçote da escoolter 4tmp GY6</video:title>
      <video:description>Nesse vídeo mostrando a vocês aonde fica os guias do cabeçote. #Tutorial #escoolter4tmp #cabeçote #mecânico</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393840/3393840_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T18:51:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tour of Garden of Eden ~ What did you see?</video:title>
      <video:description>Tour of Garden of Eden ~ What did you see? Imagine stepping into the paradise described in Genesis 2–3… Walk through the breathtaking Garden of Eden—see its magnificent rivers, lush trees, peaceful animals, the Tree of Life, and the Tree of the Knowledge of Good and Evil. But this paradise was not meant to remain unchanged… What happened when the serpent appeared? Why were Adam and Eve driven from the garden? And what does the Tree of Life reveal about God’s greater plan? 📖 Genesis 2–3 👀 Watch the complete virtual tour and tell us: WHAT DID YOU SEE? 💬 Comment the most amazing thing you noticed in Eden! ❤️ Like | 🔄 Share | ➕ Follow for more Biblical mysteries and cinematic Bible stories. #GardenOfEden #Bible #Genesis #BibleStories #Jesus #</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393839/3393839_720p.mp4</video:content_loc>
      <video:duration>123</video:duration>
      <video:publication_date>2026-09-01T18:51:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Outro Evangelho</video:title>
      <video:description>Vídeo gospel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393838/3393838_720p.mp4</video:content_loc>
      <video:duration>195</video:duration>
      <video:publication_date>2026-09-01T18:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>,😃🥰</video:title>
      <video:description>❤️ #Bebe</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393837/3393837_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:51:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onde está o amor?</video:title>
      <video:description>O amor sentimento de presença é coração #Amor #carinho #saudade</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393836/3393836_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T18:51:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>oops 😁</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393834/3393834_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T18:50:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>More Than I Can Say - Ann-Mette Elten - Lyrics #music #lyricsvideo #shorts.mp4</video:title>
      <video:description>More Than I Can Say - Ann-Mette Elten - Lyrics #music #lyricsvideo #shorts.mp4 #MoreThanICanSay-Ann-MetteElten-Lyricsmusiclyricsvideoshortsmp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393831/3393831_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T18:50:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geral do Gremio - Avalanche</video:title>
      <video:description>Geral do Gremio - Anos 2000 #Gremio #Futebol #Avalanche #Gol #Hinchada</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393830/3393830_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T18:50:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A aliança 2</video:title>
      <video:description>Hino gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393829/3393829_720p.mp4</video:content_loc>
      <video:duration>245</video:duration>
      <video:publication_date>2026-09-01T18:50:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Calcário Liquido Fertilizante Corretor De Solo IMPERIAL CÁLCIO + MAGNÉSIO - 1 Litro Imperial Nutri</video:title>
      <video:description>Saiba mais: https://s.shopee.com.br/20v7Wpyj7G Calcário Liquido Fertilizante Corretor De Solo IMPERIAL CÁLCIO + MAGNÉSIO - 1 Litro Imperial Nutri #Achadinhos #AchadinhosAgro #ProdutosAgro #OfertasAgro #Oferta #Promocao #Compreaqui #AchadosDoAgro #Suplementoanimal #agronegocio #agronegócio</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393826/3393826_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T18:50:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeo engraçado 233</video:title>
      <video:description>Vídeo engraçado para você de divertir #Vídeogatinho</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393824/3393824_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:49:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>love you iran 🇮🇷♥️.mp4</video:title>
      <video:description>love you iran 🇮🇷♥️.mp4 #loveyouiran🇮🇷♥️mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393823/3393823_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T18:49:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>História Bíblica Infantil 3D</video:title>
      <video:description>#HistóriaBíblica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393821/3393821_720p.mp4</video:content_loc>
      <video:duration>127</video:duration>
      <video:publication_date>2026-09-01T18:49:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>check what I found. 🤣🤣</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393819/3393819_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:49:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher sobe em torre para tirar fotos</video:title>
      <video:description>#Mulhersobeemtorreparatirarfotos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393818/3393818_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T18:49:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>❤️❤️ 9</video:title>
      <video:description>❤️❤️ #Gato</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393817/3393817_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:49:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O motivo dos cachorro uivar vocé SABIA?</video:title>
      <video:description>🐶os cachorros podem uivar por vários motivos? Alguns estão se comunicando, outros respondem a sons ou até expressam emoções como solidão ansiedade! entre outros 🐺 #CachorrosUIVAR</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393816/3393816_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T18:48:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Irmã Eunice</video:title>
      <video:description>Homenagem gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393815/3393815_720p.mp4</video:content_loc>
      <video:duration>269</video:duration>
      <video:publication_date>2026-09-01T18:48:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>after lights 🔥🔥🔥</video:title>
      <video:description>aperte o play e sinta a enrgia !! 🔉 🔊 #musicaeletronicamusica #eletronica24h #musicaseletronica #topmusicaseletronicas #musicaeletronicaemingles #musicaseletronicasalok</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393814/3393814_720p.mp4</video:content_loc>
      <video:duration>377</video:duration>
      <video:publication_date>2026-09-01T18:48:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sojas</video:title>
      <video:description>#Soja #colher</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393813/3393813_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T18:48:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ideas for home garden</video:title>
      <video:description>#House</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393812/3393812_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T18:48:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A maior onda do MUNDO</video:title>
      <video:description>#AmaiorondadoMUNDO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393811/3393811_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T18:47:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Complete restoration of a Toyota Supra MK4</video:title>
      <video:description>Complete restoration of a Toyota Supra MK4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393810/3393810_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T18:47:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dumb ways to die.</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393809/3393809_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T18:47:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Da mesma massa</video:title>
      <video:description>Vídeo gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393808/3393808_720p.mp4</video:content_loc>
      <video:duration>294</video:duration>
      <video:publication_date>2026-09-01T18:47:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Capítulo  número 2 a história da moranguita bela</video:title>
      <video:description>É uma história muito boa de frutinha escrevam dê o like comente compartilhe fique todos vocês com Deus que Deus abençoe até o próximo vídeo todos os dias a partir de uma hora que #Brasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393807/3393807_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T18:47:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time to Fall in Love EP01 | Exchange identity to become CEO’s gf | Luo Zheng, Lin Xinyi</video:title>
      <video:description>*Time to Fall in Love* is a Chinese romantic comedy centering on Su Yan Xi, an optimistic and independent livestreamer. To help cover her ailing mother&apos;s medical expenses, she accepts a risky proposition: assuming her twin sister&apos;s identity and signing a contract to become the girlfriend of Gu Xi Cheng, the CEO of a major corporation. Gu Xi Cheng is a cold, methodical man who sought this fake relationship solely to fulfill his sick grandmother&apos;s wish. However, living together and Su Yan Xi&apos;s vibrant personality begin to melt the executive&apos;s icy exterior, transforming the charade into a genuine, sweeping romance. #TimetoFallinLove #C-Drama #ChineseDrama #Romance #RomanticComedy #ContractRelationship #FakeDating #ContractGirlfriend #CEORomance #MistakenIdentity #TwinSisters #LuoZheng #LinXinyi #FakeLove #ForcedProximity #RichCEO #OppositesAttract</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393805/3393805_720p.mp4</video:content_loc>
      <video:duration>1954</video:duration>
      <video:publication_date>2026-09-01T18:47:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gol do Grêmio</video:title>
      <video:description>Futból - Gol de Gremio!! #futbol #gol #golaço #golazo #craque #brazil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393804/3393804_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T18:47:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Real drive</video:title>
      <video:description>#Cardrive</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393803/3393803_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-01T18:47:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Lingerie &amp; Bikini Try-On! 🔥 USA Summer Style Showcase.</video:title>
      <video:description>Trying on the ultimate sexy lingerie and bikini pieces today! Obsessed with the fit and the hot summer vibes of this collection. ☀️👙 ✨ Tap &quot;Follow&quot; right now to support my channel and catch all my daily drops! Let me know your favorite look in the comments below! 👇 #lingeriebikinitryonhaulbikinimodelsummerstylefashioninspousagorgeousbeautyforyou</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393802/3393802_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T18:47:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rain Without You 2</video:title>
      <video:description>A place where deep emotions meet soulful blues music. Discover relaxing blues playlists, romantic guitar melodies, smoky bar vibes, midnight blues sessions, rain atmosphere, vintage sounds and timeless soul. Perfect for relaxing, studying, late nights, emotional moments and true blues lovers.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393801/3393801_720p.mp4</video:content_loc>
      <video:duration>409</video:duration>
      <video:publication_date>2026-09-01T18:47:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Usina serra grande</video:title>
      <video:description>#Trabalho</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393800/3393800_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:46:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Homem de ferro na vida real</video:title>
      <video:description>#Homemdeferronavidareal</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393799/3393799_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-01T18:46:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuando no le di de comer al gato durante 5 minutos</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393797/3393797_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:45:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Colocando ferro derretido em cima de ovos</video:title>
      <video:description>#Colocandoferroderretidoemcimadeovos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393794/3393794_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-01T18:45:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spectreman - Episode 1: Dr. Gori Targets the Earth!</video:title>
      <video:description>Spectreman - Episode 1: Dr. Gori Targets the Earth! #Spectreman-Episode1DrGoriTargetstheEarth</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393793/3393793_720p.mp4</video:content_loc>
      <video:duration>1366</video:duration>
      <video:publication_date>2026-09-01T18:45:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Phoenix Valkyries - The Valkyrie’s Call - New Version ( Viking Metal / Official Ai Music )</video:title>
      <video:description>FREEBEAT.AI : Together, they merge myth and music in a storm of fire, light, and destiny — where every note becomes a strand in the grand tapestry of existence. ⚡ Support the band &amp; our partners! We created this project using incredible AI music tools like Freebeat AI — one of the best platforms for creating professional music videos, clips, and lyrics automatically. 🎧 Try it yourself and unlock your creativity! 👉https://freebeat.ai/#via=phoenixvalkyries CUPOM : PHOENIX10 for 10%off #freebeatai #freebeat =============================================== CREMI.AI 🎥🗣️ Want high-quality lip-syncing in your videos? Try Cremi.Ai 👉 link here: https://cremi.ai/friend/phoenixvalkyries #cremiai #cremi ============================================== ⚔️ The call has been heard once again… “The Valkyrie’s Call” returns in a completely reimagined version — darker, more cinematic, and more powerful than ever. This was the very first video that truly changed everything for Phoenix Valkyries. The one that reached people, that made the channel grow, and that marked the beginning of our journey. Now, we bring it back with a new vision. A battlefield consumed by chaos. A storm rising over fallen warriors. And the moment when the Valkyries answer the call once more. This is not just a remake. This is a rebirth. 🔥 If you’ve been here since the beginning — this one is for you. 🔥 If you’re new — welcome to the battlefield. Turn up the volume… and answer the call. — 🎧 Listen on Spotify: (your link) 🔥 Follow us: Instagram: (link) TikTok: (link) — Phoenix Valkyries is a virtual power metal band #PhoenixValkyries #Metal #EpicMusic #Valkyrie #Cinematic #HeavyMetal 🎧 Listen on all platforms: 🔗 Spotify: https://open.spotify.com/intl-pt/artist/5g958TGeG5SVW2gB1K62QW 🔗 Apple Music: https://music.apple.co</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393792/3393792_720p.mp4</video:content_loc>
      <video:duration>281</video:duration>
      <video:publication_date>2026-09-01T18:45:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Irmãs glorificado ao Sr Jesus</video:title>
      <video:description>Exaltação ao Sr jesus #Riodejaneiro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393791/3393791_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T18:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot 8</video:title>
      <video:description>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393790/3393790_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:44:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot 7</video:title>
      <video:description>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393789/3393789_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T18:44:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Dishita Dhanuka Dance 9</video:title>
      <video:description>Indian Girl Dishita Dhanuka Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393788/3393788_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T18:44:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Festa 5</video:title>
      <video:description>#Festa #balada #música</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393787/3393787_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T18:44:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot 6</video:title>
      <video:description>🎁 Seu presentinho te esperando 👀🔥 👇 Acesse aqui: https://t.me/Marylybotbot</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393786/3393786_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:44:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Guerra do Paraguay - Estratégias</video:title>
      <video:description>Guerra do Paraguay - Estratégias</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393785/3393785_720p.mp4</video:content_loc>
      <video:duration>1541</video:duration>
      <video:publication_date>2026-09-01T18:44:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminhão passando por cima de tudo</video:title>
