<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9"
        xmlns:video="http://www.google.com/schemas/sitemap-video/1.1">
  <url>
    <loc>https://www.febspot.com/video/3396965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #42</video:title>
      <video:description>Brincando !!! #funny #fun #cat #cats #gatinhos #catshorts #funnycats #cute #pets #petshorts #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #animalshorts #shortsengraçados #animaisengraçados #vídeosengraçados #vídeosdegatos #petsengraçados</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396965/3396965_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:47:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resident Evil 7 Part =_04.webm</video:title>
      <video:description>Resident Evil 7 Part =_04.webm</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396964/3396964_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-02T03:47:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bello named Little Horse</video:title>
      <video:description>Belo, a young horse, felt lonely and friendless, so he attached himself to a sheep farmer, seeking attention.Ask the sheep farmer for food and drink at the farm. #Entertainment</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396963/3396963_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T03:47:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What If GPS Suddenly Stopped Working Worldwide? The First 24 Hours</video:title>
      <video:description>Imagine waking up tomorrow and discovering that GPS signals have completely disappeared across the entire planet. Cars lose navigation. Ships struggle to determine their exact position. Aircraft systems are disrupted. Delivery networks become confused, financial systems face unexpected problems, and countless everyday devices suddenly lose access to one of the technologies they silently depend on. But how much of modern civilization actually relies on GPS? In this video, we explore what could happen during the first minutes, hours, and days of a worldwide GPS outage — and how governments, transportation networks, emergency services, businesses, and ordinary people could be affected. 🛰️ What would happen if GPS disappeared instantly? ✈️ Could airplanes still navigate safely? 🚢 How would ships find their way across the oceans? 🚗 What would happen to cars, delivery systems, and navigation apps? 💳 Could financial systems be affected by the loss of GPS timing? 🌎 How would the world function without satellite positioning? GPS is almost invisible when it works — but its disappearance could reveal just how dependent modern society has become on satellites. If GPS stopped working worldwide tomorrow, how long would it take for the world to feel the impact? #whatifgpsstoppedworking #whatifgpsdisappeared #gpsblackout #globalgpsoutage #worldwidegpsoutage #gpsfailure #gpsstoppedworking #whathappensifgpsstopsworking #worldwithoutgps #gpsshutdown #globalgpsshutdown #gpssatellitefailure #satellitenavigation #gpssatellites #globalnavigationsystem #navigationfailure #gpsoutageexplained #gpsblackoutexplained #whatifsatellitesstoppedworking #satellitefailure #globalsatelliteoutage #airplaneswithoutgps #shipswithoutgps #carswithoutgps #navigationwithoutgps #gpsandaviation #gpsandtransportati</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396962/3396962_720p.mp4</video:content_loc>
      <video:duration>454</video:duration>
      <video:publication_date>2026-09-02T03:47:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resident Evil 7 Part =_03.webm</video:title>
      <video:description>Resident Evil 7 Part =_03.webm</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396961/3396961_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-02T03:46:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cabelo afro</video:title>
      <video:description>✨ Cabelo afro que chama atenção! ✨ Você teria coragem de apostar nesse visual poderoso? 😍🔥 Valorize seus cachos, sua beleza e sua personalidade com muito estilo! 💇🏾‍♀️❤️ 👉 O que você achou desse cabelo? Comenta aqui! #Viajem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396960/3396960_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-02T03:46:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Scooby-Doo finalmente esta de Volta ! - Scooby-Doo is finally back!</video:title>
      <video:description>Scooby-Doo finalmente esta de Volta ! - Scooby-Doo is finally back! #movies #movienews #entertainment #cinema #films #series #TVshows #popculture #geek #nerd #moviefacts #movietrivia #entertainmentnews #upcomingmovies #newmovies #viralvideos #trending #shorts #movieclips #filmes #séries #culturapop #mundonerd #mundogeek #curiosidades #curiosidadesdefilmes #notíciasdefilmes #novidadesdocinema #filmesnovos #próximosfilmes #entretenimento #heróis #vilões #desenhos #vídeosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396959/3396959_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T03:46:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>avb026</video:title>
      <video:description>avb026</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396958/3396958_720p.mp4</video:content_loc>
      <video:duration>2835</video:duration>
      <video:publication_date>2026-09-02T03:46:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thor tem uma IRMÃ? E Odin achava que ela estava MORTA! 😱 | Thor Has a SISTER?!</video:title>
      <video:description>Thor tem uma IRMÃ_ E Odin achava que ela estava MORTA_ 😱 #movies #movienews #entertainment #cinema #films #series #TVshows #popculture #geek #nerd #moviefacts #movietrivia #entertainmentnews #upcomingmovies #newmovies #viralvideos #trending #shorts #movieclips #filmes #séries #culturapop #mundonerd #mundogeek #curiosidades #curiosidadesdefilmes #notíciasdefilmes #novidadesdocinema #filmesnovos #próximosfilmes #entretenimento #heróis #vilões #desenhos #vídeosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396957/3396957_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-02T03:46:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O massacre dos morlocks, Que Poucos conhece ! The Morlock massacre.</video:title>
      <video:description>O massacre dos morlocks #movies #movienews #entertainment #cinema #films #series #TVshows #popculture #geek #nerd #moviefacts #movietrivia #entertainmentnews #upcomingmovies #newmovies #viralvideos #trending #shorts #movieclips #filmes #séries #culturapop #mundonerd #mundogeek #curiosidades #curiosidadesdefilmes #notíciasdefilmes #novidadesdocinema #filmesnovos #próximosfilmes #entretenimento #heróis #vilões #desenhos #vídeosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396956/3396956_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-02T03:46:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Finalmente, RAMBO está de Volta! 🔥 | RAMBO Is Finally Back!</video:title>
      <video:description>#movies #movienews #entertainment #cinema #films #series #TVshows #popculture #geek #nerd #moviefacts #movietrivia #entertainmentnews #upcomingmovies #newmovies #viralvideos #trending #shorts #movieclips #filmes #séries #culturapop #mundonerd #mundogeek #curiosidades #curiosidadesdefilmes #notíciasdefilmes #novidadesdocinema #filmesnovos #próximosfilmes #entretenimento #heróis #vilões #desenhos #vídeosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396955/3396955_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T03:46:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌺 ஆவணி 16 – புதன்கிழமை | அம்மன் அருள்வாக்கு</video:title>
      <video:description>🌺 ஆவணி 16 – புதன்கிழமை | அம்மன் அருள்வாக்கு &amp; துல்லியமான ராசி பலன் 🌺</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396954/3396954_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:46:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dave Bautista substitui Ryan Hurst como Kratos ! Dave Bautista as Kratos?!</video:title>
      <video:description>Dave Bautista substitui Ryan Hurst como Kratos ! Dave Bautista as Kratos?! #movies #movienews #entertainment #cinema #films #series #TVshows #popculture #geek #nerd #moviefacts #movietrivia #entertainmentnews #upcomingmovies #newmovies #viralvideos #trending #shorts #movieclips #filmes #séries #culturapop #mundonerd #mundogeek #curiosidades #curiosidadesdefilmes #notíciasdefilmes #novidadesdocinema #filmesnovos #próximosfilmes #entretenimento #heróis #vilões #desenhos #vídeosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396953/3396953_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-02T03:46:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resident Evil 7 Part =_02.webm</video:title>
      <video:description>Resident Evil 7 Part =_02.webm</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396952/3396952_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T03:46:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Breaking My Own Chains</video:title>
      <video:description>#music #song</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396951/3396951_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-02T03:46:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CISMA_ A BRIGA QUE DIVIDIU OS X-MEN ! - The Fight That Split the X-Men.</video:title>
      <video:description>CISMA_ A BRIGA QUE DIVIDIU OS X-MEN ! - The Fight That Split the X-Men. #movies #movienews #entertainment #cinema #films #series #TVshows #popculture #geek #nerd #moviefacts #movietrivia #entertainmentnews #upcomingmovies #newmovies #viralvideos #trending #shorts #movieclips #filmes #séries #culturapop #mundonerd #mundogeek #curiosidades #curiosidadesdefilmes #notíciasdefilmes #novidadesdocinema #filmesnovos #próximosfilmes #entretenimento #heróis #vilões #desenhos #vídeosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396950/3396950_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-02T03:46:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Bird Thinks It&apos;s Michael Jackson 😂🕺🐦</video:title>
      <video:description>When the music hits just right… this bird starts dancing! 😂🐦🕺 The moves, the timing, and the Michael Jackson vibes make this one impossible not to laugh at. Nature can be unexpectedly hilarious! #funnybird #dancingbird #birddancing #funnyanimals #hilariousbird #birddance #funnywildlife #animaldancing #funnyanimalvideo #cutebird #funnybirdvideo #MichaelJackson #MichaelJacksondance #birdlikeMichaelJackson #dancinganimal #hilariousanimals #funnynature #viralbird #funnymoments #animalcomedy</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396949/3396949_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-02T03:46:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resident Evil 7 Part =_01.webm</video:title>
      <video:description>Resident Evil 7 Part =_01.webm</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396948/3396948_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T03:46:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vai Coração, É Amor – Berinjela | O Novo Pagode Romântico 2026</video:title>
      <video:description>❤️🎶 BERINJELA — VAI CORAÇÃO, É AMOR 🔥 Prepare o coração para sentir cada batida desse novo pagode romântico! “Vai Coração, É Amor” chega trazendo uma mistura envolvente de amor, paixão, sentimento e aquele swing gostoso do pagode brasileiro. Quando o coração fala mais alto, não tem jeito… é preciso deixar o sentimento acontecer. ❤️ Com cavaquinho marcante, pandeiro envolvente, tantan, percussão e um refrão feito para cantar junto, essa música foi criada para embalar momentos especiais, rodas de pagode, encontros apaixonados e aquelas noites em que o amor toma conta. 🎧 Aumente o volume e deixe o coração cantar! Se você curtiu, deixe seu like, inscreva-se no canal e compartilhe com aquela pessoa que faz seu coração bater mais forte. ❤️ 🎤 Berinjela — Pagode Brasileiro 🎵 Vai Coração, É Amor #Berinjela #VaiCoraçãoÉAmor #VaiCoraçãoéAmorBerinjela #BerinjelaVaiCoraçãoÉAmor #pagode #pagoderomântico #samba #sambaromântico #pagodeaovivo #músicadepagode #músicaromântica #músicadeamor #músicaparaapaixonados #pagode2026 #samba2026 #músicabrasileira #pagodebrasileiro #sambabrasileiro #novopagode #pagodenovo #lançamentopagode #lançamentomusical #novosucesso #sucessodopagode #coração #amor #paixão #saudade #romance #pagodeapaixonado #pagodeparaouvir #pagodeparacantar #pagodeparadançar #rodadesamba #rodadepagode #cavaquinho #pandeiro #tantan #Berinjelacantor #cantordepagode #músicanova #pagodeviral #sambaviralVaiCoracaoEAmorBerinjelaPagodePagodeRomanticoSambaMusicaDeAmorMusicaRomanticaPagode2026MusicaBrasileiraPagodeBrasileiroSambaRomanticoMusicaNovaNovoPagodeRodaDeSambaPagodeAoVivoBrasil #Brasília #RiodeJaneiro #SãoPaulo #Brasil #Salvador #Manaus #Lisboa #Portugal #Miami #Orlando #NovaYork #EstadosUnidos #BuenosAires #Argentina #SantiagoChile #MadriEspanha #Barcelona #ParisFrança #Londr</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396946/3396946_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-09-02T03:45:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>raíz profunda</video:title>
      <video:description>Raiz Profunda” 🌹🎶 Una historia de amor que ni la distancia ni el tiempo pudieron apagar. Uma canção sertaneja sobre saudade, amor verdadeiro e a esperança de um reencontro. ❤️‍🔥 Si alguna vez amaste a alguien que todavía vive en tu corazón, esta canción es para ti. Dale ❤️, comenta y compártela con esa persona especial. #RaizProfunda #RaízProfunda #RaizProfundamúsica #RaizProfundaletra #músicaRaizProfunda #músicabrasileira #músicaromântica #músicadeamor #amor #saudade #paixão #romance #raízes #sentimentos #coração #cançãoromântica #músicaromânticabrasileira #músicasdeamor #Brazilianmusic #músicaemocional #músicaparacasal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396945/3396945_720p.mp4</video:content_loc>
      <video:duration>426</video:duration>
      <video:publication_date>2026-09-02T03:45:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Safri Duo - Played-A-Live</video:title>
      <video:description>Safri Duo - Played-A-Live</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396944/3396944_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-09-02T03:44:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flamengo 4</video:title>
      <video:description>Flamengo #Futebol #crf #fifa #brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396943/3396943_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-02T03:44:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVORES TOCADOS COM FLAUTA DOCE</video:title>
      <video:description>LOUVORES TOCADOS COM FLAUTA DOCE #musicasdepaz #musicasparaacalmar #musicasparadormir #hinos #hinosdelouvoraDeus #ccb #hinosccb #cânticosccb #louvoresdaharpaCristã #musicasdemeditação #musicaspararelaxar #flautadoce #flautapan #flautaboliviana #hinostocadoscomflauta #hinosinstrumental</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396942/3396942_720p.mp4</video:content_loc>
      <video:duration>4758</video:duration>
      <video:publication_date>2026-09-02T03:44:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Don&apos;t Look Back Tonight | The End of the Lie</video:title>
      <video:description>#music #eletronic #song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396941/3396941_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-09-02T03:44:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu lar</video:title>
      <video:description>Este lugar e muito lindo #Corridatrilha #cachoeira</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396940/3396940_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-02T03:43:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Man From Uncle - 3x5 - The Monks of St. Thomas Affair.</video:title>
      <video:description>The Man from U.N.C.L.E. (br.: &quot;O Agente da UNCLE&quot;) é uma série de espionagem americana, criada pela Metro-Goldwyn-Mayer para ser exibida na televisão. A série foi ao ar de 1964 até 1968 na rede de televisão NBC, com 105 episódios de 60 minutos cada, totalizando quatro temporadas (a primeira foi em preto &amp; branco). O autor de James Bond, Ian Fleming contribuiu para a criação do show. Em 1966 foi lançada a série derivada The Girl from U.N.C.L.E.. #themanfromuncle</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396939/3396939_720p.mp4</video:content_loc>
      <video:duration>3007</video:duration>
      <video:publication_date>2026-09-02T03:43:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você teria coragem</video:title>