      <video:description>#Caminhãopassandoporcimadetudo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393784/3393784_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T18:44:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oops 😁</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393783/3393783_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:44:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A visão de Deus e  a visão do mundo</video:title>
      <video:description>Hinos gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393782/3393782_720p.mp4</video:content_loc>
      <video:duration>219</video:duration>
      <video:publication_date>2026-09-01T18:44:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393781</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393781/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>eFOOTBALL 2027 I NAPOLI vs INTER | TOTAL REALISM with Manual Passing | Gameplay FULL HD</video:title>
      <video:description>Experience eFootball 2027 with a full Napoli vs Inter match focused on total realism and manual passing! ⚽🔥 In this gameplay, the focus is on realistic gameplay, manual passing, natural ball movement, realistic player positioning, and a more authentic football experience. 🔥 Match: Napoli vs Inter 🎮 Game: eFootball 2027 ⚽ Gameplay Style: Total Realism 🎯 Passing: Manual Passing 🏟️ Full Match Gameplay If you enjoy realistic football games, eFootball gameplay, manual passing, and immersive matches, make sure to LIKE 👍, SUBSCRIBE 🔔, and leave a comment! #eFootball2027 #eFootball2027gameplay #eFootball2027realisticgameplay #eFootball2027NapolivsInter #NapolivsInter #NapoliIntereFootball #eFootballrealisticgameplay #eFootballrealism #eFootballmanualpassing #manualpassingeFootball #realisticfootballgameplay #eFootball2027match #eFootballgameplay #eFootball2027PS5 #footballgame2027 #eFootballfullmatch #NapolieFootball #IntereFootball #totalrealismeFootball #realisticpassing</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393781/3393781_720p.mp4</video:content_loc>
      <video:duration>1522</video:duration>
      <video:publication_date>2026-09-01T18:44:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>We Found a Strange Glow Beneath the Ocean… Then It Moved 👀🌊</video:title>
      <video:description>A mysterious blue glow appeared inside a hidden underwater cavern. As the camera moved closer, something alive emerged from the darkness and looked directly at us. Watch until the final second and discover what was hiding below. 🌊👀 #underwater #oceanmystery #deepsea #marinelife #seacreature #oceandiscovery #underwaterdiscovery #underwaterwildlife #deepseacreature #oceanexploration #wildlifedocumentary #mysteriouscreature</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393779/3393779_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T18:43:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comedy 346</video:title>
      <video:description>#funny #comedy</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393778/3393778_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T18:43:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Volta às primeiras obras</video:title>
      <video:description>Vídeo cristãos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393777/3393777_720p.mp4</video:content_loc>
      <video:duration>265</video:duration>
      <video:publication_date>2026-09-01T18:43:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melher gosta de ❤️ carinho🤣🤣🤣🤣🤣</video:title>
      <video:description>Humor sobre carinho</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393776/3393776_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:42:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gênesis 4 — A INVEJA O LEVOU AO FIM DE TUDO | Bíblia Narrada</video:title>
      <video:description>Ouça e medite com a Palavra de Deus neste Devocional da Manhã. Hoje vamos acompanhar a leitura e narração de Gênesis Capítulo 4. Que esta leitura bíblica traga paz, sabedoria e direcionamento para o seu dia! 🙏 Se este vídeo abençoou a sua vida, deixe o seu Amém nos comentários, curta o vídeo e se inscreva no canal para não perder os próximos capítulos. ✨ Versão Bíblica Utilizada: NTLH / Nova Tradução na Linguagem de Hoje ------------------------------------------------------------------------- 📖✨ Leia a Bíblia em ordem cronológica! Adquira nosso Planner de Leitura Bíblica e acompanhe os acontecimentos na sequência em que ocorreram, com controle de progresso e espaço para anotações. 🎁 Garanta o seu: 🔗https://pay.kiwify.com.br/u1oVm6r 🙏 Fortaleça sua fé e organize sua jornada pela Palavra de Deus. #Biblia #Bible #palavradeDeus #wordofGod #leitura #reading #Genesis #jesus #Deus #God</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393775/3393775_720p.mp4</video:content_loc>
      <video:duration>281</video:duration>
      <video:publication_date>2026-09-01T18:42:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu portaria</video:title>
      <video:description>Upa senador camara RJ #Riodejaneiro</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393774/3393774_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:42:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One waterfall. Two countries. 🌊🇺🇸🇨🇦 Niagara Falls is something you have to see to believe</video:title>
      <video:description>One waterfall. Two countries. 🌊🇺🇸🇨🇦 Niagara Falls is something you have to see to believe #travel #niagrafalls #travelling #amazingplaces</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393773/3393773_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T18:42:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nem todas as coisas agente tem o controle 👀✨</video:title>
      <video:description>#Brazil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393772/3393772_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-09-01T18:42:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393771</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393771/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brincando com tubarao</video:title>
      <video:description>#Brincandocomtubarao</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393771/3393771_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T18:42:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FAMILIA</video:title>
      <video:description>uma pequena e nova família #cdrama #kdrama #jdrama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393770/3393770_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T18:42:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR Toasted Marshmallows &amp; Crispy Chocolate Ice Cream | 中文字幕</video:title>
      <video:description>Relax and enjoy this satisfying ASMR video featuring toasted marshmallows and crispy chocolate ice cream! Experience the crunchy, gooey, and crispy sounds up close — perfect for relaxation, stress relief, and sleep. Chinese subtitles included for our Chinese-speaking audience. Sit back, put on your headphones, and enjoy every crisp and crackle! 中文字幕已添加，欢迎收看和放松！ #Crispy #Crunchy #SatisfyingASMR</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393769/3393769_720p.mp4</video:content_loc>
      <video:duration>818</video:duration>
      <video:publication_date>2026-09-01T18:42:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌶️ Spicy Food Preparation Challenge</video:title>
      <video:description>: Watch these talented cooks prepare a delicious and colorful spicy dish using a variety of flavorful spices and sauces. 🌶️🥣 The cooking process is satisfying, creative, and full of mouth-watering moments!#ViralReels #Trending #Shorts #FoodShorts #CookingReels #USAEnglish</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393768/3393768_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T18:42:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The best driver!</video:title>
      <video:description>#Drive</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393767/3393767_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T18:41:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baile funk em barraansa RJ</video:title>
      <video:description>Baile funk lotado , #BarramansaRJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393766/3393766_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T18:41:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Barco sendo engolido por onda gigante</video:title>
      <video:description>#Barcosendoengolidoporondagigante</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393765/3393765_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T18:41:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Máquina de amarração de plantas Grampeador de videira</video:title>
      <video:description>SUCA Máquina de Amarração de Plantas, Ferramenta Leve de Fita de Amarração de Plantas para Amarrar Rapidamente A Videira, Arma de Tapener de Amarração de Plantas com Fitas e Grampos, Vermelho COMPRE AQUI: https://link.amazon/B0jhZGU5Q #AMAZON</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393764/3393764_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T18:41:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic video 💯💯</video:title>
      <video:description>Islamic video 💯💯</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393762/3393762_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T18:41:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pomonha cremosa e delicioso receita fácil guê derrete na boca</video:title>
      <video:description>pomonha caseira cremosa e cheia de sabor uma receita simples feita com milho e aquele gostinho de comida de roça guê da água na boca</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393761/3393761_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-01T18:40:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ABANDONED 1940s Dodge Power Wagon is brought back to life one step at a time  Full restoration timel</video:title>
      <video:description>ABANDONED 1940s Dodge Power Wagon is brought back to life one step at a time Full restoration timel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393760/3393760_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T18:40:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 LIONEL MESSI: A LENDA QUE REDEFINIU O FUTEBOL! 🐐⚽</video:title>
      <video:description>🐐⚽ Lionel Messi não é apenas um jogador, é uma verdadeira lenda do futebol! Com dribles incríveis, gols inesquecíveis e uma carreira marcada por conquistas, o craque argentino deixou seu nome na história para sempre. 🏆🇦🇷 Você também considera Messi um dos maiores de todos os tempos? 🔥 #LionelMessi #Messi #LeoMessi #MessiGOAT #Messicraque #Messilenda #MessiArgentina #Messicampeãodomundo #MessiCopadoMundo #MessiBarcelona #MessiInterMiami #golsdoMessi #driblesdoMessi #melhoresmomentosMessi #futebol #futebolmundial #futebolargentino #jogadordefutebol #maiorjogadordahistória #ídolodofutebol #LaPulga #GOATdofutebol #carreiradoMessi #títulosdoMessi #camisa10⚽🐐🇦🇷</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393759/3393759_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T18:40:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MÚSICA para agradecer um novo dia ✨ Gratidão, Energia Positiva, Lei da Atração</video:title>
      <video:description>MÚSICA para agradecer um novo dia ✨ Gratidão, Energia Positiva, Lei da Atração Vamos meditar, fazer nossos pedidos a deus.. #agradecer #novodia #energiapositiva #leidaatração</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393758/3393758_720p.mp4</video:content_loc>
      <video:duration>260</video:duration>
      <video:publication_date>2026-09-01T18:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aniversário Corinthians🦅🖤🤍</video:title>
      <video:description>Muita história, tradição, raça e Torcida Fiel Te amo e Vai Corinthians🦅 #CorinthiansFutebolFielTorcidaTimãoVaiCorinthians</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393756/3393756_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:40:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivação 49</video:title>
      <video:description>Se inspirar que tudo pode dar certo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393755/3393755_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T18:39:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Festa 4</video:title>
      <video:description>#Festa #bailão #música</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393753/3393753_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T18:39:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O perigo fatal do secador de cabelo no banheiro molhado! ⚠️⚡ #Shorts</video:title>
      <video:description>Água + pés descalços + secador de cabelo = risco iminente de choque elétrico fatal. Entenda por que a resistência da pele despenca e como se prevenir! Inscreva-se no Manual de Risco. #secadornobanheiromolhado #choquesecadordecabelo #choqueeletricobanheiro #perigoeletricidadeagua #manualderisco #dicasdeseguranca #shorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393751/3393751_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T18:39:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atirando de basuca em um alvo a 570 m</video:title>
      <video:description>#Atirandodebasucaemumalvo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393750/3393750_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T18:39:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>why ?</video:title>
      <video:description>#Faith #God #LoveBible #Prayer #Jesus #Motivation</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393749/3393749_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T18:39:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Look how beautiful ❤️❤️❤️</video:title>
      <video:description>😃🥰🥰🥰🥰😍😍😍💗💗</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393748/3393748_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:39:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Come laugh with us.</video:title>
      <video:description>Your funny videos here. #funnyvideos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393747/3393747_720p.mp4</video:content_loc>
      <video:duration>3543</video:duration>
      <video:publication_date>2026-09-01T18:39:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>悄悄跟着筛米BGM扭一段，竟被发现了</video:title>
      <video:description>悄悄跟着筛米BGM扭一段，竟被发现了～#萌娃搞笑日常 #人类幼崽 #戏精宝宝 #萌娃跳舞 #筛米舞 #萌娃跳舞 #晚晚小北鼻.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393746/3393746_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T18:39:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Midnight Desire” by Luma Valentina</video:title>
      <video:description>Midnight Desire is a sensual blues soul song with emotional female vocals, perfect for late night listening, romantic moments and deep feelings. This track blends classic blues, modern soul and smooth jazz elements, creating a cinematic and immersive sound experience. If you are searching for sensual blues music, romantic soul songs, emotional female singers or late night vibe music, Midnight Desire delivers a powerful and unforgettable atmosphere. Ideal for relaxing, thinking, driving at night or feeling love and heartbreak. This song is inspired by classic blues and modern soul artists, bringing a timeless yet fresh sound for 2026 listeners. Enjoy deep vocals, slow rhythms and a passionate performance. Subscribe for more blues, soul and emotional music released weekly. Keywords: sensual blues soul song, female blues singer, romantic blues music, emotional soul vocals, midnight vibe music, late night songs, relaxing blues, love and heartbreak music, smooth jazz soul, cinematic blues track. sensual blues soul song female singer romantic blues music emotional midnight vibe relaxing blues music late night soul songs heartbreak music smooth jazz blues female vocals #sensualbluessoulsong #femalebluessinger #romanticbluesmusic #emotionalsoulvocals #midnightvibemusic #latenightsongs #relaxingblues #loveandheartbreakmusic #smoothjazzsoul #cinematicbluestrack</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393745/3393745_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T18:38:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Posição de adorador</video:title>
      <video:description>Vídeo gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393744/3393744_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-01T18:38:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cutting a Crystal Orange | Hyper-Realistic AI ASMR</video:title>
      <video:description>What happens when a perfectly textured orange reveals an interior made entirely of glistening, translucent crystal? Watch the deeply satisfying cutting process as the blade slices right through the glass-like citrus segments, producing crisp shattering sounds and stunning macro details. #crystalorange #hyper-realisticai #asmrslicing #glassfruit #satisfyingglasssound #3dvisualasmr</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393743/3393743_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:38:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trump diz que não descarta &apos;rever&apos; posição dos EUA sobre Malvinas</video:title>
      <video:description>Trump diz que não descarta &apos;rever&apos; posição dos EUA sobre Malvinas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393742/3393742_720p.mp4</video:content_loc>
      <video:duration>156</video:duration>
      <video:publication_date>2026-09-01T18:38:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kak Tia Athaya Pramugari Cantik Super Air Jet.mp4</video:title>
      <video:description>Kak Tia Athaya Pramugari Cantik Super Air Jet.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393741/3393741_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T18:38:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A vida é uma ironia</video:title>
      <video:description>Frases motivacionais para todos #Brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393739/3393739_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T18:37:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kutte bade bafadar hote Hain</video:title>
      <video:description>Kutte bade bafadar hote Hain #ShortsPuppyCutePuppyCatFunnyCatFunnyVideoCuteAnimalsPuppyLove3DCartoonBoyAndPuppyViralShortsFunnyAnimals</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393738/3393738_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T18:37:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relaxing Piano Music, Gentle, Reducing Stress, Fatigue  #relax #relaxingmusic #peacefulrelaxing</video:title>
      <video:description>Relaxing Piano Music, Gentle, Reducing Stress, Fatigue #relax #relaxingmusic #peacefulrelaxing ► Subscribe now to be one of the first to experience the peacefulness of Peaceful Relaxing: https://www.youtube.com/@EmmaLawsonOfficial #peacefulrelaxing #relaxingmusic #spamusic #watersounds #healingmusic ❤️ This video features soothing piano music that is perfect for relaxation, meditation, yoga, study, and sleep. The gentle melodies and soft tones will help you unwind and let go of stress and anxiety, allowing you to focus on your breath and inner thoughts. 💚As you listen to the peaceful sounds of the piano, you&apos;ll be transported to a calm and tranquil place, where you can let go of all your worries and troubles. Whether you&apos;re practicing yoga or meditation, studying for exams, or just need a moment to yourself, this music will help you find inner peace and tranquility.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393737/3393737_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T18:37:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Advice 27</video:title>
      <video:description>Always be good</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393736/3393736_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:37:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>@Rafiya_Anjum101 Musalman or kafir aoraton me farq ye bhi hy - nazam - status -Muslim nazam.mp4</video:title>
      <video:description>@Rafiya_Anjum101 Musalman or kafir aoraton me farq ye bhi hy - nazam - status -Muslim nazam.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393735/3393735_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T18:37:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Blusa Feminina Ribana Canelada Corte Assimétrico Casual Elegante Lisa Dia a Dia Moda Verão</video:title>
      <video:description>COMPRE AQUI: https://link.amazon/B00pTFTvX #amazon</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393734/3393734_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T18:36:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chyren o rei de Brasil!</video:title>
      <video:description>As profecias que envolvem o Mashiach, também conhecido como Chyren! #mashiach #chyren #jotaelbatista #ahistóriadoservo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393732/3393732_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-01T18:36:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Melhor Do Mundo</video:title>
      <video:description>Lionel Messi 🇦🇷⚽ é um dos maiores jogadores da história do futebol. Com talento, dribles incríveis e uma visão de jogo única, conquistou inúmeros títulos e marcou uma era no esporte. 🐐🏆 #LionelMessi #Messi #LeoMessi #MessiGOAT #futebol #futebolmundial #craque #lendadofutebol #Argentina #campeãodomundo #CopadoMundo #InterMiami #Barcelona #gols #dribles #assistências #melhoresmomentos #futebolargentino #jogadordefutebol #ídolo #LaPulga⚽🐐🔥</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393731/3393731_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T18:36:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rebola muito!!!</video:title>
      <video:description>Dança demais.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393730/3393730_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T18:36:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂😁🤣 Coque combat chevre</video:title>
      <video:description>Ça fait rire #Comedy</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393729/3393729_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Origami 8</video:title>
      <video:description>Montagem em origami do símbolo da Santa casa da misericórdia de Resende</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393728/3393728_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:36:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎶 VAMOS DIVULGAR O TALENTO! 🎶 heus | Canto</video:title>
      <video:description>🎶 VAMOS DIVULGAR O TALENTO! 🎶 🎤 Tuninho D’ilheus | Cantor &amp; Compositor 🎸 Música • Alegria • Cultura • História ✨ Já somos 100 inscritos no YouTube! Agora queremos chegar ainda mais longe! 🚀 👉 Inscreva-se no canal, curta os vídeos e compartilhe com os amigos! ❤️ 🎵 Venha conhecer as músicas e acompanhar o trabalho do Tuninho D’ilheus! 📺 YouTube: Tuninho D’ilheus 🔔 Inscreva-se e faça parte dessa história! 100 inscritos hoje… rumo a 1.000! 🙌🎶 #Muito</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393727/3393727_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T18:36:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Queridos animais</video:title>
      <video:description>Como é lindo ver a diversão dos animais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393726/3393726_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T18:36:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎮🔥 BATEU O DROP E O DESESPERO!</video:title>
      <video:description>#CityOfTheWolves #FGC #FatalFury #FightingGames #SNK</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393725/3393725_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T18:35:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot girl 31</video:title>
      <video:description>Dance girl #Girl</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393724/3393724_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:35:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393723</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393723/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saio na rua olhando para trás</video:title>
      <video:description>Música boa !!!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393723/3393723_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T18:35:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wrapped Lamborghini Crazy Driver - Acceleration | Conductor Loco en Lamborghini Vinilado | Aceleraci</video:title>
      <video:description>#lamborghini</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393722/3393722_720p.mp4</video:content_loc>
      <video:duration>129</video:duration>
      <video:publication_date>2026-09-01T18:34:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Pandemic Poop Marker (a flipbook)</video:title>
      <video:description>#ThePandemicPoopMarkeraflipbook</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393721/3393721_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-01T18:34:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Velvet Goodbye — Luma Valentine</video:title>
      <video:description>“Velvet Goodbye” is a haunting blues soul ballad that captures the quiet, elegant pain of a love that ends without chaos — only silence. #emotionalvocalsandacinematicatmosphere #thesongtellsthestoryoftwoheartsdriftingapart #whereeveryglance #everytouch #andeverymemorylingerslikeperfumeintheair</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393720/3393720_720p.mp4</video:content_loc>
      <video:duration>335</video:duration>
      <video:publication_date>2026-09-01T18:34:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DOG HEARS BABY! Reação inacreditável! 😭❤️</video:title>
      <video:description>Our dogs know everything! O faro e a audição deles percebem o mundo antes de nós! ❤️He felt the baby heartbeat! Ele sentiu o coraçãozinho e entregou o carinho mais fofo do mundo! Cute overload! #dog #cachorro #babyheartbeat #coraçãodobebê #viral #dogreaction #reaçãocachorro #cutedog #trending #love</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393719/3393719_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T18:34:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viral 133</video:title>
      <video:description>Hhchlchlc #Cfhhjk</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393716/3393716_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T18:33:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>interval  - Horizon window</video:title>
      <video:description>Imagine standing by a quiet window as the sun sets over Rio de Janeiro. The city slowly lights up, the sea becomes calm, and every melody carries memories of love, longing, and peaceful evenings. #brazilianjazz #brazilianmusic #relaxing #musicstudy #music</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393715/3393715_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-09-01T18:33:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Laughing my head off lol</video:title>
      <video:description>You&apos;ll find the best funny videos here. #funnyvideos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393714/3393714_720p.mp4</video:content_loc>
      <video:duration>3698</video:duration>
      <video:publication_date>2026-09-01T18:33:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fuel Tanker Catches Fire on Highway — Firefighters Respond</video:title>
      <video:description>Flames and thick black smoke billow high from a burning tanker truck on the roadside of a highway, forcing passing motorists to exercise extreme caution. Firefighters and highway management personnel were immediately dispatched to the scene to contain and extinguish the blaze. #TankerFireHighwayAccidentVehicleFireRoadSafetyFirefighters</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393713/3393713_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-01T18:33:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GTA 6 11</video:title>
      <video:description>#gta6</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393712/3393712_720p.mp4</video:content_loc>
      <video:duration>145</video:duration>
      <video:publication_date>2026-09-01T18:33:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That&apos;s how Doggo City works</video:title>
      <video:description>#DOGCATFUNNY</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393711/3393711_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T18:33:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393709</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393709/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>**Reze Agora: Nossa Senhora Vai Acalmar Seu Coração | Oração Poderosa**</video:title>
      <video:description>🙏 **Reze agora e entregue suas preocupações nas mãos de Deus.** Esta oração com Nossa Senhora foi preparada para trazer paz ao coração, fortalecer a fé e ajudar você a encontrar conforto nos momentos difíceis. ✨ Faça esta oração com fé e confiança. Peça proteção, tranquilidade, força e uma graça especial para sua vida. Que Nossa Senhora interceda por você e que Deus abençoe seu caminho. ❤️ Se esta oração tocar seu coração, compartilhe com familiares e amigos que também precisam de uma palavra de fé e esperança. 🔔 Acompanhe mais **orações poderosas, mensagens de fé, orações de Nossa Senhora e momentos de oração diária**. #oraçãopoderosa #rezeagora #oraçãodeNossaSenhora #NossaSenhora #oraçãoparaacalmarocoração #oraçãoparamomentosdifíceis #oraçãodefé #oraçãocatólica #oraçãopoderosadehoje #mensagemdeNossaSenhora #oraçãoparaansiedade #oraçãoparaproteção #oraçãoparaalcançarumagraça #oraçãoantesdedormir #oraçãodanoite #Deus #féemDeus #oraçãodiária #oraçãodehoje</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393709/3393709_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-01T18:33:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Phoenix Valkyries - Wings of Eternity (Power Metal - Official Ai Music)</video:title>
      <video:description>FREEBEAT.AI : Together, they merge myth and music in a storm of fire, light, and destiny — where every note becomes a strand in the grand tapestry of existence. ⚡ Support the band &amp; our partners! We created this project using incredible AI music tools like Freebeat AI — one of the best platforms for creating professional music videos, clips, and lyrics automatically. 🎧 Try it yourself and unlock your creativity! 👉https://freebeat.ai/#via=phoenixvalkyries CUPOM : PHOENIX10 for 10%off #freebeatai #freebeat =============================================== CREMI.AI 🎥🗣️ Want high-quality lip-syncing in your videos? Try Cremi.Ai 👉 link here: https://cremi.ai/friend/phoenixvalkyries #cremiai #cremi ============================================== Phoenix Valkyries is a virtual power metal band ⚔️ About the song: Wings of Eternity returns… reborn. This is not just a remake — it’s a transformation. In this new version of Wings of Eternity, we revisit one of our most iconic songs with a completely reimagined visual experience. Set among vast mountain cliffs, stormy skies, and endless horizons, this music video brings to life the bond between warriors and the spirit of the sky. Ravens, falcons, and eagles guide the journey — symbols of freedom, power, and transcendence. Each member of Phoenix Valkyries embodies a different force of nature, united under one vision: to rise above, to endure, and to become something greater. At the center of it all, Valeria Nightshade ascends… no longer just a voice, but a presence — wings unfolding as the music reaches its peak. This remake was created to align with YouTube guidelines while also pushing our visual quality further than ever before. A new era. A new vision. The same soul. 🎧 Listen on all platforms: 🔗 Spotify: https://open.spotify.com/int</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393707/3393707_720p.mp4</video:content_loc>
      <video:duration>299</video:duration>
      <video:publication_date>2026-09-01T18:32:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Blusa Nula Manga Um Ombro Só Slim Fit Bicolor Básica Dia a Dia Feminina</video:title>
      <video:description>COMPRE AQUI: https://collshp.com/jaylimaachadinhos?view=storefront #SHOPEE</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393705/3393705_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T18:32:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Europe’s continued financial support for Ukraine is unsustainable</video:title>
      <video:description>Supporting Kiev should mean pushing for peace negotiations with Russia. Kartheiser also criticizes Germany’s rearmament policy and warns of growing political repression and economic problems in the country #ukrainerussiaeuwarzone</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393704/3393704_720p.mp4</video:content_loc>
      <video:duration>535</video:duration>
      <video:publication_date>2026-09-01T18:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Barretos Cowboy Festival final 2026</video:title>
      <video:description>Experience the thrilling action of the LNR Finals at the 71st edition of the Barretos Cowboy Festival</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393703/3393703_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-01T18:31:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imvi ijambo ryiza</video:title>
      <video:description>Biratangaje mwumve ububutumwa Bw&apos;Imana</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393701/3393701_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:31:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mensagens de reflexso</video:title>
      <video:description>🙏 JESUS QUER FALAR COM VOCÊ HOJE! ❤️ Não desista. Mesmo quando você não consegue enxergar uma saída, Deus está cuidando de você e preparando o caminho. ✨ 🙏 Sua oração não foi esquecida. ❤️ Jesus conhece o seu coração. 🕊️ Continue caminhando com fé. Se esta mensagem tocou você, escreva AMÉM nos comentários e compartilhe com alguém que precisa ouvir isso hoje.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393700/3393700_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T18:30:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu te amo o todo tempo</video:title>
      <video:description>Lindo louvor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393699/3393699_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T18:30:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bombinhas Santa Catarina</video:title>
      <video:description>Litoral #Praia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393698/3393698_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T18:30:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>need for spideen heat  primeira fase</video:title>
      <video:description>nfs</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393697/3393697_720p.mp4</video:content_loc>
      <video:duration>888</video:duration>
      <video:publication_date>2026-09-01T18:30:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😃🥰</video:title>
      <video:description>😃💗</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393696/3393696_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T18:30:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus anda sobre as águas</video:title>