      <video:description>🔥 Você teria coragem? 😱 Parece simples… até chegar a hora de enfrentar o desafio! 👀 👉 E você, encararia ou desistiria? Comente sua resposta! #ViajemaFrança</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396938/3396938_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-02T03:43:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂kkkkkforte</video:title>
      <video:description>Fazer você rir</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396937/3396937_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T03:43:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Escape 100 Cops, Win $500,000 MrBeast</video:title>
      <video:description>is it possible to escape 100 cops? Sponsored by Call of Duty: Mobile Download it for FREE</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396936/3396936_720p.mp4</video:content_loc>
      <video:duration>1228</video:duration>
      <video:publication_date>2026-09-02T03:43:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Man From Uncle - 3x4 - The Super-Colossal Affair</video:title>
      <video:description>The Man from U.N.C.L.E. (br.: &quot;O Agente da UNCLE&quot;) é uma série de espionagem americana, criada pela Metro-Goldwyn-Mayer para ser exibida na televisão. A série foi ao ar de 1964 até 1968 na rede de televisão NBC, com 105 episódios de 60 minutos cada, totalizando quatro temporadas (a primeira foi em preto &amp; branco). O autor de James Bond, Ian Fleming contribuiu para a criação do show. Em 1966 foi lançada a série derivada The Girl from U.N.C.L.E.. #themanfromuncle</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396935/3396935_720p.mp4</video:content_loc>
      <video:duration>3008</video:duration>
      <video:publication_date>2026-09-02T03:42:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sou Grato Jesus</video:title>
      <video:description>Uma canção que devemos ser Grato e dar todo louvor a Jesus. #MúsicaGospel #Louvor #Adoração</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396934/3396934_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-02T03:42:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeos engraçados 4</video:title>
      <video:description>Pregando uma peça #Manaus-AM</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396933/3396933_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-09-02T03:41:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_30.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_30.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396932/3396932_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:41:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Man From Uncle - 3x3 - The Galatea aFFAIR.</video:title>
      <video:description>The Man from U.N.C.L.E. (br.: &quot;O Agente da UNCLE&quot;) é uma série de espionagem americana, criada pela Metro-Goldwyn-Mayer para ser exibida na televisão. A série foi ao ar de 1964 até 1968 na rede de televisão NBC, com 105 episódios de 60 minutos cada, totalizando quatro temporadas (a primeira foi em preto &amp; branco). O autor de James Bond, Ian Fleming contribuiu para a criação do show. Em 1966 foi lançada a série derivada The Girl from U.N.C.L.E.. #themanfromuncle</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396931/3396931_720p.mp4</video:content_loc>
      <video:duration>3010</video:duration>
      <video:publication_date>2026-09-02T03:41:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diagnóstico Eletrônico_ Domine Motores Diesel e Hidráulica</video:title>
      <video:description>Diagnóstico Eletrônico_ Domine Motores Diesel e Hidráulica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396930/3396930_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-02T03:41:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_29.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_29.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396929/3396929_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:41:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_28.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_28.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396928/3396928_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T03:41:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LUZ DO EVANGELHO.</video:title>
      <video:description>Saiba como interpleta os ensinamentos do evangelho de Jesus Cristo. #Culto #ensinamento #evangelho</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396927/3396927_720p.mp4</video:content_loc>
      <video:duration>799</video:duration>
      <video:publication_date>2026-09-02T03:41:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Live em um Navio Pirata</video:title>
      <video:description>Live #Live #pirata #pirats #fy #fyp #Brasil #Russian #usa</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396926/3396926_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-02T03:40:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_27.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_27.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396924/3396924_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-02T03:40:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Veja o Final</video:title>
      <video:description>Fazer você rir</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396923/3396923_720p.mp4</video:content_loc>
      <video:duration>150</video:duration>
      <video:publication_date>2026-09-02T03:40:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FURIOUS KITTENS: The Wildest Cat</video:title>
      <video:description>#Ia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396922/3396922_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-02T03:40:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Man From Uncle 02 - 03 session</video:title>
      <video:description>The Man from U.N.C.L.E. (br.: &quot;O Agente da UNCLE&quot;) é uma série de espionagem americana, criada pela Metro-Goldwyn-Mayer para ser exibida na televisão. A série foi ao ar de 1964 até 1968 na rede de televisão NBC, com 105 episódios de 60 minutos cada, totalizando quatro temporadas (a primeira foi em preto &amp; branco). O autor de James Bond, Ian Fleming contribuiu para a criação do show. Em 1966 foi lançada a série derivada The Girl from U.N.C.L.E.. #themanfromuncle</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396921/3396921_720p.mp4</video:content_loc>
      <video:duration>3007</video:duration>
      <video:publication_date>2026-09-02T03:40:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_26.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_26.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396920/3396920_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T03:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_25.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_25.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396919/3396919_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:40:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O MILAGRE DA ÁGUA EM VINHO</video:title>
      <video:description>Uma trilha sonora perfeita para acompanhar seus momentos de estudo, leitura ou aquela pausa tranquila no fim do dia. Pegue sua xícara de café, deixe o som rolar e relaxe. Se curtiu a atmosfera, se inscreve no canal para mais beats semanais! #JesusCristo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396918/3396918_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-02T03:39:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_24.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_24.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396917/3396917_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:39:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_23.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_23.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396916/3396916_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-02T03:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminhada 3</video:title>
      <video:description>Caminhada #Paris #frança #viagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396915/3396915_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-02T03:39:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>রোগ ভালো করার জন্য আল্লাহর এই ৩টি নাম? জানুন</video:title>
      <video:description>চোখ, মাথা ও পেটের রোগ ভালো করার জন্য আল্লাহর নাম নির্দিষ্ট সংখ্যায় পড়ার কথা শুনেছেন? কিন্তু এর সহিহ প্রমাণ আছে কি? #আল্লাহরনামেরফজিলত #রোগমুক্তিরদোয়া #রোগভালোকরারআমল #চোখেররোগেরদোয়া #মাথাররোগেরদোয়া #পেটেররোগেরদোয়া #ইয়ানূর #ইয়াআলীম #আল্লাহরনাম #শিফারদোয়া #রোগমুক্তিরইসলামিকআমল #কুরআনওহাদিস #সহিহহাদিস #শরিয়তসম্মতরুকইয়াহ #IslamicHealingBangla #DuaforShifa #AllahNames #YaNoor #YaAleem #IslamicReminderBangla #BanglaIslamicShorts #IslamicShorts #QuranHadithBangla</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396914/3396914_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-02T03:39:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Man From Uncle 01-03 session</video:title>
      <video:description>The Man from U.N.C.L.E. (br.: &quot;O Agente da UNCLE&quot;) é uma série de espionagem americana, criada pela Metro-Goldwyn-Mayer para ser exibida na televisão. A série foi ao ar de 1964 até 1968 na rede de televisão NBC, com 105 episódios de 60 minutos cada, totalizando quatro temporadas (a primeira foi em preto &amp; branco). O autor de James Bond, Ian Fleming contribuiu para a criação do show. Em 1966 foi lançada a série derivada The Girl from U.N.C.L.E.. #themanfromuncle</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396913/3396913_720p.mp4</video:content_loc>
      <video:duration>3006</video:duration>
      <video:publication_date>2026-09-02T03:39:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_22.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_22.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396912/3396912_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T03:39:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_21.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_21.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396911/3396911_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:38:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_20.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_20.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396910/3396910_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:38:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_19.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_19.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396909/3396909_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:38:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu sei dançar</video:title>
      <video:description>Pessoal eu gosto de dançar</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396908/3396908_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T03:38:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Música gospel | teu nome reina</video:title>
      <video:description>Teu Nome Reina | Rhema Uma canção de adoração que exalta o nome de Jesus e declara Sua presença, Seu poder e Sua soberania acima de todas as coisas. Quando tudo parece incerto, existe um nome que permanece. O nome de Jesus reina, transforma, restaura e traz esperança. 🙏 Que esta música seja uma oração para o seu coração e fortaleça sua fé. 🎵 Como Teu Nome Reina — Rhema #Música</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396907/3396907_720p.mp4</video:content_loc>
      <video:duration>189</video:duration>
      <video:publication_date>2026-09-02T03:37:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sou eu</video:title>
      <video:description>#eu</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396906/3396906_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:37:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Petanjo</video:title>
      <video:description>Um anjinho cachorro #Cachorro #petanjo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396905/3396905_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-02T03:37:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Live no Egito Antigo</video:title>
      <video:description>Egito #Egito #viral #fy #fyp</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396904/3396904_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-02T03:37:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What If Time Travel Were Possible? The Day Humanity Changed Forever</video:title>
      <video:description>Imagine waking up tomorrow and discovering that time travel is no longer science fiction. A machine capable of sending humans into the past or future could completely transform civilization. But changing history might come with consequences no one could predict. What would happen if someone traveled back in time and changed a single event? Could we create alternate timelines? Would it be possible to meet your younger self? And what if someone from the future came back with knowledge that could change the world? In this video, we explore one of humanity&apos;s greatest hypothetical possibilities and the scientific theories, paradoxes, and consequences surrounding time travel. ⏳ Could humans really travel through time? 🚀 What would happen if we could travel into the future? 🕰️ Could we change the past? 🧩 What is the grandfather paradox? 🌎 Could changing history create an alternate reality? 👁️ What if someone from the future visited us today? Time may be the one thing humanity cannot control. But what if, one day, we finally could? #timetravel #whatiftimetravelwerepossible #whatifwecouldtravelthroughtime #timetravelexplained #timetraveltheory #timemachine #timemachineexplained #travelingthroughtime #traveltothefuture #traveltothepast #timetravelscience #timetravelphysics #physicsoftimetravel #timeparadox #timetravelparadox #grandfatherparadox #bootstrapparadox #alternatetimeline #alternatetimelines #paralleluniverse #paralleluniverses #changingthepast #changinghistory #whatifwechangedhistory #futuretechnology #futureofhumanity #timetravelexperiment #timetravelpossibility #cantimetravelbepossible #istimetravelpossible #scienceoftimetravel #relativity #einsteintimetravel #spacetime #wormholes #wormholetimetravel #blackholesandtimetravel #futurecivilization #mysterioustimetravel #</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396903/3396903_720p.mp4</video:content_loc>
      <video:duration>415</video:duration>
      <video:publication_date>2026-09-02T03:36:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comida da Roça e Saúde: O Que a Alimentação Simples Pode Ensinar?/ Country-Style Food and Health: Wh</video:title>
      <video:description>Você já parou para pensar por que a comida da roça continua despertando tanta lembrança e curiosidade? 🌱🍲 Arroz, feijão, mandioca, milho, verduras, frutas e outros alimentos presentes na alimentação tradicional brasileira fazem parte de uma cultura alimentar baseada, muitas vezes, em alimentos naturais e preparações caseiras. Mas será que comida da roça é sinônimo de alimentação saudável? 🤔 Neste vídeo, vamos descobrir o que a alimentação tradicional pode nos ensinar sobre comida caseira, alimentos in natura, alimentação saudável e saúde — e também por que não basta apenas o alimento: a quantidade de sal, açúcar, óleo e a forma de preparo também fazem diferença. #AlimentacaoDaRocaComidaDaRocaComidaCaseiraAlimentacaoSaudavelAlimentosNaturaisComidaDeVerdadeSaudeAlimentacaoNatural</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396902/3396902_720p.mp4</video:content_loc>
      <video:duration>130</video:duration>
      <video:publication_date>2026-09-02T03:36:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>vidssave.com MAKE $100 to $500 WEEKLY WITH THIS NEW AI TRAINING COMPANY - WORKS IN AFRICA (NIGERIA)</video:title>
      <video:description>Link: https://cadquests.com/...​ This platform is similar to outlier where you perform task and get paid weekly…… just that this is a new platform and you work as an engineer by giving difference between each structure and solids. #viral #remotework #AItraining #weeklypayouts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396901/3396901_720p.mp4</video:content_loc>
      <video:duration>575</video:duration>
      <video:publication_date>2026-09-02T03:36:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alexia - Summer Is Crazy</video:title>
      <video:description>Alexia - Summer Is Crazy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396900/3396900_720p.mp4</video:content_loc>
      <video:duration>262</video:duration>
      <video:publication_date>2026-09-02T03:36:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aprendendo a ler</video:title>