      <video:description>Jesus andando sobre as águas nos ensina que, mesmo em meio às tempestades da vida, Ele continua no controle. Quando o medo tentar dominar nosso coração, devemos manter os olhos em Cristo e confiar que Sua presença é maior do que qualquer dificuldade. #JesusCristoFéEmDeusPalavraDeDeusDeusNoControleFéQueTransforma</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393695/3393695_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-01T18:30:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stranger Cats.</video:title>
      <video:description>#StrangerCats</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393694/3393694_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T18:29:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Punjabi dance performance 🔥 2026</video:title>
      <video:description>Punjabi dance performance 🔥 2026</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393693/3393693_720p.mp4</video:content_loc>
      <video:duration>186</video:duration>
      <video:publication_date>2026-09-01T18:29:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>মরুভূমিতে গাছ লাগালেন বৃদ্ধ,</video:title>
      <video:description>মরুভূমির মতো শুকনো জায়গায় এক বৃদ্ধ একটি গাছ লাগানোর চেষ্টা করেন। 🌱👴 কিন্তু গাছটিকে ঘিরে হঠাৎ একটি বানরের আগমন ঘটে। 🐒 এরপর কী ঘটে যায়, সেটাই এই ছোট্ট গল্পের সবচেয়ে অবাক করা অংশ! 😱 শেষ পর্যন্ত দেখুন এবং গল্পটি কেমন লেগেছে কমেন্টে জানান। ❤️ #বৃদ্ধেরগল্প #বানরেরগল্প #গাছলাগানোরগল্প #মরুভূমিরগল্প</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393692/3393692_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T18:29:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>,,❤️❤️❤️❤️❤️</video:title>
      <video:description>..😍😍😍😍❤️</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393691/3393691_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T18:29:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Breath of Fire - Part 14</video:title>
      <video:description>Well, finally got the G.Bar, we can trade it for the Icicle and travel to Arad; please note that this city is in the desert and the hero can use the dragon spells obtained before. #spells #games #dragon #gameplays #gaming</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393690/3393690_720p.mp4</video:content_loc>
      <video:duration>1159</video:duration>
      <video:publication_date>2026-09-01T18:29:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arafta season 2 episode 12 in  Hindi/Urdu</video:title>
      <video:description>Arafta season 2 episode 12 in Hindi/Urdu #Araftaseason2episode12inHindiUrdu #arafta #araftaseason2 #araftaseason2episode12</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393689/3393689_720p.mp4</video:content_loc>
      <video:duration>6662</video:duration>
      <video:publication_date>2026-09-01T18:29:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Festa 3</video:title>
      <video:description>#Festa #dança</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393688/3393688_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T18:28:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>extra income from jar cakes&quot; bolo de pote</video:title>
      <video:description>Extra income.bolo de pote #BolodepoteFromjarcakes</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393687/3393687_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-09-01T18:28:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>মোবাইল আসক্ত হুমায়রা কীভাবে বদলে গেল ইসলামিক গল্প</video:title>
      <video:description>মোবাইল আসক্ত হুমায়রা কীভাবে বদলে গেল ইসলামিক কার #ইসলামিকগল্প</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393685/3393685_720p.mp4</video:content_loc>
      <video:duration>306</video:duration>
      <video:publication_date>2026-09-01T18:28:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melhor do Brasil 2</video:title>
      <video:description>#Brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393684/3393684_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T18:28:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>আয়াশ আর ছোট চড়ুই</video:title>
      <video:description>আয়াশ আর ছোট চড়ুই #BanglaCartoonBengaliCartoonBanglaCartoonVideoBanglaAnimationBengaliAnimationBanglaKidsCartoonKidsCartoonBanglaBanglaGolpoCartoon</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393683/3393683_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-01T18:28:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quem você vota no Lula ou no Flávio</video:title>
      <video:description>Eleições brasileiras</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393682/3393682_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T18:28:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shibe gets Bamboozled</video:title>
      <video:description>#CÃOENGRAÇADODIVERSÃO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393681/3393681_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T18:27:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Epa kandulal sala..hadannata obe netha...// IMAGE VIDEO SONG..</video:title>
      <video:description>Epa kandulal sala..hadannata obe netha...// IMAGE VIDEO SONG.. #IVSEntertainment</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393680/3393680_720p.mp4</video:content_loc>
      <video:duration>260</video:duration>
      <video:publication_date>2026-09-01T18:27:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O carro do Chaves e o carro do Kiko</video:title>
      <video:description>Chave e o carro dele</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393679/3393679_720p.mp4</video:content_loc>
      <video:duration>139</video:duration>
      <video:publication_date>2026-09-01T18:27:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Queda de Lúcifer</video:title>
      <video:description>#deusceuinferno</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393678/3393678_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-01T18:27:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WHEN AIR BECAME A WEAPON (QUANDO O AR VIROU UMA ARMA)</video:title>
      <video:description>During World War I, a new threat emerged on the battlefields: chemical weapons. This video explores how chlorine gas was used in 1915, how other agents, such as mustard gas, turned the trenches into even more dangerous places, and how soldiers were forced to develop gas masks for protection. A story about an invisible weapon that forever changed warfare and left one of the darkest marks in military history. Durante a Primeira Guerra Mundial, uma nova ameaça surgiu nos campos de batalha: as armas químicas. O vídeo mostra como o cloro foi utilizado em 1915, como outros agentes, como o gás mostarda, transformaram as trincheiras em lugares ainda mais perigosos e como os soldados precisaram desenvolver máscaras para se proteger. Uma história sobre uma arma invisível que mudou para sempre a guerra e deixou uma das marcas mais sombrias da história militar #primeiraguerramundial #documentário #história #entretenimento #mistério #ciência #fatosdesconhecidos #educação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393677/3393677_720p.mp4</video:content_loc>
      <video:duration>253</video:duration>
      <video:publication_date>2026-09-01T18:27:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indian Girl Dipa Roy Dance 9</video:title>
      <video:description>Indian Girl Dipa Roy Dance #bollywooddance #danceindia #indiandancegirls</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393676/3393676_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T18:27:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Messi &amp; CR7</video:title>
      <video:description>Viral soccer #Usa</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393674/3393674_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T18:26:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shibe gets Angery at game</video:title>
      <video:description>#CÃOENGRAÇADOJOGO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393673/3393673_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-01T18:26:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>116 anos parabéns Corinthians.</video:title>
      <video:description>O Corinthians hoje completa 116 anos.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393672/3393672_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-01T18:26:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bailão 2</video:title>
      <video:description>#Festa #bailão #dança</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393671/3393671_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:25:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Biblico</video:title>
      <video:description>Mensagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393670/3393670_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T18:25:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ROLEX – Orochi Type Beat (Prod. By Ravvek)</video:title>
      <video:description>Título: ROLEX Estilo: Orochi Type Beat BPM: [126] Escala: [Dó menor/Cm] Produzido por: Ravvek 📝 SOBRE O BEAT: Um instrumental de Trap pesado e melódico na estética do Orochi (Mainstreet). Perfeito para flows marcantes, linhas de ostentação e rimas de vivência. Se você procura um som comercial, com graves profundos e identidade forte para o seu próximo single, &quot;ROLEX&quot; é a escolha certa. 🚀 INSCREVA-SE NO CANAL: Não perca os próximos lançamentos. #Orochi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393669/3393669_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T18:25:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Experience the thrilling action of the LNR Finals at the 71st edition of the Barretos Cowboy Festiva</video:title>
      <video:description>Experience the thrilling action of the LNR Finals at the 71st edition of the Barretos Cowboy Festival (Festa do Peão de Barretos), featuring top-tier bull riding and elite cowboys competing in the ultimate arena showdown.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393668/3393668_720p.mp4</video:content_loc>
      <video:duration>1132</video:duration>
      <video:publication_date>2026-09-01T18:25:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>San Marino</video:title>
      <video:description>🇸🇲 Você sabia que existe um país inteiro dentro da Itália? San Marino é pequeno no mapa… mas a vista é GIGANTE! 😍 Você colocaria esse lugar na sua lista de viagens? 👀 #SanMarinoItaliaViagemEuropaTravel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393666/3393666_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:25:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mr bubz is bipolar</video:title>
      <video:description>#DOGBIPOLARMORDIDA</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393665/3393665_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T18:25:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lost in Your Love</video:title>
      <video:description>Lost in Your Love is an emotional electronic dance-pop song about falling deeply in love, dancing under neon lights, and feeling like the whole world disappears when you&apos;re together. A dreamy, romantic and energetic track made for unforgettable moments. #LostInYourLove #ElectronicPop #DanceMusic #LoveSong #RomanticMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393664/3393664_720p.mp4</video:content_loc>
      <video:duration>252</video:duration>
      <video:publication_date>2026-09-01T18:25:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Descendentes 2</video:title>
      <video:description>Malia baker #Descendants</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393663/3393663_720p.mp4</video:content_loc>
      <video:duration>154</video:duration>
      <video:publication_date>2026-09-01T18:25:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smoke In My Heart — Luma Valentine</video:title>
      <video:description>A place where deep emotions meet soulful blues music. Discover relaxing blues playlists, romantic guitar melodies, smoky bar vibes, midnight blues sessions, rain atmosphere, vintage sounds and timeless soul. Perfect for relaxing, studying, late nights, emotional moments and true blues lovers. #emotions #atmosphere #vintagesoulfulbluesmusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393662/3393662_720p.mp4</video:content_loc>
      <video:duration>335</video:duration>
      <video:publication_date>2026-09-01T18:25:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Black Thong Try-On Showcase! ✨ Tap &apos;Follow&apos; for more looks. 2</video:title>
      <video:description>Trying on this beautiful and sexy black thong set. Loving how confident and elegant the details make you feel! 🖤 ✨ Tap the &quot;Follow&quot; button to support my profile and catch all my daily updates and fashion inspo! Don&apos;t forget to drop a comment below and let me know your thoughts! 👇 #lingerietryonhaulblackthonggorgeousbeautyfashioninspooutfitofthedayusaaestheticforyou</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393661/3393661_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T18:25:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tum Se Tum Tak 1st September 2026 Episode 419</video:title>
      <video:description>Tum Se Tum Tak 1st September 2026 Episode 419 1. &quot;A love story wrapped in sorrow&quot; 2. &quot;A tale of love and heartbreak&quot; 3. &quot;A painful journey of love&quot; 4. &quot;A love that ended in tears&quot; 5. &quot;A doomed love story&quot; 6. &quot;A love story that broke hearts&quot; 7. &quot;A romance filled with sadness&quot; 8. &quot;A bittersweet love story&quot; 9. &quot;A love story lost to fate&quot; 10.&quot;A tragic romance&quot; 11.&quot;A Tum Se Tum Tak All Episode #TumSeTumTak1stSeptember2026Episode419</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393660/3393660_720p.mp4</video:content_loc>
      <video:duration>1291</video:duration>
      <video:publication_date>2026-09-01T18:24:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu demônio favorito</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393659/3393659_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T18:24:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onça atacando cachorro</video:title>
      <video:description>Muito bom engraçado vc gostar riram muito #Cachorrolevesustocomonçaatacando</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393658/3393658_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T18:24:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lasier Martins tomando choque</video:title>
      <video:description>#MEMEENGRACADO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393657/3393657_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T18:24:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Se pega, imagina os ratos</video:title>
      <video:description>#humor #comedia #entreterimento</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393656/3393656_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T18:24:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher sendo fudida</video:title>
      <video:description>e sentada no pênis de frente por cima do homem, deixe o homem sem camisa e com seu pênis dentro da buceta da mulher #Brasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393655/3393655_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T18:24:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WHAT I FOUND INSIDE THIS ABANDONED MINE... NOBODY BELIEVED ME   이 폐광 안에서 발견한 것... 아무도 믿지 않았다</video:title>
      <video:description>Exploring an abandoned mine and found something I still can&apos;t explain 😨 Would you go inside? #abandonedmine #urbanexploration #scarystories #realhorror #exploringabandonedplaces #creepy #mystery #urbex #hiddenurban #truestory 폐광을 탐험하다가 설명할 수 없는 것을 발견했습니다 😨 당신이라면 들어갈 수 있나요? #폐광 #도시탐험 #무서운이야기 #진짜공포 #폐허탐방 #소름 #미스터리 #urbex #실화 #darkcavernaprypriat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393654/3393654_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-01T18:23:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hastinapur Ke Veer • Episode 79 • 01 September 2026 • The Deadly River Mystery</video:title>
      <video:description>👍Don&apos;t Forget Like and Follow! #HastinapurKeVeer #ZeeTV #zee5 #zeetvserial #india</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393653/3393653_720p.mp4</video:content_loc>
      <video:duration>1406</video:duration>
      <video:publication_date>2026-09-01T18:23:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AS Roma pesta gol dengan menghancurkan tuan  rumah Lecce 4-0 dalam laga pekan kedua Serie A</video:title>
      <video:description>Fakta Menarik Pertandingan Debut Gol Sempurna Rodrigo Mora: Pemain muda asal Uruguay, Rodrigo Mora, sukses mencetak gol perdananya untuk I Giallorossi pada menit ke-65, hanya beberapa menit setelah masuk ke lapangan menggantikan Matias Soulé. Dominasi Mutlak Gasperini: Taktik menyerang total dari pelatih baru, Gian Piero Gasperini, membuat Roma menguasai jalannya laga dengan 66% penguasaan bola dan melepaskan 15 tembakan sepanjang pertandingan.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393652/3393652_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T18:23:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diário de um vampiro</video:title>
      <video:description>Katherine #Thevampirediaries</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393651/3393651_720p.mp4</video:content_loc>
      <video:duration>103</video:duration>
      <video:publication_date>2026-09-01T18:22:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Corre!!!</video:title>
      <video:description>#Animais</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393650/3393650_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T18:22:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como Fazer Batata Assada Crocante e Dourada no Forno (Estilo de Frango Assado) 🥔🔥</video:title>
      <video:description>Se você quer aprender como fazer batata assada crocante e dourada no forno, igual aquelas que acompanham frango de padaria, essa receita vai te surpreender. Eu uso um segredo simples de tempero que deixa a batata macia por dentro, dourada por fora e extremamente saborosa. #batataassada</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393649/3393649_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T18:22:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#nossa mãe Santíssima pisando na cabeça da serpente</video:title>
      <video:description>Este vídeo representa nossa mãe Santíssima protegendo todos nós os seus filhos e filhas de todas as serpentes da inveja da ignorância e autoritarismo 🙏🙏🙏 sr.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393648/3393648_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T18:22:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mulher de 50</video:title>
      <video:description>Me sinto poderosa #dancinha</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393647/3393647_720p.mp4</video:content_loc>
      <video:duration>110</video:duration>
      <video:publication_date>2026-09-01T18:22:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>H2r Kawasaki vs muscle car</video:title>
      <video:description>Escreva-se Subscreve #Motos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393646/3393646_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T18:21:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This GTA 6 game is really good.</video:title>
      <video:description>Let&apos;s play this game together. #Games</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393645/3393645_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T18:21:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Skinkwe da manhã</video:title>
      <video:description>#Rotinadiáriadeumamãesoloeatípica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393644/3393644_720p.mp4</video:content_loc>
      <video:duration>476</video:duration>
      <video:publication_date>2026-09-01T18:21:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sou luna</video:title>
      <video:description>Naurucinho #Souluna</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393643/3393643_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T18:21:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ganga Mai Ki Betiyan • Episode 340 • 01 September 2026 • Purvi Exposes Siddhu&apos;s Secret Visit to the </video:title>
      <video:description>👍Don&apos;t Forget Like and Follow! #GangaMaiKiBetiyan #zeetv #zee5 #zeetvserial</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393642/3393642_720p.mp4</video:content_loc>
      <video:duration>1335</video:duration>
      <video:publication_date>2026-09-01T18:20:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melhor jogo de mundo aberto</video:title>
      <video:description>Who has played this game? #Game</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393641/3393641_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-01T18:20:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful and cute thing.</video:title>
      <video:description>Very handsome</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393640/3393640_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T18:20:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>এক ড্রাইভার এর জীবন কাহিনি</video:title>
      <video:description>এক ড্রাইভার এর জীবন কাহিনি #ছন্দেরকথা #কষ্টরেভিডিও #মটিভেশনালভিডিও #বানিচিরন্তনি #জামিলা #love</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393638/3393638_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T18:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ousadia</video:title>
      <video:description>Para entrar no santuário tem que ter ousadia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393637/3393637_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:19:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Last Dance Alone — Luma Valentine</video:title>
      <video:description>A place where deep emotions meet soulful blues music. Discover relaxing blues playlists, romantic guitar melodies, smoky bar vibes, midnight blues sessions, rain atmosphere, vintage sounds and timeless soul. Perfect for relaxing, studying, late nights, emotional moments and true blues lovers. New videos every week.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393636/3393636_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:19:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lei STF determina em sistemas públicos brasileiros</video:title>
      <video:description>Fala sobre lei que vai complicar vários tipos de homens no Brasil e também veja completamente</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393635/3393635_720p.mp4</video:content_loc>
      <video:duration>114</video:duration>
      <video:publication_date>2026-09-01T18:19:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seu casamento pode mudar  quando vc muda</video:title>
      <video:description>Casal feliz ajuda o outro e vivem felizes #Gimenes10</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393634/3393634_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T18:18:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bubble Wrap Factory Process is Weirdly Satisfying 🤯</video:title>
      <video:description>Ever wondered how bubble wrap is made? Watch molten plastic film get vacuum-molded into perfect air bubbles, sealed, and spooled — then popped in oddly satisfying slow motion. 🫧 ‎#BubbleWrap #HowItsMade #SatisfyingVideo #FactoryProcess #Manufacturing #OddlySatisfying #Shorts #bubblewrap #howitsmade #satisfyingvideo #factoryprocess #manufacturingprocess #oddlysatisfying #ASMRfactory #plasticmanufacturing #howbubblewrapismade #satisfyingfactory #packagingmanufacturing #scienceandtechnologyshorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393633/3393633_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T18:18:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>several cats</video:title>
      <video:description>talking cats</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393632/3393632_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T18:18:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Triângulo da Bermudas</video:title>
      <video:description>O que ninguém te conta sobre o Mistério do &quot;Triângulo das Bermudas&quot;</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393631/3393631_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T18:18:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Final do rodeio internacional de Barretos 2026! Barretos International Rodeo Final 2026</video:title>
      <video:description>Final do rodeio internacional de Barretos 2026! Barretos International Rodeo Final 2026 #finalbarretos2026 #rodeiointernacionaldebarretos #rodeioemtouros</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393629/3393629_720p.mp4</video:content_loc>
      <video:duration>4488</video:duration>
      <video:publication_date>2026-09-01T18:17:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>660LB MONSTER ARAPAIMA - Giant Pirarucu Fishing Amazon River Brazil 🇧🇷</video:title>
      <video:description>Nessa aventura no Lago da Sucuri, pegamos um dos maiores pirarucus (Arapaima gigas) da região. Pesca esportiva raiz, sem rede, na mão! 📍 Local: Rio Madeira - Porto Velho, RO - Brasil 🎣 Peixe: Pirarucu / Arapaima - 300kg / 660LB 👉 Inscreva-se para mais monstros da Amazônia! ENGLISH: Giant 660LB Arapaima fishing in Amazon River, Brazil. One of the biggest freshwater fish in the world caught in Rondonia! #Amazon #fishing #Lago #natureza</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393628/3393628_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T18:17:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He doesn’t give up on you.</video:title>
      <video:description>He left the 99 just to find you. No matter how lost you may feel, Jesus has not forgotten your name. His love will find you, rescue you, and lead you home. You are never too far from God. 🙏🐑 Luke 15:4 Comment “Amen” if you believe Jesus never gives up on us. #Jesus #Faith #God #GodsLove #Bible #Prayer #JesusSaves #ChristianMotivation</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393627/3393627_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-01T18:17:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>exotic animal 이색 동물</video:title>
      <video:description>Animal exótico brasileiro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393626/3393626_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T18:17:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Assista nossos vídeos</video:title>
      <video:description>Se inscreva eu te peço #Seinscreva #canalviral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393625/3393625_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T18:17:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393624</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393624/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cobham Next Gen 5-4 West Ham U21_s _ HIGHLIGHTS _ Premier League 2 _ 2026_27</video:title>
      <video:description>Cobham Next Gen 5-4 West Ham U21_s _ HIGHLIGHTS _ Premier League 2 _ 2026_27(720P_HD).mp4 #CobhamNextGen5-4WestHamU21_s_HIGHLIGHTS_PremierLeague2_2026_27</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393624/3393624_720p.mp4</video:content_loc>
      <video:duration>196</video:duration>
      <video:publication_date>2026-09-01T18:16:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Essa toca muito</video:title>
      <video:description>Garota no samba tocando pandeiro #Gimenes10</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393623/3393623_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-01T18:16:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A garota que fala com os pássaros</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393622/3393622_720p.mp4</video:content_loc>
      <video:duration>147</video:duration>
      <video:publication_date>2026-09-01T18:16:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🙏 ONE QUESTION: DO YOU STILL TRUST IN JESUS?</video:title>
      <video:description>🙏 ONE QUESTION: DO YOU STILL TRUST IN JESUS? #faith #prayer #prayer Adding Value to the YouTube Channel. Subscribe to our Channel #Oracao #fe #frança #EstadosUnidos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393621/3393621_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:15:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jogo top de todos os tempos</video:title>
      <video:description>Games realista #Jogo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393620/3393620_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T18:15:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ছোট্ট চড়ুই আর সোনার বীজ</video:title>
      <video:description>ছোট্ট চড়ুই আর সোনার বীজ #kids #entertainment</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393619/3393619_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-01T18:15:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#, videos</video:title>
      <video:description>Plz support to grow</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393618/3393618_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T18:15:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Вот так на ютубе накручивают лайки.И в мире проходят соцопросы.</video:title>
      <video:description>Вот так на ютубе накручивают лайки.И в мире проходят соцопросы.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393617/3393617_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T18:15:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Weekend Night Playlist - Luxury Driving Music | Playlist Noche de Fin de Semana | Música de Lujo par</video:title>
      <video:description>Unwind with a carefully selected collection of Deep House 2026 featuring smooth melodies, powerful bass, and uplifting rhythms. Whether you&apos;re cruising through city lights, enjoying a late-night drive, relaxing at home, or setting the mood for the weekend, this playlist delivers the perfect balance of energy and emotion from start to finish. __________________________________________________________________________________________________________________________________ Desconecta con una selección cuidadosamente realizada de Deep House 2026, con melodías suaves, graves potentes y ritmos estimulantes. Ya sea para conducir bajo las luces de la ciudad, disfrutar de un trayecto nocturno, relajarte en casa o ambientar tu fin de semana, esta lista de reproducción ofrece el equilibrio perfecto entre energía y emoción de principio a fin. #luxurynightsmusiccarmusiccarbassmusicdeephousedeephouseremixgangstermusictiktoktiktokviraltiktoktechnomusictrendingmusicviralviralmusic2026</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393616/3393616_720p.mp4</video:content_loc>
      <video:duration>725</video:duration>
      <video:publication_date>2026-09-01T18:15:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pq sonhamos</video:title>
      <video:description>Pq</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393615/3393615_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T18:15:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mais que palavras / More then words</video:title>
      <video:description>Essa música marcou toda uma geração #musicmusicasong</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393614/3393614_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-09-01T18:15:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Taylor Swift - Opalite 2</video:title>
      <video:description>Taylor Swift - Opalite (Official Music Video)(720P_HD).mp4 #TaylorSwift-Opalite</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393613/3393613_720p.mp4</video:content_loc>
      <video:duration>360</video:duration>
      <video:publication_date>2026-09-01T18:15:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Good, the Bad and the Ugly - The Danish National Symphony Orchestra.</video:title>
      <video:description>A powerful orchestral performance of “The Good, the Bad and the Ugly” by the Danish National Symphony Orchestra, bringing Ennio Morricone’s iconic Western soundtrack to life with dramatic tension, epic melodies, and cinematic grandeur. #CinematicMusicTheGoodtheBadandtheUglyDanishNationalSymphonyOrchestraEpicOrchestraWesternMovieSoundtrackEnnioMorricone</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393612/3393612_720p.mp4</video:content_loc>
      <video:duration>362</video:duration>
      <video:publication_date>2026-09-01T18:14:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Consistency and Diligence Will Definitely Work 👍</video:title>
      <video:description>Follow the Process to Ensure Success #Catfishbreeders #catfishponds #catfishcultivationtips #catfishbusiness</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393611/3393611_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:14:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imagine Doggos</video:title>
      <video:description>#CAOFUNNY</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393610/3393610_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T18:14:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Olha o gráfico desse jogo</video:title>
      <video:description>Jogo realista #Game</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393609/3393609_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-01T18:14:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A VIUVINHA DA ROÇA NO DIA DA MULHER</video:title>
      <video:description>A viuvinha da roça relembrando o dia da mulher #viuvinha #viuvinhadaroça #roça #diadamulher</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393608/3393608_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T18:14:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>[Korean Hype/OST] &quot;Blue Flag (푸른 깃발)&quot; — Soaring Against the Wind, Never Giving Up! The Ultimate Moti</video:title>
      <video:description>Never close your eyes, even in the middle of the storm! 🚩 Raise high that flag of hope and victory—&quot;Blue Flag (푸른 깃발)&quot; is an empowering track packed with energy and courage. No matter how many times you fall, get right back up! Hope this song gives you the strength to keep pushing forward. 💡 If you enjoyed this, don&apos;t forget to Like, Favorite, and Subscribe to support the channel! ✨ #KoreanSong #HypeMusic #BGM #Motivational #BlueFlag</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393607/3393607_720p.mp4</video:content_loc>
      <video:duration>208</video:duration>
      <video:publication_date>2026-09-01T18:14:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How many countries are there in Africa?</video:title>
      <video:description>Test your brain and brain challenge. #Africa #GeneralKnowledge #Quiz #education #shorts #Viral #learn</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393606/3393606_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T18:14:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dados um soninho</video:title>
      <video:description>#Bebê</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393605/3393605_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-01T18:13:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Process of Making a Round Pool Base</video:title>