      <video:description>Olha pessoal eu já to aprendendo a ler</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396899/3396899_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T03:36:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ela é a reencarnação do Rimuru Tempest?! Magia de gelo épica!</video:title>
      <video:description>When the Rimuru-style character crafts a perfect crystal cat, but copying the magic ends in a hilarious explosion! 🐱❄️ Enjoy this comedy scene in 2D anime. Like, comment, and share! #animeart #animation #rimurutempest #slimeanimevibes #crystalcat #icesculpture #magicfail #funnyexplosion #sootface #cuteanime #comedyanime #fantasyanime #schoolofmagic #trainingsession #bluehair #blindfold #whiteshirt #greyhair #shortgreyhair #purpleeyes #schooluniform #whitecoat #blackgloves #magiccube #iceblock #wintersetting #snowlandscape #glowingcrystals #particles #sparks #magicalenergy #funnyexpression #wideeyes #screaminganime #reactionface</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396898/3396898_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T03:36:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MANIFESTING WEALTH MUSIC with POWERFUL AFFIRMATIONS to ATTRACT MONEY, LUXURY, and QUICK FORTUNE 4</video:title>
      <video:description>Listen to the most powerful Wealth Manifestation Music you&apos;ve ever heard! This is your daily soundtrack for attracting abundant money, luxury, and rapid fortune. Tired of struggling? Use the power of your mind to manifest a millionaire and billionaire lifestyle. With powerful affirmations to attract wealth and high vibrations, you will reprogram your subconscious mind for financial success. #manifestmoney #lawofattraction #musictoattractmoney #positiveaffirmationsforwealth #attractmoneyurgently #musictomanifest #subliminalforwealth #subliminalformoney #mentalreprogrammingforwealth #frequencytoattractmoney #millionaire #billionaire #financialabundance #prosperity #quickfortune #musictomanifestwealth #lawofattractionmusic #wealth</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396897/3396897_720p.mp4</video:content_loc>
      <video:duration>135</video:duration>
      <video:publication_date>2026-09-02T03:36:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Very nice 41</video:title>
      <video:description>#Pakistani</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396896/3396896_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-02T03:35:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic prayers and supplications 3</video:title>
      <video:description>Islamic prayers and supplications</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396895/3396895_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:35:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>4- ZORRO - VELHO CONHECIDO</video:title>
      <video:description>Zorro é uma série de produção da Walt Disney baseado no herói mascarado, estreado em 10 de Outubro de 1957 no canal ABC. O final da série no canal foi em 2 de Junho de 1959. Foram produzidos 78 episódios, além de 4 especiais de uma hora que foram ao ar entre 30 de Outubro de 1960 e 2 de Abril de 1961 pela antologia de séries de televisão dos Estúdios Walt Disney. No Brasil, a série foi ao ar na TV Globo entre janeiro de 1973 e março de 1974. #zorro1959</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396894/3396894_720p.mp4</video:content_loc>
      <video:duration>2947</video:duration>
      <video:publication_date>2026-09-02T03:35:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI TABLE 3</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396893/3396893_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:35:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BOMBA A CASA CAIU</video:title>
      <video:description>BOMBA A CASA CAIU Moraes deve ser imediatamente afastada do STF #bomba #casa #moraes #afastado</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396892/3396892_720p.mp4</video:content_loc>
      <video:duration>613</video:duration>
      <video:publication_date>2026-09-02T03:35:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Simpsons - Prêmio De Natal</video:title>
      <video:description>Temporada 1 Episódio 1 #Desenho #osSimpsons</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396891/3396891_720p.mp4</video:content_loc>
      <video:duration>1431</video:duration>
      <video:publication_date>2026-09-02T03:35:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_18.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_18.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396890/3396890_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:35:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_17.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_17.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396889/3396889_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:35:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI TABLE 2</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396888/3396888_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T03:34:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 - ZORRO - Proposta de Casamento</video:title>
      <video:description>Zorro é uma série de produção da Walt Disney baseado no herói mascarado, estreado em 10 de Outubro de 1957 no canal ABC. O final da série no canal foi em 2 de Junho de 1959. Foram produzidos 78 episódios, além de 4 especiais de uma hora que foram ao ar entre 30 de Outubro de 1960 e 2 de Abril de 1961 pela antologia de séries de televisão dos Estúdios Walt Disney. No Brasil, a série foi ao ar na TV Globo entre janeiro de 1973 e março de 1974. #zoro1959</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396887/3396887_720p.mp4</video:content_loc>
      <video:duration>2943</video:duration>
      <video:publication_date>2026-09-02T03:34:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Outer Banks: Season 5 | Official Teaser</video:title>
      <video:description>🏝️ Outer Banks: Season 5 | Official Teaser | Series Finale The Pogues are back for one final adventure. 🌊🔥 After everything they&apos;ve been through, John B, Sarah, JJ, Kiara, Pope, and Cleo face their biggest challenge yet. Secrets will be revealed, friendships will be tested, and the search for one last treasure could change everything. Get ready for the final chapter of Outer Banks. 🎬 Outer Banks: Season 5 — The Series Finale #outerbanksseason5finale #outerbanksseason5finalereaction #outerbanksseason5finaleexplained #outerbanksfinalseason #outerbanksseason5finalbattle #outerbanksseason5finalfight #outerbanksseason5whykiaraownsthefinale #outerbanksseason5 #outerbanksseason4 #outerbanksseason2 #outerbanksseason3 #outerbanksfinale #outerbanksseason5jj #outerbanksseason5fight #season3outerbanks #season4outerbanks #outerbanksseason5ending #outerbanksseason4ending</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396886/3396886_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-02T03:34:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_16.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_16.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396885/3396885_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:34:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>✨ ASMR com sons de microfone bombeando ❤️ Sons relaxantes para um sono profundo 😴🌙</video:title>
      <video:description>✨ ASMR Mic Pumping ❤️ Relaxing Sounds for Deep Sleep 😴🌙 Get ready to relax, unwind, and drift into a peaceful state with this ASMR Mic Pumping experience. 🎧✨ Put on your headphones, turn down the lights, get comfortable, and let the gentle, soothing microphone sounds calm your mind and help you fall into a deep, relaxing sleep. 😴🌙 This video is perfect for anyone looking for ASMR sounds for sleep, stress relief, relaxation, tingles, and a peaceful nighttime experience. ❤️ 🎧 For the best ASMR experience, headphones are highly recommended! ✨ Perfect for: ❤️ Deep relaxation 😴 Falling asleep 🌙 Nighttime relaxation 🎧 ASMR tingles 💤 Better sleep 🧘 Stress and anxiety relief ✨ Satisfying and relaxing sounds Let the soft sounds surround you, clear your mind, and create the perfect atmosphere for rest. Close your eyes, breathe slowly, relax your body, and enjoy the experience. 🌙💤 🔔 Subscribe to the channel and turn on notifications for more relaxing ASMR videos, sleep sounds, satisfying triggers, and peaceful nighttime experiences. 💬 Comment below: What ASMR sound helps you relax and fall asleep the fastest? ❤️ #asmr #asmrmicpumping #micpumpingasmr #asmrforsleep #relaxingasmr #asmrsleep #deepsleepasmr #relaxingsounds #sleepsounds #asmrtriggers #asmrtingles #satisfyingasmr #satisfyingsounds #calmingsounds #soothingsounds #relaxingsoundsforsleep #deepsleepsounds #sleeprelaxation #bedtimeasmr #nighttimeasmr #asmrrelaxation #stressreliefasmr #anxietyreliefasmr #sleepaid #fallasleepfast #helpmesleep #peacefulsounds #gentleasmr #softsoundsasmr #microphoneasmr #micsounds #microphonesounds #asmrnotalking #notalkingasmr #immersiveasmr #tinglyasmr #sleeptriggers #relaxingvideo #sleepvideo #asmr2026</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396884/3396884_720p.mp4</video:content_loc>
      <video:duration>896</video:duration>
      <video:publication_date>2026-09-02T03:34:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orando pra dormir</video:title>
      <video:description>Meus amores orando pro papai do céu</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396883/3396883_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T03:34:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Silent Disease Killing Indoor Cats — And Hardly Anyone Notices</video:title>
      <video:description>DON&apos;T IGNORE THESE SIGNS! They could be linked to serious health issues, including kidney failure—a condition that can progress silently. In this video, you’ll discover the warning signs every owner needs to know and understand why spotting changes early can make a huge difference in your cat&apos;s life. 💔 Sometimes, a cat won&apos;t meow for help; its behavior simply changes. And you need to know how to spot that change. 👉 Watch until the end to find out what your cat might be trying to tell you before it’s too late. #kidneydiseaseincats #sickcatsymptoms #signsofillnessincats #felinekidneyfailure #catdrinkingalotofwater #cathealth #silentdiseasesincats #strangecatbehavior #catstoppingeating #catcare #catveterinarian #dangeroussymptomsincats #sadcatillness #interestingfactsaboutcats #darkcatchannel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396882/3396882_720p.mp4</video:content_loc>
      <video:duration>226</video:duration>
      <video:publication_date>2026-09-02T03:34:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BEBEU TODAS BATEU CAIU</video:title>
      <video:description>HOMEM BEBADO BEBEU TODAS CAIU</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396881/3396881_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T03:34:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI TABLE 1</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396880/3396880_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T03:34:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>আলুর গ্রাম তলিয়ে গেল!</video:title>
      <video:description>ভিডিওটি শেষ পর্যন্ত দেখুন এবং মজার মুহূর্তগুলো উপভোগ করুন। ভালো লাগলে লাইক, কমেন্ট ও শেয়ার করতে ভুলবেন না! 👍 ভিডিওটি ভালো লাগলে Like দিন 💬 আপনার মজার মন্তব্য করতে ভুলবেন না 🔔 এমন আরও ফানি ভিডিও পেতে Subscribe করুন</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396879/3396879_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-02T03:34:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI SASHIMI</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396878/3396878_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:33:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MÚSICA GOSPEL | O TEU NOME CURA</video:title>
      <video:description>O Teu Nome Cura | Rhema Uma canção de fé, esperança e entrega para aqueles momentos em que o coração precisa lembrar que ainda existe cura, força e paz. “O Teu Nome Cura” fala sobre o poder do nome de Jesus, sobre confiar mesmo em meio à dor e encontrar esperança quando tudo parece perdido. Uma mensagem de adoração profunda, feita para tocar o coração e fortalecer a fé. 🙏 Que essa música alcance quem precisa de consolo, renove sua esperança e lembre que você não está sozinho. 🎵 O Teu Nome Cura — Rhema ❤️ Ouça, compartilhe e permita que essa mensagem toque seu coração. #Músicagospel #músicaboa #música</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396877/3396877_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-09-02T03:33:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 - ZORRO - ADIOS EL CUCHILLO</video:title>
      <video:description>Zorro é uma série de produção da Walt Disney baseado no herói mascarado, estreado em 10 de Outubro de 1957 no canal ABC. O final da série no canal foi em 2 de Junho de 1959. Foram produzidos 78 episódios, além de 4 especiais de uma hora que foram ao ar entre 30 de Outubro de 1960 e 2 de Abril de 1961 pela antologia de séries de televisão dos Estúdios Walt Disney. No Brasil, a série foi ao ar na TV Globo entre janeiro de 1973 e março de 1974. #zorro1959</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396876/3396876_720p.mp4</video:content_loc>
      <video:duration>2942</video:duration>
      <video:publication_date>2026-09-02T03:33:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Te enseño como descargar Imágenes ISO Oficiales de Windows 10 y Windows 11!!!</video:title>
      <video:description>https://www.microsoft.com/es-es/software-download/windows11 https://www.microsoft.com/es-es/software-download/windows10 #Windows10 #Windows11 #ImágenesISOOficialesdeWindows #ISOOficialesdeWindows #IT #ITSupport</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396875/3396875_720p.mp4</video:content_loc>
      <video:duration>450</video:duration>
      <video:publication_date>2026-09-02T03:33:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>হে বোন আমি তোমাকে বলছি</video:title>
      <video:description>হে বোন আমি তোমাকে বলছি</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396874/3396874_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-02T03:33:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>STAR WARS ALTA REPÚBLICA   A PRIMEIRA MISSÃO DE VERNESTRA RWOH</video:title>
      <video:description>Canal de Star Wars https://www.youtube.com/channel/UCXyYnvfQgl3fLhNWJ1XYcFA #StarWars #jedi #HighRepublic #AltaRepublica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396873/3396873_720p.mp4</video:content_loc>
      <video:duration>206</video:duration>
      <video:publication_date>2026-09-02T03:33:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zorro (1959)</video:title>
      <video:description>Zorro é uma série de produção da Walt Disney baseado no herói mascarado, estreado em 10 de Outubro de 1957 no canal ABC. O final da série no canal foi em 2 de Junho de 1959. Foram produzidos 78 episódios, além de 4 especiais de uma hora que foram ao ar entre 30 de Outubro de 1960 e 2 de Abril de 1961 pela antologia de séries de televisão dos Estúdios Walt Disney. No Brasil, a série foi ao ar na TV Globo entre janeiro de 1973 e março de 1974. #zorro1959</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396872/3396872_720p.mp4</video:content_loc>
      <video:duration>3079</video:duration>
      <video:publication_date>2026-09-02T03:32:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Find the emoji 3</video:title>
      <video:description>Find the emoji #shorts #quiz #challengeemoji In this video, you&apos;ll find a mental and observational game where you have to spot different emojis among several similar ones. Invite your friends and play together. Let us know in the comments how many different emojis you found. #quiz #emojichallenge #emoji #game #findtheemoji</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396871/3396871_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T03:32:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>wds5uhgo98</video:title>
      <video:description>onht4xzwupp #kpkj7gc5dxs2</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396870/3396870_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-02T03:32:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>último beijo</video:title>