      <video:description>The base of the pond determines the maximum absorption of ammonia. #EdukasiBudidayaLele #KolamBundar #AlasKolam</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393604/3393604_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T18:13:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 11</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393603/3393603_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T18:13:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>hamsters be like.</video:title>
      <video:description>#HAMSTERSENGRAÇADO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393601/3393601_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:13:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Para Random</video:title>
      <video:description>@semuaorang #random</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393600/3393600_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T18:13:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Essa música é top</video:title>
      <video:description>Anastácia canta One Day in your life #musicasingsong</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393599/3393599_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-01T18:13:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Turma da Mônica - História de Gibi - Milena em MAMÃE TIROU FOLGA</video:title>
      <video:description>Turma da Mônica - História de Gibi - Milena em MAMÃE TIROU FOLGA #Mônica #turmadamônica #gibi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393598/3393598_720p.mp4</video:content_loc>
      <video:duration>107</video:duration>
      <video:publication_date>2026-09-01T18:13:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Despreze Ele Para Mudar Sua História de Amor!</video:title>
      <video:description>Despreze Ele Para Mudar Sua História de Amor! #Despreze #Mudar #História #Amor</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393597/3393597_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-09-01T18:13:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🚨 WHO SAID IT&apos;S OVER? GOD STILL HAS A PLAN</video:title>
      <video:description>🚨 WHO SAID IT&apos;S OVER? GOD STILL HAS A PLAN God&apos;s Word for Your Life! #fe</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393596/3393596_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:13:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Big Fish Amazon 🇧🇷</video:title>
      <video:description>Pescaria Raiz no coração da floresta Amazônica, achei essa canoa abandonada e fui pesca nela , segue nois pra mais vídeos #Pescaria #peixes #natureza #Amazônia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393595/3393595_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-09-01T18:12:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 10</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393594/3393594_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T18:12:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Call of Duty: Warzone MW4 Beta (Sniper) Gameplay! (No Commentary</video:title>
      <video:description>Gameplay de Call of Duty: Warzone MW4 Beta, com foco em combates de longa distância e muitos momentos usando sniper. Uma partida completa, sem comentários, mostrando a gameplay de forma direta e imersiva. 🎮 Warzone MW4 Beta 🎯 Sniper Gameplay 🔇 No Commentary Se curtir a gameplay, deixe o like e inscreva-se no canal para acompanhar os próximos vídeos! 💬 Entre no Discord do TKzin2: Discord TKzin2</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393593/3393593_720p.mp4</video:content_loc>
      <video:duration>816</video:duration>
      <video:publication_date>2026-09-01T18:12:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ana castela</video:title>
      <video:description>Ana castela conta como ficou vitaliza da #Gimenes10</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393592/3393592_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T18:12:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tarpaulin Pool Specifications Diameter three</video:title>
      <video:description>Quick Solution for Fish Farming #Kolamterpal #tipbudidayalele #Peternaklele #peternakikanairtawar</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393591/3393591_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T18:12:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>eggdog.</video:title>
      <video:description>#EGGDOGENGRAÇADO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393590/3393590_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-01T18:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatas linda</video:title>
      <video:description>#Animais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393589/3393589_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-01T18:12:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novola de rede globo</video:title>
      <video:description>Ela abriu a janela e deu de cara com o perigoso assassino #NovelaredegloboBrasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393588/3393588_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:12:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Bangladeshi Ilish Bhapa You NEED to Try 🤤🇧🇩🔥</video:title>
      <video:description>Authentic Bangladeshi Ilish Bhapa made with fresh hilsa, mustard, green chili and mustard oil. 🇧🇩❤️ The fish is coated in a rich mustard mixture and steamed until tender, creating that unforgettable Bengali aroma and flavor. Ingredients: 6 hilsa steaks, 3 tbsp yellow mustard, 1 tbsp black mustard, 4 green chilies, ½ tsp turmeric, 1 tsp salt, 4 tbsp mustard oil, 2 tbsp coconut, 2 tbsp yogurt. Serve hot with steamed white rice. 🍚🐟 Save this recipe and follow RannaBot for more delicious halal recipes! #IlishBhapa #IlishBhaparecipe #BangladeshiIlishBhapa #hilsafishrecipe #hilsabhapa #Bengalifishrecipe #Bangladeshifishrecipe #mustardhilsa #mustardfishrecipe #halalfishrecipe #Bangladeshifood #Bengalifood #Bangladeshrecipe #traditionalBangladeshirecipe #steamedhilsa #Ilishrecipe #RannaBot</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393587/3393587_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T18:12:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Acha que usina solar ☀️ é só moleza</video:title>
      <video:description>Dificuldades do dia a dia nas obras solares #energiasolarUSAPARIS</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393585/3393585_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T18:11:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Speed ​​in China: The Most INSANE Moments!</video:title>
      <video:description>IShowSpeed ​​(Darren Jason Watkins Jr.) is one of the most popular, chaotic, and energetic content creators and streamers in the world, known globally for his unpredictable live streams, over-the-top reactions, overwhelming passion for Cristiano Ronaldo, and hilarious moments of pure confusion.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393584/3393584_720p.mp4</video:content_loc>
      <video:duration>224</video:duration>
      <video:publication_date>2026-09-01T18:11:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bocanilce</video:title>
      <video:description>Bocanilce seus trigêmeos novelinha #Bocanilcelaranja</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393583/3393583_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T18:11:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romantic Song 15</video:title>
      <video:description>Lovely Movie</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393582/3393582_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-01T18:11:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disrespectful Birb</video:title>
      <video:description>#PAPAGAIOENGRAÇADO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393581/3393581_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T18:11:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎶 VAMOS DIVULGAR O TALENTO! 🎶 🎤 Tuninho D’ilheus | Cantor &amp; Compositor 🎸 Música • Alegria • Cultura </video:title>
      <video:description>🎶 VAMOS DIVULGAR O TALENTO! 🎶 🎤 Tuninho D’ilheus | Cantor &amp; Compositor 🎸 Música • Alegria • Cultura • História ✨ Já somos 100 inscritos no YouTube! Agora queremos chegar ainda mais longe! 🚀 👉 Inscreva-se no canal, curta os vídeos e compartilhe com os amigos! ❤️ 🎵 Venha conhecer as músicas e acompanhar o trabalho do Tuninho D’ilheus! 📺 YouTube: Tuninho D’ilheus 🔔 Inscreva-se e faça parte dessa história! 100 inscritos hoje… rumo a 1.000! 🙌🎶 #Músicaboa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393580/3393580_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T18:11:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GTA 6 gameplay (full timeline )</video:title>
      <video:description>GTA 6 gameplay novidad #Gta6 #gta #game #meme</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393579/3393579_720p.mp4</video:content_loc>
      <video:duration>589</video:duration>
      <video:publication_date>2026-09-01T18:11:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Look how beautiful!</video:title>
      <video:description>Beautiful thing</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393578/3393578_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T18:10:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Seu hábito de hoje é seu resultado de amanhã</video:title>
      <video:description>Riqueza não acontece da noite pro dia — ela é construída na repetição dos pequenos hábitos que você escolhe manter todos os dias. Enquanto uns esperam o momento perfeito, outros já começaram, mesmo pequeno. Salva esse vídeo pra lembrar disso na próxima vez que bater a preguiça. #dinheiro #disciplina #motivação #investimentos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393577/3393577_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T18:10:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393576</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393576/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GTA 6 tudo real</video:title>
      <video:description>Game #Jogo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393576/3393576_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-01T18:10:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DOG ER DOING YOUGA</video:title>
      <video:description>GOOD TRAINED DOG</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393575/3393575_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T18:10:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Batik pria modern sarimbit lapis furing bahan adem</video:title>
      <video:description>Sangat cocok untuk segala acara Nyaman dipakai gak bikin gerah #paris #perancis #cina #indiakoreaselatan #indonesia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393574/3393574_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T18:10:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A vergonha de laranjinha</video:title>
      <video:description>A laranjinha hoje passou uma vergonha na rua</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393573/3393573_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T18:10:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Esse Animal apareceu no sitio #animalselvagem</video:title>
      <video:description>Esse Animal apareceu no sitio #animalselvagem #sitio #animais #natureza #brasil #amazonia #rondonia #cidade</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393572/3393572_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T18:10:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GÊNESIS CAPÍTULO 2: O SÁBADO, O JARDIM DO ÉDEN E A CRIAÇÃO DO HOMEM E DA MULHER</video:title>
      <video:description>Explore em detalhe o segundo capítulo do livro de Gênesis. Descubra a instituição do dia de descanso (o Sábado), a formação detalhada do homem a partir do pó da terra, a perfeição do Jardim do Éden com a árvore da vida e o momento profético da criação da mulher. Um estudo bíblico profundo sobre a nossa origem e o plano original de Deus para a família e o casamento. #GENESIS2 #GENESIS #LIVRODEGENESIS #BIBLIA #PALAVRADEDEUS #DEUS #EDEN #JARDIMDOEDEN #CRIACAO #CASAMENTO #CRISTAO #VIRAL #SHORTS Os vídeos não substituem a leitura de uma Bíblia &quot;tradicional&quot;, mais se você apreciar o nosso áudio-vídeo com a voz na palavra bíblica ao sons de chuva e leves trovoadas relaxantes, esta será uma boa opção de Bíblia favorita. #genesis #deus #oração #criaçãodohomem #adãoeeva #biblianarrada</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393571/3393571_720p.mp4</video:content_loc>
      <video:duration>232</video:duration>
      <video:publication_date>2026-09-01T18:10:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Corgi hops.</video:title>
      <video:description>#CAOGORDOSUBINDOESCADA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393570/3393570_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-01T18:10:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sena top</video:title>
      <video:description>#Anime</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393569/3393569_720p.mp4</video:content_loc>
      <video:duration>352</video:duration>
      <video:publication_date>2026-09-01T18:10:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nova treiler do Wolverine game</video:title>
      <video:description>#filmes #jogos #series</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393568/3393568_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-01T18:09:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeo viral 4</video:title>
      <video:description>Vídeo muito engraçado veja vc vai rir muito #Gimenes10</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393565/3393565_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T18:09:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A garota de quarto escondia uma cobra</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393564/3393564_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-01T18:09:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the timid cat</video:title>
      <video:description>Intruder in the area</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393563/3393563_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T18:09:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nisra Noor #😘 Hot dance #performance #🔥 2026</video:title>
      <video:description>Nisra Noor #😘 Hot dance# performance# 🔥 2026</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393562/3393562_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T18:09:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cocada no Fogo de Chão #vidanositio</video:title>
      <video:description>Fazendo cocada no fogo de chão no Sitio. #cocada #sitio #vidanositiobrasil #viral #shorts #foryou</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393561/3393561_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T18:09:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 9</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393560/3393560_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:09:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Google Voice: Business Phone Number &amp; Systems</video:title>
      <video:description>We respond within 24 hours: ➤ Telegram: @kycusasmm ➤ WhatsApp: +1 (434) 879-3038 ➤ Email: kycusasmm@gmail.com Business communication increasingly relies on cloud-based tools. Instead of using a traditional office telephone system, organizations can use internet-based services to manage calls, text messages, voicemail, and related communication from computers and mobile devices. #googlevoice</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393559/3393559_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T18:09:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soccer 11</video:title>
      <video:description>Viral soccer #Usa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3393558/3393558_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T18:08:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chillido de Perro Remix</video:title>
      <video:description>#CAODANÇAENGRAÇADO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393557/3393557_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T18:08:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fala minha galera</video:title>
      <video:description>🎶 VAMOS DIVULGAR O TALENTO! 🎶 🎤 Tuninho D’ilheus | Cantor &amp; Compositor 🎸 Música • Alegria • Cultura • História ✨ Já somos 100 inscritos no YouTube! Agora queremos chegar ainda mais longe! 🚀 👉 Inscreva-se no canal, curta os vídeos e compartilhe com os amigos! ❤️ 🎵 Venha conhecer as músicas e acompanhar o trabalho do Tuninho D’ilheus! 📺 YouTube: Tuninho D’ilheus 🔔 Inscreva-se e faça parte dessa história! 100 inscritos hoje… rumo a 1.000! 🙌🎶 #França</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393556/3393556_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:08:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 36</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393555/3393555_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:08:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carro largo</video:title>
      <video:description>#Brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393554/3393554_720p.mp4</video:content_loc>
      <video:duration>114</video:duration>
      <video:publication_date>2026-09-01T18:08:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naturrza</video:title>