      <video:description>Aquele Último Beijo” 💋❤️ — Un último beso, una despedida que nunca terminó y un amor que sigue esperando el reencuentro. Una canción intensa para quienes todavía guardan en el corazón a ese amor que nunca pudieron olvidar. 🎶🔥 #ÚltimoBeijo #UltimoBeijo #ÚltimoBeijomúsica #UltimoBeijoletra #músicaÚltimoBeijo #músicabrasileira #músicaromântica #músicadeamor #amor #saudade #paixão #romance #beijo #coraçãopartido #separação #términoderelacionamento #cançãoromântica #músicaromânticabrasileira #músicasdeamor #Brazilianmusic #músicaemocional</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396869/3396869_720p.mp4</video:content_loc>
      <video:duration>314</video:duration>
      <video:publication_date>2026-09-02T03:32:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hardstyle Trance Hybrid</video:title>
      <video:description>Siente el impacto y la velocidad con esta pista instrumental que fusiona la emotividad del Trance con la potencia agresiva del Hardstyle. Diseñada con un intro corto y dinámico, esta producción destaca por sus sintetizadores supersaw envolventes, sus kicks distorsionados con pegada profunda y una mezcla estéreo balanceada óptima para equipos de sonido de alto rendimiento. Ideal para contenido de ritmo acelerado, entrenamiento (workout), gaming, deportes extremos y vídeos de alta energía. #HardstyleTranceMusicElectronicMusicHardstyleTranceEDMInstrumentalMusicStereoSoundHighEnergy</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396868/3396868_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-02T03:31:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Outer Banks: Season 4 | Official Teaser</video:title>
      <video:description>Outer Banks: Season 4 | Official Teaser 🌊🔥 The Pogues are back for their biggest adventure yet! Season 4 brings new mysteries, dangerous challenges, unexpected twists, and secrets that could change everything. As John B and his friends continue their journey, their friendship and loyalty will be tested like never before. 🎬 Watch the official teaser and get ready for Season 4 of Outer Banks! #OuterBanks #Season4 #OfficialTeaser #Netflix #Pogues #JohnB #adventure #mystery #treasurehunt #teendrama #TVseriesouterbanks #outerbankscast #outerbanks2026 #cleoouterbanks #outerbanksscene #outerbanksrecap #outerbanksedits #outerbanksfunny #outerbanksteaser #outerbanksscenes #outerbanksseries #outerbanksending #outerbanksseason5 #outerbankstrailer #outerbanksseason4 #outerbanksnetflix #netflixouterbanks #trailerouterbanks #outerbanksseason6 #outerbankssaison5 #outerbanksseason3 #outerbankstrailer1 #outerbankstheories #outerbanksbloopers #outerbanksspoilers #outerbanksouttakes #outerbanksreaction</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396867/3396867_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-02T03:31:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Live no Titanic</video:title>
      <video:description>Live #Titanic #viral #fy</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396866/3396866_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-02T03:31:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fique por dentro das novidades</video:title>
      <video:description>Futuro presidente em campanha #Flavio #pl #22 #democracia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396865/3396865_720p.mp4</video:content_loc>
      <video:duration>139</video:duration>
      <video:publication_date>2026-09-02T03:31:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MULHER É PRESA ACUSADA DE GOLPES CONTRA ÍDOSO</video:title>
      <video:description>Uma MULHER FOI PRESA ACUSADA DE GOLPES CONTRA ÍDOSO ÉM SANTA MARIA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396864/3396864_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T03:31:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alexia - Me And You</video:title>
      <video:description>Alexia - Me And You</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396863/3396863_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-09-02T03:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396862</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396862/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, O ANJO DA MORTE.</video:title>
      <video:description>Louvor gospel #Louvor #gospel #brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396862/3396862_720p.mp4</video:content_loc>
      <video:duration>1751</video:duration>
      <video:publication_date>2026-09-02T03:30:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Engraçado 25</video:title>
      <video:description>Latindo como um cachorro. #Manaus-AM</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396861/3396861_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T03:30:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Find the emoji 2</video:title>
      <video:description>Find the emoji #shorts #quiz #challengeemoji In this video, you&apos;ll find a mental and observational game where you have to spot different emojis among several similar ones. Invite your friends and play together. Let us know in the comments how many different emojis you found. #quiz #game #emojichallenge #puzzle #quizzes #findtheemoji</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396860/3396860_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:30:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_15.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_15.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396859/3396859_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:30:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trilha 3</video:title>
      <video:description>Lindo lugar #Natureza #rios #paisagem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396858/3396858_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-02T03:30:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atisarte</video:title>
      <video:description>Fazendo um almoço</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396857/3396857_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T03:30:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Live no primeiro pouso na Lua</video:title>
      <video:description>Live #Moom</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396856/3396856_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T03:30:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Outer Banks Season 3 | Official Teaser</video:title>
      <video:description>Outer Banks Season 3 | Official Teaser 🌊🔥 The Pogues are back for a new adventure! After everything they’ve been through, John B and his friends face new challenges, dangerous enemies, and shocking secrets. Their journey takes them farther than ever as they search for answers and fight to stay together. 🎬 Watch the official teaser and get ready for Season 3 of Outer Banks! #OuterBanks #Season3 #OfficialTeaser #Netflix #Pogues #JohnB #adventure #treasurehunt #mystery #teendrama #TVseriesouterbanks #outerbankscast #outerbanks2026 #cleoouterbanks #outerbanksscene #outerbanksrecap #outerbanksedits #outerbanksfunny #outerbanksteaser #outerbanksscenes #outerbanksseries #outerbanksending #outerbanksseason5 #outerbankstrailer #outerbanksseason4 #outerbanksnetflix #netflixouterbanks #trailerouterbanks #outerbanksseason6 #outerbankssaison5 #outerbanksseason3 #outerbankstrailer1 #outerbankstheories #outerbanksbloopers #outerbanksspoilers #outerbanksouttakes #outerbanksreaction</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396855/3396855_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-02T03:30:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_14.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_14.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396853/3396853_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-02T03:29:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neon Fade Society – In This Heartbeat (Official Music Vídeo) | (Nostalgic Synthpop Visual)</video:title>
      <video:description>Neon Fade Society presents In This Heartbeat, an original nostalgic synthpop track inspired by the echoes of the 1980s. This visual dives into analog textures, broken signals, and emotions frozen in time — a late-night journey where every beat carries a memory that feels familiar, even if it never truly happened. Blending melancholic melodies, atmospheric synths, and subtle retro aesthetics, In This Heartbeat is made for night drives, quiet moments, and those who feel connected to the past through sound. 🎧 Genre: Synthpop / Retro Electronic 🌌 Mood: Nostalgic, Melancholic, Atmospheric 📺 Visual style: Analog, VHS, Cinematic If this song feels familiar, it’s because you’ve been here before. 🔔 Subscribe for more nostalgic synthpop visuals and original music. #NeonFadeSociety #InThisHeartbeat #Synthpop #80sSynthpop #NostalgicMusic #RetroSynthpop #MelancholicMusic #NightDriveMusic #LateNightVibes #VHSaesthetic #AnalogAesthetic #cinematicmusic Available soon on Spotify, Apple Music and all platforms. Listen to Spotify: https://open.spotify.com/intl-pt/album/0IDiE7LzxMrj4DGuC4mUv2?si=Mt7KAe_3TlWZVYUNwfHt_w © 2026 Neon Fade Society. All rights reserved. Original music and visuals. #inthisheartbeat #synthpop #nostalgicsynthpop #80ssynthpop #retrosynthpop #analogsynthpop #melancholicsynthpop #dreamysynthpop #atmosphericsynthpop #nostalgicelectronicmusic #nightdrivemusic #latenightmusic #synthpopmusicvideo #retromusicvideo #VHSaesthetic #analogaesthetic #cinematicsynthpop #indiesynthpop #undergroundsynthpop #darksynthpop #minimalsynthpop #retroelectronicmusic #nostalgicvisuals #80s #retrowave #synthwave #NeonFadeSociety</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396852/3396852_720p.mp4</video:content_loc>
      <video:duration>255</video:duration>
      <video:publication_date>2026-09-02T03:29:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dois magos travando uma batalha épica, transformados em leão de fogo e águia gigante</video:title>
      <video:description>Dois magos travando uma batalha épica, transformados em leão de fogo e águia gigante... e eu só ali no canto comendo minha banana. 🍌🔥🦅</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396851/3396851_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-02T03:29:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O que não serve, descarte ...</video:title>
      <video:description>As vezes, uma palavra basta, na hora certa e da pessoa certa. #Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396850/3396850_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-02T03:29:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ruth Star cantando em casa</video:title>
      <video:description>Tarde boa cantando e encantando</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396849/3396849_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-09-02T03:29:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Navio lançado ao mar</video:title>
      <video:description>Varips navios jogados ao mar veja e compartilha se voce gpstou. #Navio #mar #oceanos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396848/3396848_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T03:29:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SEM ENERGIA ELÉTRICA</video:title>
      <video:description>Está faltando ENERGIA ELÉTRICA em Cruz DAS ALMAS bahia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396847/3396847_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-02T03:29:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>saudade louca</video:title>
      <video:description>Saudade Louca” 💔🎶 — Hay amores que se van, pero nunca abandonan el corazón. Una canción de nostalgia, pasión y esperanza para quien todavía espera ese regreso. ❤️‍🔥 #SaudadeLouca #SaudadeLoucamúsica #SaudadeLoucaletra #músicaSaudadeLouca #músicabrasileira #músicaromântica #músicadeamor #saudade #amor #paixão #romance #coraçãopartido #músicadesaudade #cançãoromântica #músicaromânticabrasileira #músicasdeamor #Brazilianmusic #músicaemocional #músicaparacasal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396846/3396846_720p.mp4</video:content_loc>
      <video:duration>297</video:duration>
      <video:publication_date>2026-09-02T03:29:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vitamina de morango com banana e mel 🍯</video:title>
      <video:description>Vitamina saudável e Fitness , simples, saborosa e fácil de fazer.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396845/3396845_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T03:28:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI SALMON AND TUNA</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396844/3396844_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:28:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alexia - Number One 1996</video:title>
      <video:description>Alexia -Number One 1996</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396843/3396843_720p.mp4</video:content_loc>
      <video:duration>227</video:duration>
      <video:publication_date>2026-09-02T03:28:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bom dia 15</video:title>
      <video:description>Bom dia #Bomdia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396842/3396842_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-02T03:28:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O MALUQUEIRO INVADIU O MARACANÃ COM O BRASIL 🤣🇧🇷</video:title>
      <video:description>O Brasil é isso aqui! 🇧🇷 Alegria, futebol e povo na rua! Tamo junto na caminhada. Qual música não pode faltar na torcida? 👇</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396841/3396841_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:27:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_13.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_13.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396840/3396840_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T03:27:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Família é o alicerce</video:title>
      <video:description>Frases motivacionais #Deusérei</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396839/3396839_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-02T03:27:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O primeiro milagre de JESUS</video:title>
      <video:description>Uma trilha sonora perfeita para acompanhar seus momentos de estudo, leitura ou aquela pausa tranquila no fim do dia. Pegue sua xícara de café, deixe o som rolar e relaxe. Se curtiu a atmosfera, se inscreve no canal para mais videos semanais! #Brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396838/3396838_720p.mp4</video:content_loc>
      <video:duration>259</video:duration>
      <video:publication_date>2026-09-02T03:27:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_12.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_12.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396837/3396837_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T03:27:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Outer Banks Season 2 | Official Trailer</video:title>
      <video:description>Outer Banks Season 2 | Official Trailer 🌊🔥 The Pogues are back for another thrilling adventure! Season 2 brings new mysteries, dangerous enemies, unexpected twists, and an even bigger treasure hunt. As John B and his friends fight to uncover the truth, their loyalty and friendship will be put to the ultimate test. 🎬 Watch the official trailer and get ready for Season 2 of Outer Banks! #OuterBanks #Season2 #OfficialTrailer #Netflix #Pogues #JohnB #treasurehunt #adventure #mystery #teendrama #TVseriesouterbanks #outerbankscast #outerbanks2026 #cleoouterbanks #outerbanksscene #outerbanksrecap #outerbanksedits #outerbanksfunny #outerbanksteaser #outerbanksscenes #outerbanksseries #outerbanksending #outerbanksseason5 #outerbankstrailer #outerbanksseason4 #outerbanksnetflix #netflixouterbanks #trailerouterbanks #outerbanksseason6 #outerbankssaison5 #outerbanksseason3 #outerbankstrailer1 #outerbankstheories #outerbanksbloopers #outerbanksspoilers #outerbanksouttakes #outerbanksreaction</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396836/3396836_720p.mp4</video:content_loc>
      <video:duration>127</video:duration>
      <video:publication_date>2026-09-02T03:27:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Go Ahead EP1 | Starring: Tan Songyun, Song Weilong, Zhang Xincheng| Romantic Comedy Drama</video:title>
      <video:description>Go Ahead EP1 | Starring: Tan Songyun, Song Weilong, Zhang Xincheng| Romantic Comedy Drama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396835/3396835_720p.mp4</video:content_loc>
      <video:duration>2626</video:duration>
      <video:publication_date>2026-09-02T03:27:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Os coveiros</video:title>
      <video:description>Amigos que se junta na suas horas de almoço e se diverti entre eles #Bilhares🎱</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396834/3396834_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-09-02T03:27:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orla de Olinda, Pernambuco | Passeio de Carro – Brazil Driving Tour</video:title>
      <video:description>Passeio de carro pela Orla de Olinda, em Pernambuco, Brasil. Imagens gravadas em 2024, mostrando o litoral, as ruas e o movimento da região. Driving tour along the coast of Olinda, Pernambuco, Brazil. Recorded in 2024, showing the coastline, streets and everyday traffic in the area. #Olinda #Pernambuco #Brazil #Brasil #drivingtour #coastaldrive #OrladeOlinda #Recife #viagem #turismo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396833/3396833_720p.mp4</video:content_loc>
      <video:duration>1019</video:duration>
      <video:publication_date>2026-09-02T03:27:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, NOS TEUS PÁTIOS.</video:title>
      <video:description>Louvor gospel #Louvor #gospel #brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396832/3396832_720p.mp4</video:content_loc>
      <video:duration>193</video:duration>
      <video:publication_date>2026-09-02T03:27:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AVALANCHE NO NEPAL</video:title>
      <video:description>AVALANCHE de lama causa DESTRUIÇÃO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396831/3396831_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-09-02T03:26:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Find the emoji</video:title>
      <video:description>Find the emoji #shorts #quiz #challengeemoji In this video, you&apos;ll find a mental and observational game where you have to spot different emojis among several similar ones. Invite your friends and play together. Let us know in the comments how many different emojis you found. #quiz #emoji #quistime #puzzle #game</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396830/3396830_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:26:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396829</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396829/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus tá voltando</video:title>
      <video:description>Ele estava exilado numa ilha, sozinho e esquecido pelo mundo. Aí os céus se abriram. 😳🔥 &quot;Não tenha medo. Eu sou o Primeiro e o Último.&quot; Isso muda tudo. 🙏 #worship #atmospheric #prophetic #slowbuild #pianoandpads #cinematic #contemporarychristian #ethereal #powerfulvocalsEmportuguês #resumido</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396829/3396829_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-02T03:26:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dam Naal Dam Naal lyrics Song</video:title>
      <video:description>Presenting &quot;Dam Naal Dam Naal&quot; - A Heart Touching Punjabi Lofi Song that will make you feel the pain of true love. Jadon yaad teri aundi ae, dam naal dam rukk jaanda ae... 🎧 Use Headphones for Best Experience 🎧 Song Credits: Song: Dam Naal Dam Naal Singer / Lyrics: [Tera Naam Daal De] Music: Lofi Mix Video: Label: Lyrics: Dam naal dam naal yaad teri... [Apne 2-3 lines yahan daal de] --- #damnaaldamnaal #punjabisong #lofisong #sadsong #punjabilofi #heartbreak #pratikmusic Disclaimer: This is an original composition. All rights reserved. Video link :- https://www.febspot.com/video/3396722 Like | Share | Follow ❤️ #Sadlove</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396828/3396828_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-02T03:26:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI PLATE 2</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396827/3396827_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:26:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Tomorrow People (1973) - S01E05 - The Slaves of Jedikiah, Part 5</video:title>
      <video:description>The Tomorrow People é uma série de televisão britânica de ficção científica infantil criada por Roger Price. Produzida pela Thames Television para a ITV Network, a série foi ao ar pela primeira vez de 30 de abril de 1973 a 19 de fevereiro de 1979. A música tema foi composta pelo compositor australiano Dudley Simpson. #TheTomorrowPeople1973</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396826/3396826_720p.mp4</video:content_loc>
      <video:duration>1448</video:duration>
      <video:publication_date>2026-09-02T03:25:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>amór eterno</video:title>
      <video:description>Amor Eterno” ❤️🎶 — Un amor que desafía la distancia, el tiempo y cualquier despedida. Una canción para quienes todavía esperan, recuerdan y creen que el verdadero amor nunca muere. ✨ #AmorEterno #AmorEternomúsica #AmorEternoletra #músicaAmorEterno #músicabrasileira #músicaromântica #músicadeamor #amorverdadeiro #saudade #paixão #romance #cançãodeamor #músicaromânticabrasileira #músicasdeamor #músicaparacasal #Brazilianmusic #músicaemocional #músicaapaixonada</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396825/3396825_720p.mp4</video:content_loc>
      <video:duration>342</video:duration>
      <video:publication_date>2026-09-02T03:25:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby koala with mum</video:title>
      <video:description>#Babykoalawithmum</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396824/3396824_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-02T03:25:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Wish You Stayed 💔 | Emotional Heartbreak Lofi Song — Lofi Man</video:title>
      <video:description>Sometimes love doesn&apos;t end because people stop caring. Sometimes two people simply reach a moment they can&apos;t fix. “I Wish You Stayed” is an original emotional heartbreak lofi song about the night two people say goodbye, even though neither of them truly wants to leave. For everyone who has ever watched someone they love walk away. 🎧 Lofi Man — Music for the moments words can&apos;t explain. ❤️ Previous chapter: “You Were My Home” Subscribe for new original songs every week. Music and visual elements created with the assistance of generative AI under original creative direction for Lofi Man. #LofiMan #lofimusic #romanticsongs #lovesongs #sadsongs #emotionalmusic #relaxingmusic #chillmusic #originalsongs #aimusic #músicasromânticas #músicasdeamor #músicastristes #músicasemocionantes #músicagospel #louvor #músicasparaorar #músicasparadormir #músicaspararelaxar #músicaparamadrugada #heartbreaksongs #lovemusic #christianmusic #gospelsongs #relaxingsongs #animelofi #lofigirl #relax</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396823/3396823_720p.mp4</video:content_loc>
      <video:duration>302</video:duration>
      <video:publication_date>2026-09-02T03:24:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um.momento.de.fe 3</video:title>
      <video:description>Assistir e compartilhar amigos #Deus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396822/3396822_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-02T03:24:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Tomorrow People (1973) - S01E04 - The Slaves of Jedikiah, Part 4.</video:title>
      <video:description>The Tomorrow People é uma série de televisão britânica de ficção científica infantil criada por Roger Price. Produzida pela Thames Television para a ITV Network, a série foi ao ar pela primeira vez de 30 de abril de 1973 a 19 de fevereiro de 1979. A música tema foi composta pelo compositor australiano Dudley Simpson. #TheTomorrowPeople1973</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396821/3396821_720p.mp4</video:content_loc>
      <video:duration>1384</video:duration>
      <video:publication_date>2026-09-02T03:24:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I need romance ep 2</video:title>
      <video:description>#Ineedromance</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396820/3396820_720p.mp4</video:content_loc>
      <video:duration>2750</video:duration>
      <video:publication_date>2026-09-02T03:24:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Awesome catch.</video:title>
      <video:description>#Awesomecatch</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396819/3396819_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T03:24:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI HOT PHILADELPHIA</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396818/3396818_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:24:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fique por dentro dos acontecimentos</video:title>
      <video:description>Foi profetizado nessa terra de cristão que ele faria isso. André Mendonça vai colocar o país nos eixos de novo. #Crê #juiz #igreja #fé #divino #profecia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396817/3396817_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-02T03:24:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_11.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_11.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396816/3396816_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T03:23:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CANTICOS CCB COLETÂNIA DE BELOS HINOS</video:title>
      <video:description>CANTICOS CCB COLETÂNIA DE BELOS HINOS #flautapanccb #hinoccbflautapan #hinosccbflautapan #ccbflautapan #hinosccbparadormirtelapreta #hinosflautapan #hinosccbparadormir #hinosccbflautaboliviana #hinoflautapan #flautaboliviana #hinosccb #hinoccbparadormir #ccbhinostocados #hinosccbflauta #ccbflautaboliviana #hinostocadoscomflauta #hinosflautaccb #hinosflautapanbolivianaccb #hinoparadormirccb #musicaparadormir #flautaindigenatelapreta #flautaccb #CCB</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396815/3396815_720p.mp4</video:content_loc>
      <video:duration>1664</video:duration>
      <video:publication_date>2026-09-02T03:23:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396814</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396814/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI dragon fruit</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396814/3396814_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T03:23:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Tomorrow People (1973) - S01E02 - The Slaves of Jedikiah, Part 2.</video:title>
      <video:description>Traduzido do inglês-The Tomorrow People é uma série de televisão britânica de ficção científica infantil criada por Roger Price. Produzida pela Thames Television para a ITV Network, a série foi ao ar pela primeira vez de 30 de abril de 1973 a 19 de fevereiro de 1979. A música tema foi composta pelo compositor australiano Dudley Simpson. #TheTomorrowPeople1973</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396813/3396813_720p.mp4</video:content_loc>
      <video:duration>1469</video:duration>
      <video:publication_date>2026-09-02T03:23:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVORES TRAPS GOSPEL.</video:title>
      <video:description>Louvores gospel. #Louvores #traps #gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396812/3396812_720p.mp4</video:content_loc>
      <video:duration>766</video:duration>
      <video:publication_date>2026-09-02T03:23:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neymar ou cr7</video:title>
      <video:description>Brabos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396811/3396811_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T03:23:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sonhos poesia</video:title>
      <video:description>Poesia acústica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396810/3396810_720p.mp4</video:content_loc>
      <video:duration>146</video:duration>
      <video:publication_date>2026-09-02T03:23:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VikingGuy Clips Hunt:ShowDownBR</video:title>
      <video:description>Clipes dos Streamers de Hunt:ShowDown do Brasil, Obrigado a toda a comunidade vocês são pessoas incríveis, aqueles que ainda não apareceram aguardem que teremos mais clips em breve #games #jogos #huntshowdown #fps #pc #jogodetiro #zumbis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396809/3396809_720p.mp4</video:content_loc>
      <video:duration>869</video:duration>
      <video:publication_date>2026-09-02T03:23:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alimentação e Fertilidade/ Diet and Fertility</video:title>
      <video:description>A alimentação pode ter relação com a saúde reprodutiva? Neste vídeo, você vai entender como a alimentação e a fertilidade podem estar relacionadas e quais hábitos alimentares vêm sendo estudados pela ciência em relação à fertilidade feminina e masculina. #FertilidadeAlimentacaoEFertilidadeInfertilidade</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396808/3396808_720p.mp4</video:content_loc>
      <video:duration>88</video:duration>
      <video:publication_date>2026-09-02T03:22:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>432 Hz: The Forbidden Frequency That Could Change the Way You Hear Music</video:title>
      <video:description>What is so mysterious about 432 Hz? Some people call it the “forbidden frequency” and claim that music tuned to 432 Hz has unique effects on the human body, the mind, and even our connection with nature. Others argue that these claims are based more on internet myths than scientific evidence. So what is actually true? In this video, we explore the fascinating history of 432 Hz, the debate surrounding musical tuning, the claims about its effects on the brain and body, and why this particular frequency has become the center of so many theories. 🎵 Why is 432 Hz considered special? 🧠 Does 432 Hz really affect the brain differently? 🌌 Is there a connection between 432 Hz and nature? 📜 Where did the “forbidden frequency” theory come from? 🔬 What does science actually say? 👁️ Is 432 Hz truly different — or is the mystery something else? Behind the music lies a fascinating debate between ancient traditions, modern science, and one of the internet&apos;s most intriguing theories. Is 432 Hz really a hidden frequency… or one of the greatest musical myths of our time? #432hz #432hzfrequency #432hzmusic #432hzfrequencyexplained #432hzbenefits #432hzhealingfrequency #432hzhealing #432hzmeditation #432hzvs440hz #440hzvs432hz #432hztuning #432hzmusicfrequency #forbiddenfrequency #432hzforbiddenfrequency #theforbiddenfrequency #secretfrequency #hiddenfrequency #healingfrequencies #frequencyhealing #soundhealing #soundfrequencies #musicfrequencies #frequencyofmusic #powerofsound #poweroffrequency #frequencyandbrain #432hzbrain #432hzscience #432hzscientificevidence #432hzexperiment #432hzeffects #effectsof432hz #432hznature #432hzuniverse #432hzancienthistory #ancientfrequencies #mysteriousfrequencies #frequencymysteries #musicmystery #soundmystery #432hzconspiracy #frequencyconspiracy #432hz</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396807/3396807_720p.mp4</video:content_loc>
      <video:duration>457</video:duration>
      <video:publication_date>2026-09-02T03:22:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TESTE 2</video:title>
      <video:description>#TESTESUSTO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396806/3396806_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-02T03:22:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI BOAT</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396805/3396805_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:22:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onde ESTÃO Eles</video:title>
      <video:description>✨ Onde Será Que Eles Estão? ✨ Prepare-se para uma história de mistério que vai prender sua atenção do início ao fim. Amanda, uma mãe dedicada e esposa amorosa, acorda em um dia aparentemente comum no paradisíaco arquipélago do Havaí, mas descobre que sua família desapareceu sem deixar rastros. 🕵️‍♀️ Enquanto busca desesperadamente por respostas, segredos começam a emergir, transformando sua vida em uma espiral de incertezas e revelações assustadoras. Será que Amanda está perdendo a sanidade, ou há algo mais sombrio por trás de tudo isso? 🌟 Descubra nesta emocionante história: Um desaparecimento inexplicável. Uma mãe disposta a tudo para encontrar respostas. Mistérios que desafiam a lógica e a razão. Um final surpreendente que vai te deixar sem palavras. 📌 &quot;Onde Será Que Eles Estão&quot; é mais do que uma narrativa. É uma viagem emocional repleta de suspense, conexões humanas e momentos de tirar o fôlego. #históriademistério #desaparecimentoinexplicável #conexõeshumanas #eventossobrenaturais #misterio #suspense #desaparecimento #históriasdemistério #suspensepsicológico #mistériosnãoresolvidos #lendasurbanasdeterror</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396804/3396804_720p.mp4</video:content_loc>