      <video:description>#natueza</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393553/3393553_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T18:08:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 35</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393552/3393552_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:07:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 8</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393551/3393551_720p.mp4</video:content_loc>
      <video:duration>110</video:duration>
      <video:publication_date>2026-09-01T18:07:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piadas 4</video:title>
      <video:description>Piadas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393550/3393550_720p.mp4</video:content_loc>
      <video:duration>2201</video:duration>
      <video:publication_date>2026-09-01T18:07:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afrren pari #blockbuster dance #performance# 🔥 2029</video:title>
      <video:description>Afrren pari #blockbuster dance# performance$ 🔥 2026</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393549/3393549_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-01T18:07:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The secret to irresistible Bangladeshi Kacchi Biryani! 🇧🇩🔥</video:title>
      <video:description>Tender halal mutton, fluffy basmati rice, golden potatoes, caramelized onions, saffron and fragrant kewra come together in this classic Bangladeshi-style biryani. Ingredients: 🥩 750g halal bone-in mutton 🍚 500g basmati rice 🥔 3 potatoes 🥛 1 cup yogurt 🧄 2 tbsp ginger-garlic paste 🌶️ 1 tsp chili powder 🧂 1½ tsp salt 🧈 4 tbsp ghee 🌿 Saffron, kewra, whole spices, fried onions, cashews &amp; raisins Marinate: at least 2 hours Rice: cook to about 70% before layering Final cooking: low heat until the mutton is completely tender. Would you eat this Kacchi Biryani? 🤤 Save this recipe and follow RannaBot for more halal recipes! #BangladeshiKacchiBiryani #KacchiBiryanirecipe #easybiryanirecipe</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393548/3393548_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T18:07:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Final do Rodeio em touros junior de barretos 2026!   Barretos Junior Bull Riding Final 2026</video:title>
      <video:description>Final do Rodeio em touros junior de barretos 2026! Barretos Junior Bull Riding Final 2026</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393547/3393547_720p.mp4</video:content_loc>
      <video:duration>1569</video:duration>
      <video:publication_date>2026-09-01T18:07:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 34</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393546/3393546_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:07:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat Pop Bohemian Rhapsody</video:title>
      <video:description>#GATOMUSICAPIANO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393545/3393545_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T18:07:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pretty Girl 324</video:title>
      <video:description>Tiktoker Girl</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393544/3393544_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T18:07:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Subindo a Ciclovia da Vida de Bike trajeto Vitória a Vila Velha</video:title>
      <video:description>Subindo a Ciclovia da Vida de bike: Giro Urbano e pedal de Vitória para Vila Velha pela Terceira Ponte, com ciclismo urbano e paisagens do Espírito Santo. Neste vídeo você acompanha a subida da Ciclovia da Vida em um pedal urbano entre Vitória e Vila Velha. Uma travessia de bicicleta com movimento, desafio, paisagem capixaba e uma vista impressionante da Terceira Ponte. O Giro Urbano mostra diferentes momentos do percurso, desde o início da subida até a travessia em direção a Vila Velha. Assista ao vídeo completo e conte nos comentários qual trecho mais chamou sua atenção. CAPÍTULOS 00:00 - Giro Urbano em Vitória 00:20 - Subida da Ciclovia da Vida 00:40 - Travessia de bike para Vila Velha Você já atravessou a Ciclovia da Vida de bicicleta? Conte sua experiência nos comentários. 👍 Deixe seu gostei. 🔔 Inscreva-se para acompanhar os próximos pedais. 📲 Compartilhe com quem também curte ciclismo urbano. Conteúdo sobre ciclismo, bike, pedal urbano, MTB, Ciclovia da Vida, Vitória, Vila Velha e rotas pelo Espírito Santo. #bike #vida #mtb #reels #viral #viralvídeo #youtube #shorts #Instagram #funny #trilha</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393543/3393543_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-01T18:07:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prateleira Industrial😍</video:title>
      <video:description>https://br.shp.ee/pejd4y3r?fromSource=copy_link&amp;smtt=0.0.9 #Prateleira #decoração</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393542/3393542_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T18:07:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 33</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393541/3393541_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:07:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comida 13</video:title>
      <video:description>#Comida #alimentação #refeições #natal</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393540/3393540_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T18:07:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mistura brasileira</video:title>
      <video:description>Vídeos engraçados para toda família #HumorcomédiaviraroBrasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393539/3393539_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T18:06:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YAOLAX City - Clamor Dos Que Ficaram</video:title>
      <video:description>[trecho falado] Essa canção é um grito de alerta dirigido a todos os que se dizem cristãos. Quer percebam ou não, muitos estão entregando suas almas à adoração de espíritos malignos disfarçados de santidade. Na Grande Tribulação, não haverá mais máscaras: alguns verão com absoluta clareza que foram enganados e reconhecerão a verdade de forma brutal. E nesse momento, terão diante de si a escolha mais dura — a salvação conquistada não por ilusões, mas pelo preço do próprio sangue. Não se enganem: confiar no falso é condenação, e só quem encara a verdade sem medo poderá escapar. [Verso 1] Sinais de fogo riscam o alto A lua perde a cor no mar Trombetas cortam o nevoeiro Ninguém consegue se esconder Portas fechadas, passos correndo Sirenas mordem o amanhecer Mães abraçando seus pequenos Enquanto o medo aprende a falar [Pré-Refrão] Mas no peito ainda resta uma chama Mesmo cercado, ninguém vai cair Se a noite exige o preço da alma A fé responde: eu vou resistir [Refrão] IÁURRU, firma os meus passos IAURRÚSHUA, guarda o meu coração Se o céu desabar sobre nós Não entrego a minha salvação IÁURRU, sopra coragem IAURRÚSHUA, acende a visão No meio da grande tribulação Resistiremos até o fim, então [Verso 2] Ruas sem nome, cidades em cinzas A fome rondando cada portão Os que proclamam a verdade são caçados E a mentira veste a multidão Correntes frias, joelhos feridos Um nome gravado na escuridão Mas cada lágrima cai como semente E rompe o chão da perseguição [Pré-Refrão] Quando a dor atravessa a carne Quando o silêncio tenta me calar Ouço no fundo do vale: Ainda há caminho para voltar [Refrão] IÁURRU, firma os meus passos IAURRÚSHUA, guarda o meu coração Se o céu desabar sobre nós Não entrego a minha salvação IÁURRU, sopra coragem IAURRÚSHUA, acende a visão No meio da grande tribulaç</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393538/3393538_720p.mp4</video:content_loc>
      <video:duration>297</video:duration>
      <video:publication_date>2026-09-01T18:06:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 32</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393537/3393537_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:06:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ELVAYRA — Feel the Fire | Afro House • Electronic • Female Vocals  #afrohouse #electronicmusic</video:title>
      <video:description>ELVAYRA — Afro House • Electronic • Female Vocals Official music from ELVAYRA. Deep Afro House grooves, hypnotic percussion, powerful bass and soulful female vocals blended with sophisticated international electronic production. Subscribe to ELVAYRA for new music and upcoming releases. #ELVAYRAAfroHouseAfroHouseMusicElectronicMusicFemaleVocalsDeepHouseDanceMusicInternationalElectronicMusicAfroElectronicHouseMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393536/3393536_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T18:06:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flávio Bolsonaro DESTROI A GLOBO e ganha VOTOS - SABATINA GLOBO</video:title>
      <video:description>Flavio Bolsonaro Na Globo #Brasil #Eleições #flaviobolsonaro #eleições2026 #profeciabrasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393535/3393535_720p.mp4</video:content_loc>
      <video:duration>138</video:duration>
      <video:publication_date>2026-09-01T18:06:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 31</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393534/3393534_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:06:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Descendentes</video:title>
      <video:description>Amizades delas acabaram #Descendentes</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393533/3393533_720p.mp4</video:content_loc>
      <video:duration>126</video:duration>
      <video:publication_date>2026-09-01T18:06:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 7</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393532/3393532_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T18:06:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora la galera 2</video:title>
      <video:description>Curit companhia #Bompranós</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393531/3393531_720p.mp4</video:content_loc>
      <video:duration>194</video:duration>
      <video:publication_date>2026-09-01T18:06:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 30</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393530/3393530_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:05:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 sites gringos</video:title>
      <video:description>Home off #Moneyextra</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393529/3393529_720p.mp4</video:content_loc>
      <video:duration>136</video:duration>
      <video:publication_date>2026-09-01T18:05:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HI, HI! 👋🐥 | Hello Song with Pilicute | Kids Songs &amp; Nursery Rhymes</video:title>
      <video:description>👋🐥 HI, HI! Come say HELLO and sing along with Pilicute! 🌈🎵 Hi, hi! Hello, hello! Wave your hands and join the fun! A cheerful and catchy hello song for toddlers and preschoolers to sing, dance and play along with Pilicute. 💛 Let&apos;s start the day with smiles, music and lots of fun! #PilicuteHelloSongKidsSongsNurseryRhymesToddlerSongsPreschoolSongs</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393528/3393528_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-09-01T18:05:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soccer 10</video:title>
      <video:description>Viral soccer #Brazil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393527/3393527_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T18:05:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angry Pom-R</video:title>
      <video:description>#CAESENGRAÇADO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393526/3393526_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-01T18:05:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aonde Está Você 🎶 | Trecho da Música</video:title>
      <video:description>Confira este trecho da música Aonde Está Você. 🎤🎶 #aondeestávocê #trechodamúsica #música #JoãoBrito #forró #seresta #brega #músicabrasileira #cantorBregaxote</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393524/3393524_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T18:05:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 29</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393523/3393523_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:05:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 6</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393522/3393522_720p.mp4</video:content_loc>
      <video:duration>296</video:duration>
      <video:publication_date>2026-09-01T18:05:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>We&apos;ve Seen GTA 6 Gameplay IRL - The First Preview</video:title>
      <video:description>Grand Theft Auto 6 is the most anticipated game of at least the last decade. And we got the chance to go Rockstar North and watch co-studio head Rob Nelson play through 30 minutes of the game. Half an hour later, it has become a clear and uncontestable fact that this game will occupy every waking minute of my existence when it finally arrives this November. If you need to know just one thing about GTA 6, it&apos;s that you&apos;ll spend so much time in it you&apos;ll probably be subject to Leonida taxes. When IGN was invited into the secretive halls of Rockstar North for an exclusive look, we knew the gameplay slice would show how much GTA has grown and evolved since its last iteration launched 13 years ago. But even with that expectation, what we saw was even grander than we expected. #GTA6 #GTA #JOGO #Gameplay</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393521/3393521_720p.mp4</video:content_loc>
      <video:duration>687</video:duration>
      <video:publication_date>2026-09-01T18:05:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WORLD WAR Z Looks Scary (PS5) Realistic ULTRA Graphics (4K 60FPS HDR)</video:title>
      <video:description>WORLD WAR Z Looks Scary (PS5) Realistic ULTRA Graphics (4K 60FPS HDR) World War Z is a third-person shooter video game developed and published by Saber Interactive. It was released for Microsoft Windows, PlayStation 4 and Xbox One on 16 April 2019, and a Nintendo Switch version was released on 2 November 2021. It was released for Google Stadia on 5 April 2022. Ports for PlayStation 5 and Xbox Series X/S released on 24 January 2023. Loosely based on the 2006 novel World War Z and set in the same universe as the 2013 film adaptation, the game follows groups of four survivors of a zombie apocalypse. #game #zumbis</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393520/3393520_720p.mp4</video:content_loc>
      <video:duration>3496</video:duration>
      <video:publication_date>2026-09-01T18:05:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A VERDADE QUE NÃO TE CONTAM SOBRE VENDAS</video:title>
      <video:description>Foco em Digital - 08-21 452 ... A VERDADE QUE NÃO TE CONTAM SOBRE VENDAS #reflexion #motivation #fypviral__ #creatorsearchinsights #casasbahia menos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393519/3393519_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T18:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 28</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393518/3393518_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:05:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiaosep</video:title>
      <video:description>Vamos da uma olhadinha ai galera #Viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393517/3393517_720p.mp4</video:content_loc>
      <video:duration>160</video:duration>
      <video:publication_date>2026-09-01T18:05:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIET FAILED JUST ONE MORE BITE,, TOO SPICY</video:title>
      <video:description>Me: &quot;I&apos;m on a diet. Just a little rice&quot; Also me 5 minutes later: _adds chili, adds more chili, suffers_ The &quot;diet&quot; was a lie and the chili won 😭 Bismillah and pray for my stomach. Tag your friend who’s always &quot;on a diet&quot; 👇 #DietFoodSpicyFoodChiliEatingRelatableComedyFoodieViralFYPIndonesiaFoodCheatDay</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393516/3393516_720p.mp4</video:content_loc>
      <video:duration>388</video:duration>
      <video:publication_date>2026-09-01T18:04:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As flores</video:title>
      <video:description>As flores são lindas. Logo se percebe a obra da criação divina, né? #Flores #criação #lindeza</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393515/3393515_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T18:04:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O garoto não era amado pela sua família</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393514/3393514_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-09-01T18:04:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 27</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393513/3393513_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:04:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novola da rede globo</video:title>
      <video:description>Ela não esperava ovi esso da própria mãe #Noveladaredeglobo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393512/3393512_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:04:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sardar Ji का Mutton Paya</video:title>