      <video:duration>1294</video:duration>
      <video:publication_date>2026-09-02T03:22:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Tomorrow People (1973) - S01E01 - The Slaves of Jedikiah, Part 1</video:title>
      <video:description>Traduzido do inglês-The Tomorrow People é uma série de televisão britânica de ficção científica infantil criada por Roger Price. Produzida pela Thames Television para a ITV Network, a série foi ao ar pela primeira vez de 30 de abril de 1973 a 19 de fevereiro de 1979. A música tema foi composta pelo compositor australiano Dudley Simpson. #TheTomorrowPeople1973</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396803/3396803_720p.mp4</video:content_loc>
      <video:duration>1415</video:duration>
      <video:publication_date>2026-09-02T03:21:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI 3</video:title>
      <video:description>SUSHI, FOOD, SUSHI, SEAFOOD #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396802/3396802_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:21:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um.momento.de.fe 2</video:title>
      <video:description>Obrigado Deus #Deusémaravilhoso</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396801/3396801_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-02T03:21:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>All of Us Are Dead | 지금 우리 학교는 -  시즌 2 발표</video:title>
      <video:description>All of Us Are Dead | 지금 우리 학교는 - 시즌 2 발표 #AllofUsAreDead #지금우리학교는-시즌2발표</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396800/3396800_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-02T03:21:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rihanna - Umbrela</video:title>
      <video:description>Rihanna - Umbrela</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396799/3396799_720p.mp4</video:content_loc>
      <video:duration>254</video:duration>
      <video:publication_date>2026-09-02T03:21:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Breaded Shrimp</video:title>
      <video:description>Breaded Shrimp #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396798/3396798_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:20:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SUSHI PLATE 1</video:title>
      <video:description>Sushi Bar, Lunch,Meal, Appetizer, Seaweed, Freshness, Food, Gourmet,Salmon, Seafood,Prawn, Seafood, Tempura,Japanese Food,East Asian Culture,Soy Sauce,Vegetable, Asian Food,Lunch Box, Yakisoba, Pitaya, Nori, Maki Sushi,Healthy Eating #TRAVEL #TOURISM #PLACES #FOOD #SUSHI #SEAFOOD</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396797/3396797_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:20:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Park Maniac</video:title>
      <video:description>Legends Based on Fact #Legends</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396796/3396796_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-02T03:20:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396795</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396795/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MINHA PRIMEIRA GAMEPLAY COMPLETA no Might &amp; Magic Fates – Deck Necrópole Funciona?</video:title>
      <video:description>Minha primeira gameplay para o canal, bora começar. Se gostou do vídeo, não esquece de se inscrever no canal, deixar seu like e ativar as notificações para ser avisado de quando tiver vídeos novos. Quer saber o que mais estou fazendo ou jogando, clique no link: https://sites.google.com/view/emersonmop/home Em breve muitas novidades, não só no canal......... Foi até fácil de ganhar, porém tem que se usar de muita estratégia nas partidas. Mas em breve estarei fazendo live no Youtube e Twitch #mightandmagicfates</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396795/3396795_720p.mp4</video:content_loc>
      <video:duration>662</video:duration>
      <video:publication_date>2026-09-02T03:20:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quase anjos</video:title>
      <video:description>Caso Angeles #CasiAngeles</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396794/3396794_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-02T03:20:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, EXERCITO DE UM ANJO SÓ.</video:title>
      <video:description>Louvor gospel. #Louvor #gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396793/3396793_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-09-02T03:19:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MEDO SUSTO</video:title>
      <video:description>#MEDOSUSTOCOMCOBRA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396792/3396792_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T03:19:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As 24 Lições de Thomas Edison para o Sucesso Pessoal e a Autossuperação</video:title>
      <video:description>Descubra como Thomas Edison, um dos maiores inventores da história, usou criatividade, autoconfiança e disciplina para superar obstáculos, transformar ideias em inovação e alcançar o sucesso. Neste vídeo, exploramos histórias inspiradoras, curiosidades e frases motivacionais que revelam os segredos do seu mindset empreendedor e a importância de manter a motivação diária, energia e uma mentalidade de vitória. Aprenda estratégias de sucesso, como vencer desafios, desenvolver hábitos poderosos e transformar sua visão de futuro, seja na vida, nos estudos ou nos negócios. Se você busca inspiração, dicas para mudar seu mindset, ou deseja entender como grandes milionários e bilionários pensam, este vídeo é para você! Inscreva-se no canal, ative as notificações e comece hoje a construir a sua própria história de sucesso! #ThomasEdison #LiçõesdeThomasEdison #SucessoPessoal #Autossuperação #DesenvolvimentoPessoal #MentalidadedeSucesso #Motivação #Inspiração #Resiliência #Produtividade #HábitosdeSucesso #FrasesdeThomasEdison #BiografiaThomasEdison #CrescimentoPessoal #Empreendedorismo #Inovação #FocoeDisciplina #SuperaçãodeDesafios #LiçõesdeVida #Sabedoria #MindsetdeCrescimento #Determinação #Criatividade #Liderança</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396791/3396791_720p.mp4</video:content_loc>
      <video:duration>602</video:duration>
      <video:publication_date>2026-09-02T03:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um.momento.de.fe</video:title>
      <video:description>#Deus abençoe #Deuséfiel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396790/3396790_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-02T03:18:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Ilha do Perigo (1968) Dublado</video:title>
      <video:description>A história acompanha um grupo de arqueólogos no Pacífico Sul — o Dr. Irwin Hayden (Frank Aletter), sua filha Leslie (Ronne Troup) e o assistente Link Simmons (Jan-Michael Vincent). Eles buscam a cidade perdida de Tobanya e o irmão desaparecido do doutor, enfrentando piratas modernos e tribos hostis com a ajuda de um nativo chamado Chongo (Kim Kahana) #Thedangerisland</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396789/3396789_720p.mp4</video:content_loc>
      <video:duration>2599</video:duration>
      <video:publication_date>2026-09-02T03:18:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prettylittleliars 2</video:title>
      <video:description>Maldosas #Prettylittleliars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396788/3396788_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-02T03:18:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>According to legend, not even the earth accepted him. #short s</video:title>
      <video:description>Legend has it that not even the earth would accept him #fyp “There is a creature that, legend has it, not even the earth would accept. His name was *Corpo Seco* (The Dried-Up Body). They say that after he died, he began to wander among the trees and cemeteries, looking for anyone who might cross his path.” #fyp , #Mod, #TalesAndCordel, #UrbanLegends, #HorrorStories, #ScaryStories, #BrazilianLegends, #BrazilianFolklore, #Folktales, #HorrorTales, #MysteriousStories, #Mysteries, #Horror, #Suspense, #StoriesOfBrazil, #LegendsOfBrazil, #BrazilianTales, #Cordel, #CordelLiterature, #BrazilianCulture, #SupernaturalStories, #MysteriousCases, #RuralLegends, #RuralStories, #BrazilianHorror, #Folklore, #FolkloreCreatures, #ContosECordelOficial #fyp #Mod #show #reels #cowgirl #instagram #love #caipira #amor #explore #explorar #pecuaria #cavalo #roça #cavalgada #vaquejada #rock #horse #farm #samba #modao #bruto #música #cavalos #brazil #campo #nordeste #foryou #festa #cantor #forró #sertanejo #modasertaneja #sofrencia #musicasertaneja #saudade #lancamento #sertanejoraiz #historiasdeterror #relatosdeterror #relatosdehorror #oscuro #sectordelterror</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396787/3396787_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-02T03:18:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alice deejay- Better off Alone</video:title>
      <video:description>Alice deejay-Better off Alone</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396786/3396786_720p.mp4</video:content_loc>
      <video:duration>175</video:duration>
      <video:publication_date>2026-09-02T03:18:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MORTAL</video:title>
      <video:description>#meninodandomortal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396785/3396785_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T03:17:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soyluna</video:title>
      <video:description>Sou luna #Souluna</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396784/3396784_720p.mp4</video:content_loc>
      <video:duration>276</video:duration>
      <video:publication_date>2026-09-02T03:17:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌟 Believe in Yourself — Acredite em Você</video:title>
      <video:description>A motivational message about staying strong, trusting the process, and continuing forward even when results take time. Believe in yourself, keep moving, and never give up. #motivation #motivationalvideo #keepgoing #nevergiveup #success #mindset #selfimprovement #discipline #perseverance #inspiration #positivemindset #believeinyourself #personalgrowth #dailymotivation #motivationquotes</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396783/3396783_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-02T03:17:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Outer Banks Season 1 - Trailer</video:title>
      <video:description>Outer Banks Season 1 Trailer 🌊🔥 Follow a group of teenagers as they uncover secrets, chase hidden treasure, and get caught up in an unforgettable adventure along the Outer Banks. Mystery, friendship, romance, and danger await. 🎬 Watch the trailer and discover the world of Outer Banks! #OuterBanks #Season1 #trailer #Netflix #Pogues #treasurehunt #adventure #mystery #teendrama #TVseriesouterbanks #outerbankscast #outerbanks2026 #cleoouterbanks #outerbanksscene #outerbanksrecap #outerbanksedits #outerbanksfunny #outerbanksteaser #outerbanksscenes #outerbanksseries #outerbanksending #outerbanksseason5 #outerbankstrailer #outerbanksseason4 #outerbanksnetflix #netflixouterbanks #trailerouterbanks #outerbanksseason6 #outerbankssaison5 #outerbanksseason3 #outerbankstrailer1 #outerbankstheories #outerbanksbloopers #outerbanksspoilers #outerbanksouttakes #outerbanksreaction</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396782/3396782_720p.mp4</video:content_loc>
      <video:duration>162</video:duration>
      <video:publication_date>2026-09-02T03:17:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396781</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396781/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Julie and phatons</video:title>
      <video:description>Julie e os fantasmas #Julieandphatson</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396781/3396781_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T03:17:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396780</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396780/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>volta pra mim</video:title>
      <video:description>Volta Pra Mim” 💔❤️ — Cuando el amor es verdadero, ni el tiempo ni la distancia consiguen apagarlo. Una canción llena de saudade, arrepentimiento y esperanza por recuperar a quien todavía vive en el corazón. 🎶✨ #VoltaPraMim #VoltaPraMimmúsica #VoltaPraMimmúsicabrasileira #VoltaPraMimletra #músicabrasileira #músicaromântica #músicadeamor #músicaromânticabrasileira #amor #saudade #paixão #romance #términoderelacionamento #voltapramimamor #cançãoromântica #músicasdeamor #Brazilianmusic #músicaparacasal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396780/3396780_720p.mp4</video:content_loc>
      <video:duration>314</video:duration>
      <video:publication_date>2026-09-02T03:17:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Susto 2</video:title>
      <video:description>#Susto</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396779/3396779_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T03:16:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 44</video:title>
      <video:description>#Filme #risadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396778/3396778_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:16:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>COORDENAÇÃO MOTORA - ATLETISMO</video:title>
      <video:description>ATIVIDADES DE COORDENAÇÃO MOTORA - ATLETISMO #ATHLETISM #ATHLET #FUNCTIONALKIDS #CROSSFIT</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396777/3396777_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-02T03:15:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minha Aula Bateria Musica: Like A Stone</video:title>
      <video:description>Hoje compartilho um pouco da minha aula de bateria tocando “Like a Stone”, um dos grandes clássicos do Audioslave. 🎸🥁 Neste vídeo, pratico a música trabalhando ritmo, tempo, dinâmica, precisão e viradas, buscando transmitir a energia e a pegada marcante dessa música. 🎵 Música: Like a Stone 🎤 Artista: Audioslave 🥁 Instrumento: Bateria / Drum Cover Se você curtiu o vídeo, deixe seu like 👍, inscreva-se no canal e compartilhe com outros fãs de rock e bateria! 💬 Comente: qual música do Audioslave você gostaria de ver em uma próxima aula? #AudioslaveLikeAStoneDrumCoverBateriaDrummerRockRockDrumsDrumPlaythroughAulaDeBateriaBaterista</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396776/3396776_720p.mp4</video:content_loc>
      <video:duration>286</video:duration>
      <video:publication_date>2026-09-02T03:15:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>IF YOU HEAR THOSE FOOTSTEPS, DON&apos;T LOOK BACK... #Mysteries, #Haunting #HorrorStories #s</video:title>
      <video:description>#HorrorStories #Tips #fyp, #Mod, #TalesAndCordel, #UrbanLegends, #HorrorStories, #ScaryStories, #BrazilianLegends, #BrazilianFolklore, #Folktales, #HorrorTales, #MysteriousStories, #Mysteries, #Horror, #Suspense, #StoriesOfBrazil, #LegendsOfBrazil, #BrazilianTales, #Cordel, #CordelLiterature, #BrazilianCulture, #SupernaturalStories, #MysteriousCases, #RuralLegends, #RuralStories, #BrazilianHorror, #Folklore, #FolkloreCreatures, #TalesAndCordelOfficial “As children, many heard of the Sack Man. They said he walked the streets carrying a huge sack. No one knew who he was... or where he took those he encountered.” #ContosECordel #LendasUrbanas #LendasBrasileiras #TerrorBrasileiro #HistoriasDeTerror #HistoriasAssustadoras #FolcloreBrasileiro #Misterios #Assombracao #Terror #Medo #Shorts #YouTubeShorts #ShortsBrasil #ContosDeTerror #relatosdeterror #misterio #sectordelterror #historiasdeterrorreales</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396775/3396775_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-02T03:15:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diversão horário de almoço só marcos kkk</video:title>
      <video:description>Amigos se divertindo no horário de almoço #Brilhar</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396774/3396774_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T03:15:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SURPRISE😦</video:title>
      <video:description>#😦</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396773/3396773_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-02T03:15:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 43</video:title>
      <video:description>#Filme #risadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396772/3396772_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T03:15:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396771</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396771/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rozalla-Everybody&apos;s free</video:title>
      <video:description>Rozalla-Everybody&apos;s Free</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396771/3396771_720p.mp4</video:content_loc>
      <video:duration>210</video:duration>
      <video:publication_date>2026-09-02T03:15:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caixa de Pandora foi aberta</video:title>
      <video:description>Tudo que se descobriu sobre as fraudes, corrupção, lavagem de dinheiro do sistema podre, STF,banco master,viagens,Lulinha,sósia luladrao,ministros , juízes,presidentes de senado,governo envolvidos nesse esquema. #Ditador #STF #monocrática #abusos #morteemcadeiafederal #genocidas #ganância #resorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396770/3396770_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-09-02T03:15:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O PASSAGEIRO do ônibus 47</video:title>
      <video:description>Um homem pega o ônibus errado às 3h da manhã e descobre que está em uma dimensão paralela onde veículos fantasmas coletam almas de pessoas mortas em acidentes. Ele precisa escolher entre voltar para seu corpo no hospital ou ficar preso eternamente rodando em uma rota macabra alimentando uma entidade sobrenatural. #Narratiz #relatossobrenaturais #suspenseintenso #segredosocultos #medo #sombrias #arrepios #inexplicável #obscuro #históriasdemedo #históriasquedãomedo #lendasurbanasdeterror #terrorpsicológico #históriasdeterror #históriasassustadoras #históriarealdeterrorônibus #experiênciadequasemorteassustadora #relatosobrenaturaltransportepúblico #lendaurbanalinhadeônibusfantasma #baseadoemfatosreaisterror #acidentedeônibussobrenatural</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396769/3396769_720p.mp4</video:content_loc>
      <video:duration>1305</video:duration>
      <video:publication_date>2026-09-02T03:15:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 42</video:title>
      <video:description>#Filme #risadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396768/3396768_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T03:14:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, JÔ SUPERAÇÃO.</video:title>
      <video:description>Louvor gospel #louvor #gospel #brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396767/3396767_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-02T03:14:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Futebol  dos craque</video:title>
      <video:description>só goubonito</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396766/3396766_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T03:14:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 41</video:title>
      <video:description>#Filme #risadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396765/3396765_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T03:14:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 Would you pass the real political challenge? 😱</video:title>
      <video:description>🔥 Would you pass the real political challenge? 😱 A follower asked a question that turned into a serious challenge! Watch until the end and see how the conversation unfolds. 👀🔥 What would YOU answer? 🤔👇 #Política #eleitores</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396763/3396763_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-02T03:14:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wandinha 7</video:title>
      <video:description>Wandinha #Wandinha</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396762/3396762_720p.mp4</video:content_loc>
      <video:duration>151</video:duration>
      <video:publication_date>2026-09-02T03:14:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Danger Island (1968)</video:title>
      <video:description>(Danger Island) foi uma série de aventura americana de 1968 produzida pela Hanna-Barbera Productions como um segmento do programa The Banana Splits Adventure Hour. #Thedangerisland</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396761/3396761_720p.mp4</video:content_loc>
      <video:duration>9672</video:duration>
      <video:publication_date>2026-09-02T03:13:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What If CERN Could Open Portals to Other Dimensions?</video:title>
      <video:description>What if the most powerful particle collider ever built could do more than study the fundamental nature of matter? Imagine CERN discovering a way to create a stable portal to another dimension. What would happen if something from another universe could suddenly interact with ours? Would we discover an entirely different reality — or unleash something we don&apos;t understand? In this video, we explore a fascinating hypothetical scenario inspired by real particle physics, theories of extra dimensions, and the mysteries surrounding the Large Hadron Collider. ⚛️ What if CERN discovered evidence of another dimension? 🌌 Could extra dimensions exist? 🌀 What would a portal between universes look like? 🔬 Could particle collisions reveal hidden dimensions? 👁️ What might exist beyond our observable universe? 💥 What could happen if a dimensional portal became unstable? Science has not demonstrated that CERN can open portals to other dimensions. But imagining what could happen leads to some of the most fascinating questions about reality, physics, and the universe. What if another dimension was only one experiment away? #cern #cernportal #cernportals #cernportaltoanotherdimension #whatifcernopenedaportal #cernotherdimensions #cernparalleluniverse #cernmultiverse #cernmystery #cernexperiments #largehadroncollider #lhc #particlecollider #particlephysics #quantumphysics #extradimensions #otherdimensions #paralleldimensions #paralleluniverse #paralleluniverses #multiversetheory #multiverseexplained #dimensionalportal #portaltoanotherdimension #portaltoanotheruniverse #interdimensionalportal #dimensiontheory #hiddendimensions #fourthdimension #higherdimensions #alternatereality #alternateuniverse #anotheruniverse #universemysteries #physicsmysteries #sciencemysteries #unexplainedscience #myst</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396760/3396760_720p.mp4</video:content_loc>
      <video:duration>320</video:duration>
      <video:publication_date>2026-09-02T03:13:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>El Momento Perfecto No Existe_ ACTÚA HOY</video:title>
      <video:description>El Momento Perfecto No Existe: ACTÚA HOY. Deja de esperar las condiciones ideales; Dios obra en el caos y en la incertidumbre. La fe no es ver el camino completo, es dar el primer paso con confianza. Tu obediencia hoy desata tu milagro de mañana. No pospongas tu propósito. #Dios #fe #Accion #confianza #Motivacion #milagro #NoEsperes</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396759/3396759_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T03:13:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lágrimas, Perdas e Pensou em Desistir</video:title>
      <video:description>uma mulher que, após ser traída e humilhada, deu a volta por cima e se transformou em um exemplo de superação e sucesso! Em sua jornada cheia de amor, traição, dor e descobertas, Camila enfrentou momentos difíceis, mas descobriu que a maior vingança não está em se vingar, mas em viver sua melhor versão. 🌟 O que você vai aprender com esta história? Comente! #superação #históriainspiradora #comosuperaratraição #voltaporcima #motivação #transformaçãopessoal #históriasemocionantes #amoretraição #jornadadesucesso #históriasreais #inspiraçãoparaavida #comolidarcomador #históriasdevida #empoderamento #crescimentopessoal #vingançaemocional #desenvolvimentopessoal #resiliência #forçainterior #históriasqueinspiram #mudançadevida #liçãodevida #superandodesafios #históriasimpactantes</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396758/3396758_720p.mp4</video:content_loc>
      <video:duration>905</video:duration>
      <video:publication_date>2026-09-02T03:12:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>teu abraço</video:title>
      <video:description>Teu Abraço é Minha Casa ❤️🏡 Quando o amor verdadeiro chega, a gente entende que lar não é um lugar… é o abraço de quem faz a alma descansar. Uma canção emocionante sobre amor, saudade, esperança e a vontade de passar a vida inteira ao lado de quem amamos. ❤️🎶 #TeuAbraço #TeuAbraco #músicaTeuAbraço #músicabrasileira #músicaromântica #músicadeamor #músicaromânticabrasileira #amor #romance #paixão #carinho #abraço #cançãodeamor #músicaparacasal #músicasdeamor #Brazilianmusic #músicapopularbrasileira</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396757/3396757_720p.mp4</video:content_loc>
      <video:duration>347</video:duration>
      <video:publication_date>2026-09-02T03:12:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR TRAP, SANSÃO TRAIÇÃO E QUEDA.</video:title>
      <video:description>Louvor gospel #louvor #gospel #trap</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396756/3396756_720p.mp4</video:content_loc>
      <video:duration>165</video:duration>
      <video:publication_date>2026-09-02T03:11:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SEMPRE APRONTANDO 🤣</video:title>
      <video:description>SEMPRE APRONTANDO 🤣</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396755/3396755_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T03:11:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PALAVRA CCB CULTO ONLINE</video:title>
      <video:description>PALAVRA CCB CULTO ONLINE #SANTOCULTOADEUSHOJE #SANTOCULTOADEUSCCBAOVIVO #palavraccbdehoje #ccbpalavradehoje #pregaçãoccbdhoje #ccbcultoonlinedehoje #cultoonlineccbbras #ccbaovivo #cultoccbagora #assistircultoccbhoje #palavraonlineccbdehoje #cultoonlineccbdehoje #ccbcultodestaquartafeira #palavraccbcultodehoje110522 #ccbpalavraonlinedehojequarta-feira #cultoonlineccbquartafeira #pregaçãoccbdehoje #palavradeDeusccb #PALAVRASANTOCULTO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396754/3396754_720p.mp4</video:content_loc>
      <video:duration>2355</video:duration>
      <video:publication_date>2026-09-02T03:11:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SURPRISE MOTHErfkk</video:title>
      <video:description>#SUSTONATELAJOGANDOBASKETBALL</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396753/3396753_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T03:11:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Em Algum Lugar do Passado  - Dublado</video:title>
      <video:description>Na noite de estreia de sua peça, um jovem escritor se depara com uma senhora misteriosa que desesperadamente pede para que ele volte para ela. Após alguns anos, ele descobre que ela foi uma conceituada atriz do início do século. Obcecado, ele decide viajar no tempo usando a hipnose para encontrá-la. #Romance</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396752/3396752_720p.mp4</video:content_loc>
      <video:duration>6211</video:duration>
      <video:publication_date>2026-09-02T03:10:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🥇 New Faucet Paying in Multiple Cryptocurrencies (Earn for Free), pays in dollars.</video:title>
      <video:description>SUBSCRIBE TO THE EUJARDSONSANTOS YOUTUBE CHANNEL. 🚀 New Faucet Paying in Multiple CryptocurrenciesIn today&apos;s video, I&apos;m going to show you a new faucet that is paying out multiple cryptocurrencies, perfect for anyone who wants to earn free crypto every day with zero investment.These platforms allow you to accumulate different coins like Bitcoin, Litecoin, Solana, and others, just by completing simple tasks. #sidehustleextraincomeincome #extraincomewebsitesonlinesidehustlemakemoneyonlinesidehustlewithzeroinvestmentfreesidehustlemonthlyextraincomerecurringextraincome</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396751/3396751_720p.mp4</video:content_loc>
      <video:duration>651</video:duration>
      <video:publication_date>2026-09-02T03:10:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Urgente, população sai em defesa de André Mendonca</video:title>
      <video:description>Hoje na brasuela,o povo saiu em defesa do ministro André Mendonça, após descobrir que o lixo careca estava passando informação confidencial para o vorcaro do banco master.nao só isso : recebeu 128 k de reais , defende corruptos amigos, #Moraes #STF #corruptos #AndréMendonça #ladrões #ditador #vingança #lulasosia #Brasília #Trump #FlávioBolsonaro #eleições #urnas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396750/3396750_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-02T03:10:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Here is Corinthians!</video:title>
      <video:description>Aqui e corinthians se escrevam</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396749/3396749_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:09:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Favorite Demon | 내가 가장 아끼는 악마</video:title>
      <video:description>My Favorite Demon | 내가 가장 아끼는 악마 #MyFavoriteDemon #내가가장아끼는악마 #MeuDemônioFavorito</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396748/3396748_720p.mp4</video:content_loc>
      <video:duration>296</video:duration>
      <video:publication_date>2026-09-02T03:09:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>North Korea 2</video:title>
      <video:description>North Korea Noord-Korea #CoréeduNordNordkoreaكورياالشمالية</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396747/3396747_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T03:09:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>lagarto</video:title>
      <video:description>#lagarto</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396746/3396746_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T03:08:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What If Humans Never Landed on the Moon? A Different History of Humanity</video:title>
      <video:description>On July 20, 1969, humanity achieved one of its greatest technological milestones: humans landed on the Moon. But what if it had never happened? Imagine a world where the Apollo missions failed, the Moon remained untouched by humans, and the United States never achieved the historic lunar landing. How would the Space Race have unfolded? Would the Soviet Union have taken the lead? Would space exploration have developed more slowly — or perhaps in a completely different direction? In this video, we explore an alternate history where humanity never set foot on the Moon and examine how this single event could have changed technology, politics, science, space exploration, and our vision of the future. 🌕 What if Apollo 11 had failed? 🚀 Could the Soviet Union have won the Space Race? 🛰️ How would space technology have developed? 🌎 Would humanity still be planning a return to the Moon? 🔬 What scientific discoveries might have been delayed? ⏳ How different would our world be today? Sometimes, history is shaped not only by what happened — but by what could have happened. What would the world look like if humanity had never reached the Moon? #whatifhumansneverlandedonthemoon #whatifweneverlandedonthemoon #whatifapollo11failed #whatifapollo11neverhappened #moonlanding #moonlandingexplained #apollo11 #apollomission #firstmoonlanding #manonthemoon #humansonthemoon #spacerace #spaceracehistory #sovietunionspacerace #unitedstatesspacerace #nasa #nasahistory #alternatehistory #alternatehistoryscenarios #whatifscenarios #historywhatif #moonlandingmystery #moonlandingconspiracy #moonlandingtheories #lunarexploration #spaceexploration #historyofspaceexploration #futureofspaceexploration #moonmissions #apollomissions #lunarmission #spacetechnology #spacetechnologyhistory #coldwar #coldwarspa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396745/3396745_720p.mp4</video:content_loc>
      <video:duration>414</video:duration>