      <video:description>Sardar Ji का Mutton Paya खाने के लिए ऐसी दीवानगी की लोग बारिश मे भीग कर खाने आते__1 घंटे मे सब खत्म #Sardarmutton #Sardarjipaya #Pappupayawala #Mumbaipaya #Mumbaimutton #Chickenthali #Dehatimurga #Dehatimeat #Adivasichicken #Mutton #Chickenpanja #Ranchimutton #Biharmutton #Keemakaleji #Zaikapatnaka #Tarajumutton #Tarajufishfry #Desifood #Patnafoodvlogs #Patnastreetfood #Patna #Bihar #Biharfoodvlogs #Biharstreetfood #Muttonrpganjosh #Desimutton #Muttonstew #Streetfood #Indianstreetfood #Ahunamutton #Patnavlogs #Muttonpaya</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393511/3393511_720p.mp4</video:content_loc>
      <video:duration>930</video:duration>
      <video:publication_date>2026-09-01T18:04:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O cavalo preto - Chyren - nascido na Bahia!</video:title>
      <video:description>Você já parou para pensar nas incriveis profecias do Apocalipse? Hoje vou lhes revelar sobre o Cavalo Preto e suas conexões místicas com o Brasil... #cavalopreto #brasil #bahia #jotaelbatistaahistóriadoservo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393510/3393510_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-01T18:04:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mylubom</video:title>
      <video:description>Bora la galera #Viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393509/3393509_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-01T18:04:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muito engraçado vale apena ver de novo</video:title>
      <video:description>Vale apena ver de novo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393508/3393508_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T18:04:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pretty Girl 323</video:title>
      <video:description>Hot Dress</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393507/3393507_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T18:04:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angery Bois</video:title>
      <video:description>#CAODIVERSAO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393506/3393506_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-01T18:03:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 26</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393505/3393505_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:03:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moonlit Reunion (Hindi) - Season 01 Episode 33</video:title>
      <video:description>#MoonlitReunion #MoonlitReuniondrama #Chinesedrama #C-drama #fantasyromance #historicalfantasy #costumedrama #supernaturalromance #demonslayer #halfdemon #WuZhen #MeiZhuyu #XuKai #TianXiwei #ancientChina #forbiddenlove #enemiestolovers #secretidentity #supernaturalmystery #romancedrama #fantasydrama #perioddrama #Chinesefantasyseries #mysticaladventure #demonsandspirits</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393504/3393504_720p.mp4</video:content_loc>
      <video:duration>2516</video:duration>
      <video:publication_date>2026-09-01T18:03:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O poder de comprar dos americanos 🤑😱</video:title>
      <video:description>#dinheiro #usa #brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393503/3393503_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-01T18:03:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moonlit Reunion (Hindi) - Season 01 Episode 32</video:title>
      <video:description>#MoonlitReunion #MoonlitReuniondrama #Chinesedrama #C-drama #fantasyromance #historicalfantasy #costumedrama #supernaturalromance #demonslayer #halfdemon #WuZhen #MeiZhuyu #XuKai #TianXiwei #ancientChina #forbiddenlove #enemiestolovers #secretidentity #supernaturalmystery #romancedrama #fantasydrama #perioddrama #Chinesefantasyseries #mysticaladventure #demonsandspirits</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393502/3393502_720p.mp4</video:content_loc>
      <video:duration>2501</video:duration>
      <video:publication_date>2026-09-01T18:03:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Da uma olhada</video:title>
      <video:description>Esse vídeo é bom #Va</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393501/3393501_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T18:03:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Essa é uma rima da hora adorei</video:title>
      <video:description>Muito da hora a letra #MG</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393500/3393500_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T18:03:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUBHAAN ALLAH 2</video:title>
      <video:description>ALLAH HO AKBAR</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393499/3393499_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T18:03:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trens</video:title>
      <video:description>#Trem #falar #futebol</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3393498/3393498_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T18:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3×9=18😜😜</video:title>
      <video:description>পররাষ্ট্র প্রতিমন্ত্রীর কথাগুলো শুনুন #vairalvideo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393497/3393497_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T18:03:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hey, come see my dog having fun!</video:title>
      <video:description>Like and share</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393496/3393496_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T18:03:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro Vingador. Cia de rodeio Tercio miranda! Avenger Bull. Tercio Miranda Rodeo Company.</video:title>
      <video:description>Touro Vingador. Cia de rodeio Tercio miranda! Avenger Bull. Tercio Miranda Rodeo Company.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393495/3393495_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T18:03:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Super Air Jet flight attendant checking passenger tickets.mp4</video:title>
      <video:description>Super Air Jet flight attendant checking passenger tickets.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393494/3393494_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T18:03:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 5</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393493/3393493_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T18:02:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Angery Bois are back</video:title>
      <video:description>#CAO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393492/3393492_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-01T18:02:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rear-naked choke</video:title>
      <video:description>#kravmaga #mma</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393491/3393491_720p.mp4</video:content_loc>
      <video:duration>369</video:duration>
      <video:publication_date>2026-09-01T18:02:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stage drama full jhakaas 2</video:title>
      <video:description>Dance performance 🔥 mujra masti video viral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393490/3393490_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T18:02:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Davi e o gigante</video:title>
      <video:description>Davi (homem baixo) venceu o gigante Goiás com uma pedra. Obs.: Ele tinha fe em Deus. #Gigante #vitória #fé</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393488/3393488_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-01T18:02:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Auto defesa canina</video:title>
      <video:description>#Defesa</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393487/3393487_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T18:02:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vishal Verma speci</video:title>
      <video:description>Enjoying the amazing view of the clear blue sky, fluffy white clouds, and green nature alongside a calm village road.sky, nature, clouds, village road, scenic view, beautiful sky, nature lovers #Enjoyingtheamazingviewoftheclearbluesky #fluffywhiteclouds #andgreennaturealongsideacalmvillageroad</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393486/3393486_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T18:01:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>La Sombra del Pasado, El Heredero de los Ochoa o Tizón de Traición</video:title>
      <video:description>la traicion en la famillia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393485/3393485_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-09-01T18:01:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quem concede a fé ao homem?</video:title>
      <video:description>#teologia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393483/3393483_720p.mp4</video:content_loc>
      <video:duration>365</video:duration>
      <video:publication_date>2026-09-01T18:01:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pramugari Cantik Super Air Jet Lagi Action dalam Pesawat 🥰🥰👍👍.mp4</video:title>
      <video:description>Pramugari Cantik Super Air Jet Lagi Action dalam Pesawat 🥰🥰👍👍.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393482/3393482_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T18:01:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 4</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393481/3393481_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-01T18:01:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 25</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393480/3393480_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:01:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YAOLAX City - A Arca em Chamas</video:title>
      <video:description>[Intro] Quando a terra encharcou de culpa IÁURRU viu a dor sem pudor Era a voz da tarde escura E o céu fechou seu corredor [Verse 1] Nos dias de Noé, lama e engano Mão no pecado, olho no irmão Coração de pedra, rosto humano Rindo do aviso, bebendo ilusão Arcas no cortejo, madeira e promessa Enquanto a enxada cortava o chão A mesma vergonha, a mesma pressa Pintava a história da geração [Pre-Chorus] E o aviso veio forte no vento Cai a mentira, sobe o julgamento Quando a maldade vira fundamento Quem nega a chama entra no tormento [Chorus] IÁURRU, salva-nos do fogo IÁURRU, fecha o chão IÁURRU, chama o justo Pra dentro da salvação IÁURRU, salva-nos do fogo IÁURRU, leva a mão Arca de vida, peito ferido Noé do tempo, livramento em vão? (não) [Verse 2] Tem templo entoando o nome errado Pedra pintada em rosto de oração Líder de manto, pacto manchado Vendendo o céu com falsa unção Adultério em púlpito, língua quebrada Mentira em coro, máscara e pão Mão dupla na mesa, alma trancada Rindo do abismo dentro do salão E o povo pede paz com a boca vazia Mas pisa na estrada da perdição O erro veste a veste da liturgia E a casa se dobra na corrupção [Pre-Chorus] E a fumaça sobe do altar torto Mas o fogo vem, não vem conforto Se a porta fecha, o grito é morto Só quem se rende atravessa o porto [Chorus] IÁURRU, salva-nos do fogo IÁURRU, fecha o chão IÁURRU, chama o justo Pra dentro da salvação IÁURRU, salva-nos do fogo IÁURRU, leva a mão Arca de vida, peito ferido Noé do tempo, livramento em vão? (não) [Bridge] IAURRÚSHUA, nome de resgate Voz que atravessa a fumaça e o terror Tua sentença não é de combate É porta aberta no meio da dor Mas quem prefere o brilho do erro Vai abraçar seu próprio carvão Vai ouvir tarde demais, no desespero O som do juízo varrendo o chão IÁURRU, dá-nos olhos limp</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393479/3393479_720p.mp4</video:content_loc>
      <video:duration>347</video:duration>
      <video:publication_date>2026-09-01T18:01:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393478</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393478/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#ogrande bitelo o cara mais forte do Brasil 🇧🇷.</video:title>
      <video:description>Este vídeo é de um dos cara mais conhecido do Brasil e do mundo.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393478/3393478_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T18:01:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Ninguém precisa acreditar no teu começo. Só precisam assistir ao teu resultado.”</video:title>
      <video:description>#motivacional</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393477/3393477_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:01:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hand-to-hand choke (rear naked choke)</video:title>
      <video:description>#kravmaga #mma #jiujitsu</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393475/3393475_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-09-01T18:01:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393474</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393474/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 24</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393474/3393474_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:01:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Have Not Forgotten You</video:title>
      <video:description>Jesus wants to speak to your heart. #Jesus #JesusChrist #Faith</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393473/3393473_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:01:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Breath of Fire- Part 13</video:title>
      <video:description>Well, there´s no much talking in here, just earning enough gold to buy the G.Bar in Bleak #game #preparing #getready #gameplays #classic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393472/3393472_720p.mp4</video:content_loc>
      <video:duration>1239</video:duration>
      <video:publication_date>2026-09-01T18:00:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amor diferente</video:title>
      <video:description>#Amor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393471/3393471_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T18:00:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muito lindo essa música</video:title>
      <video:description>Eu adorei a letra dessa música é muito linda #MG</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393470/3393470_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T18:00:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 23</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393469/3393469_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:00:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jo sukoon pata hai azan sunkar wo coment kare</video:title>
      <video:description>jo sukoon pata hai azan sunkar wo coment kare 🥰 #vairalvideo #islamicvideo #ytshorts #trendingvideo.mp4 #josukoonpatahaiazansunkarwocomentkare</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393468/3393468_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T18:00:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393467</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393467/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro Reza lenda. Cia. Jk Bucking Bulls!! Bull Prays legend. Co. Jk Bucking Bulls</video:title>
      <video:description>Touro Reza lenda. Cia. Jk Bucking Bulls!! Bull Prays legend. Co. Jk Bucking Bulls</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393467/3393467_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:00:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ivestimento 3</video:title>
      <video:description>#Ivestimento</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393465/3393465_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T18:00:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 22</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393464/3393464_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T18:00:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Movimento único</video:title>
      <video:description>#Amor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393463/3393463_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T17:59:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stage drama full jhakaas</video:title>
      <video:description>Hot 😍 dance performance 🔥 video viral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393462/3393462_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T17:59:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FUNNY REACTION | リアクション神 | 반응 레전드 | 反应太真实</video:title>
      <video:description>Welcome #funny #comedy #funnyvideo #viralfunny #hilarious #meme #funnymoments #comedyshorts #웃긴영상 #개그 #웃음주의 #코미디 #레전드 #대박 #笑った #面白い #爆笑 #おもしろ動画 #笑い #ネタ #搞笑 #搞笑视频 #爆笑视频 #搞笑日常 #太好笑了 #无厘头 #viral #trending #shorts #kdrama #k-drama #koreandrama #koreancomedy #dramafunnymoments #dorama #japanesedrama #jdrama #dramacoreano #ドラマ #韓国ドラマ #面白いドラマ #한국드라마 #드라마추천 #드라마명장면 #드라마웃긴장면 #코믹 #웃긴장면 #명장면 #韩剧 #韩剧搞笑 #韩剧名场面 #电视剧 #搞笑剧情 #funnydrama #dramascene #funnyreaction #unexpectedmoment #plottwist</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393461/3393461_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T17:59:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3393460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3393460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eating, food, Mukbang, asmr 21</video:title>
      <video:description>Eating, food, Mukbang, asmr #Eating #food #Mukbang #asmr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3393460/3393460_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T17:59:42+02:00</video:publication_date>
    </video:video>
  </url>
</urlset>