      <video:publication_date>2026-09-02T03:08:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396744</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396744/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Tiny Frog &amp; The Glowing Firefly | A Magical Rainforest Moment 🐸✨</video:title>
      <video:description>Step into a peaceful rainforest after the rain, where a tiny tree frog encounters a glowing firefly in a magical natural moment. 🌿🐸✨ Watch the beautiful interaction surrounded by fresh leaves, mist, raindrops, and golden sunlight. #treefrog #glowingfirefly #rainforest #naturevideo #wildlife #cutefrog #magicalnature #tropicaljungle #realisticwildlife #cinematicnature #rainforestanimals #firefly #relaxingnature #4Kwildlife #animaladventure #beautifulnature #peacefulforest #naturephotography</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396744/3396744_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:08:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivação 54</video:title>
      <video:description>Motivacional #Motivacional</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396743/3396743_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:07:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, DE ESCRAVO A GOVERNADOR.</video:title>
      <video:description>Louvor gospel #louvor #gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396742/3396742_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-02T03:07:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Pacific Intro</video:title>
      <video:description>A hauntingly beautiful, Emmy-winning title theme composed by Hans Zimmer, Geoff Zanelli, and Blake Neely, featuring poignant strings and brass that set a deeply emotional, somber tone for HBO&apos;s acclaimed World War II miniseries. #ThePacificHansZimmerHBOTVThemesFilmScore</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396741/3396741_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-02T03:07:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Thing vs. Colossus: Who Is Stronger?</video:title>
      <video:description>The Thing, the rocky powerhouse of the Fantastic Four, faces Colossus, the steel-skinned X-Man. Both possess superhuman strength and nearly indestructible bodies — one made of living rock, the other of organic steel. It is a brutal brawl of brawn and endurance where every blow shakes the ground, but Colossus&apos;s full metal form and greater durability give him the slim edge in this clash of titans. #Coisa #Colossus #tochahuman #heroi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396740/3396740_720p.mp4</video:content_loc>
      <video:duration>233</video:duration>
      <video:publication_date>2026-09-02T03:07:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SURPRISE 2</video:title>
      <video:description>#SURPRISE</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396739/3396739_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T03:06:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>「浴室金髮女郎」真的存在過嗎？</video:title>
      <video:description>你聽過「浴室金髮女郎」的傳說嗎…但你知道這個傳說可能源自真實故事嗎？ https://www.youtube.com/watch?v=Y-Rq0ps-RRU&amp;list=PLUGJOsh-9JT0 #真實故事, #傳說, #浴室金髮女郎, #históriareal #lenda #loiradobanheiro #existi #contoscordel #Mitosexistemesmo #lendasurbanas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396738/3396738_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-02T03:06:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amorzinho 😍😍😍😍😍</video:title>
      <video:description>Seu amor ❤️❤️❤️ #Amor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396737/3396737_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T03:06:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Órfã (2009)</video:title>
      <video:description>Uma série de eventos alarmantes faz uma mulher acreditar que algum mal esteja por trás do rosto angelical da filha de nove anos, recentemente adotada. #terror</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396736/3396736_720p.mp4</video:content_loc>
      <video:duration>7375</video:duration>
      <video:publication_date>2026-09-02T03:06:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Supercars #SportsCars #Cars #Automotive #EngineSound #Cars4K #NightCars 4</video:title>
      <video:description>#SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396735/3396735_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:05:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bocanilce sua gravidez</video:title>
      <video:description>Bocanilce indo às compra do bebê estourou cartão da mãe laranja 🤭🤭 #BocanilceLaranjagravidez</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396734/3396734_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-09-02T03:05:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 40</video:title>
      <video:description>#Filme #risadas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396733/3396733_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:05:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EP 1 | Caverna do Dragão</video:title>
      <video:description>Se divirta com esse episódio Da Caverna do Dragão e dê risada com essa turma. #CAVERNADODRAGÃO #DESENHOSANIMADOS</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396732/3396732_720p.mp4</video:content_loc>
      <video:duration>1194</video:duration>
      <video:publication_date>2026-09-02T03:05:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 39</video:title>
      <video:description>#Filme #risadas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396731/3396731_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T03:04:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O QUE...</video:title>
      <video:description>#SUSTO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396730/3396730_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T03:04:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat 🐈🐈🐈</video:title>
      <video:description>Cat #catmania</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396729/3396729_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T03:04:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>馬廷塔佩雷拉：鳥女巫</video:title>
      <video:description>屋頂傳來一聲刺耳的哨響。黑暗中許下的諾言。還有那筆無人敢忘的債。 Matinta Pereira 是亞馬遜地區最古老、流傳最廣的傳說之一——直到今天，帕拉州（Pará）、亞馬遜州（Amazonas）和阿馬帕州（Amapá）的居民仍堅稱自己曾聽過、甚至親眼見過這個會在夜間化身為鳥的生物。在這段影片中，你將了解這個傳說的起源、最令人毛骨悚然的版本、它與 Saci-Pererê 之間鮮為人知的聯繫，以及為何這個故事能在巴西北部的各個社區代代相傳。 🦉 Matinta Pereira 從何而來？ 🌙 她為何要來索取當初許下的承諾？ 🔎 傳說背後是否有某種解釋？ 請觀看至影片結尾，揭曉這個故事的最終結局。 👉 如果你聽過 Matinta，或知道你所在地區流傳的另一個版本，請在留言區告訴我們——你的故事可能會成為本頻道的下一個影片內容。 🔔 訂閱 Contos &amp; Cordel 並開啟小鈴鐺通知，以免錯過任何關於巴西民間傳說的神話、奇聞或未解之謎。 📌 如果你喜歡這些跨越世代流傳的故事，請按讚支持。 #matintapereira, #matintaperera, #亞馬遜傳說, #巴西民間傳說, #都市傳說, #巴西神話, #巴西傳說, #亞馬遜民俗, #亞馬遜謎團, #靈異, #巴西民間傳說, #都市傳說, #巴西神話, #巴西傳說, #亞馬遜民俗, #亞馬遜謎#巴西民俗, #恐怖, #恐怖故事, #失落的傳說, #未解之謎 #matintapereira #matintaperera #lendaamazonica #folclorebrasileiro #lendasurbanas #mitosbrasileiros #lendasbrasileiras #folcloreamazonico #misteriodaamazonia #assombração #historiareal #curiosidades #causosdaamazonia #lendasdointerior #culturapopular #amazonialegends #contosecordel #historiassombrias #lendasindigenas #mistériosdobrasil #folclorenorte #paraense #amazonia #bruxadanoite #assustador #historiasdemedo #lendasperdidas #relatosdeterror #historiasdeterror</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396728/3396728_720p.mp4</video:content_loc>
      <video:duration>211</video:duration>
      <video:publication_date>2026-09-02T03:04:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Supercars #SportsCars #Cars #Automotive #EngineSound #Cars4K #NightCars 3</video:title>
      <video:description>#SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396727/3396727_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:04:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 38</video:title>
      <video:description>#Filme #risadas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396726/3396726_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T03:04:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, CARREGANDO A CRUZ.</video:title>
      <video:description>LOUVOR GOSPEL #louvor #gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396725/3396725_720p.mp4</video:content_loc>
      <video:duration>139</video:duration>
      <video:publication_date>2026-09-02T03:03:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme 37</video:title>
      <video:description>#Filme #risadas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396724/3396724_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:03:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396723</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396723/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Supercars #SportsCars #Cars #Automotive #EngineSound #Cars4K #NightCars 2</video:title>
      <video:description>#SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396723/3396723_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:02:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Main bhi hu Tu bhi haiamane samane</video:title>
      <video:description>#sadlove</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396722/3396722_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T03:02:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ruth Star cantando</video:title>
      <video:description>Eu e o meu Primo Gernilson</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396721/3396721_720p.mp4</video:content_loc>
      <video:duration>285</video:duration>
      <video:publication_date>2026-09-02T03:02:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>[OJV] Dogs of War - Medal of Honor: European Assault</video:title>
      <video:description>A thrilling live symphonic performance by the Orchester des Jeunes de Vandoeuvre, delivering a fiery, dramatic rendition of Michael Giacchino&apos;s iconic Dogs of War theme with intense brass and powerful orchestral drive. #MedalOfHonorEuropeanAssaultDogsOfWarMichaelGiacchinoOJV</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396720/3396720_720p.mp4</video:content_loc>
      <video:duration>201</video:duration>
      <video:publication_date>2026-09-02T03:01:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cerveja 3</video:title>
      <video:description>#Cerveja #copo #beber</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396718/3396718_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T03:01:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Black Panther vs. Deathstroke: Who Wins?</video:title>
      <video:description>Black Panther, Wakanda&apos;s Vibranium-clad king with superhuman senses and godlike strength, faces Deathstroke — the genetically enhanced tactical genius and world&apos;s deadliest mercenary. Both are master combatants and strategic minds, but Black Panther&apos;s Vibranium protection and mystical powers ultimately outmatch Deathstroke&apos;s skills in a battle of precision versus royal might. #Pantera #Negra #exterminadorheroiBlackPanther #WakandasVibranium-cladkingwithsuperhumansensesandgodlikestrength #facesDeathstroke—thegeneticallyenhancedtacticalgeniusandworldsdeadliestmercenaryBotharemastercombatantsandstrategicminds #butBlackPanthersVibraniumprotectionandmysticalpowersultimatelyoutmatchDeathstrokesskillsinabattleofprecisionversusroyalmight</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396717/3396717_720p.mp4</video:content_loc>
      <video:duration>204</video:duration>
      <video:publication_date>2026-09-02T03:01:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minha Aula Bateria Musica: The Scientist</video:title>
      <video:description>Hoje compartilho um pouco da minha aula de bateria tocando “The Scientist”, um dos maiores sucessos do Coldplay. 🎹🥁 Neste vídeo, pratico a música trabalhando ritmo, tempo, dinâmica e coordenação, buscando reproduzir a essência da bateria da música. 🎵 Música: The Scientist 🎤 Artista: Coldplay 🥁 Instrumento: Bateria / Drum Cover Se você gostou do vídeo, deixe seu like 👍, inscreva-se no canal e compartilhe! 💬 Comente: qual música do Coldplay você gostaria de ver na bateria? #ColdplayTheScientistDrumCoverBateriaDrummerColdplayCoverBateriaRockDrumPlaythroughAulaDeBateria</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396716/3396716_720p.mp4</video:content_loc>
      <video:duration>266</video:duration>
      <video:publication_date>2026-09-02T03:01:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juros sltos</video:title>
      <video:description>O presidente Trump diz que as taxas de juros dos EUA estão &quot;altas demais&quot; e rejeita a ideia de um novo aumento. #Economia #impostos #juros #preços #mercadoglobal</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396715/3396715_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T03:01:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rio Largo 29/08/26</video:title>
      <video:description>Levando meu filho pra aventura #Viagenspasseios #trilhas #aventuras #Brasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396714/3396714_720p.mp4</video:content_loc>
      <video:duration>242</video:duration>
      <video:publication_date>2026-09-02T03:00:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#Supercars #SportsCars #Cars #Automotive #EngineSound #Cars4K #NightCars</video:title>
      <video:description>#SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396713/3396713_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:00:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #41</video:title>
      <video:description>Tô com medo!!! #funny #fun #cat #cats #gatinhos #catshorts #funnycats #cute #pets #petshorts #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #animalshorts #shortsengraçados #animaisengraçados #vídeosengraçados #vídeosdegatos #petsengraçados</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396712/3396712_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T03:00:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hollywood&apos;s Biggest Lies: The Secrets They Don&apos;t Show You</video:title>
      <video:description>Hollywood has spent more than a century creating illusions — but what happens when we look behind the scenes? From movie magic and staged stunts to misleading publicity, manipulated stories, fake locations, celebrity images, and scenes that are far from what they appear to be, the entertainment industry has mastered the art of making fiction look like reality. In this video, we uncover some of Hollywood&apos;s most fascinating tricks, controversies, myths, and behind-the-scenes secrets — and reveal how the industry creates the illusions that audiences around the world believe. 🎬 Movie scenes that aren&apos;t what they seem 🎭 The reality behind Hollywood&apos;s biggest illusions 💰 How publicity can shape a celebrity&apos;s image 🎥 Fake locations and movie magic 📰 Hollywood publicity tricks and media manipulation 🤯 Stories that became myths over the years Hollywood is built on storytelling — but sometimes, the biggest story is the one happening behind the camera. How much of what Hollywood shows us is actually real? #hollywoodsecrets #hollywoodlies #hollywoodexposed #hollywoodmysteries #secretsofhollywood #hollywoodbehindthescenes #hollywoodscandals #hollywoodmyths #hollywoodtricks #hollywooddeception #moviesecrets #movieindustrysecrets #filmindustrysecrets #hollywoodmoviesecrets #behindthesceneshollywood #hollywoodpublicity #celebritypublicity #celebrityimage #celebritysecrets #moviemagic #movieillusions #movietricks #fakemoviescenes #moviemyths #hollywoodmythsdebunked #hollywoodcontroversies #entertainmentindustrysecrets #darksideofhollywood #darksideofthefilmindustry #hollywooddocumentary #hollywooddocumentaryexplained #hiddenhollywood #untoldhollywoodstories #hollywoodhistory #cinemasecrets #filmmakingsecrets #movieproductionsecrets #howhollywoodworks #hollywoodmanipulation #mediamanipul</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396711/3396711_720p.mp4</video:content_loc>
      <video:duration>218</video:duration>
      <video:publication_date>2026-09-02T03:00:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Fighter Jets Are Made: Inside a High-Tech Aircraft Factory</video:title>
      <video:description>Ever wondered how modern fighter jets are built? Take a look inside a high-tech aircraft manufacturing process, from precision metal and composite components to advanced assembly, surface finishing, and final quality inspection. A fascinating look at aerospace engineering, precision manufacturing, and the technology behind modern military aircraft. #howfighterjetsaremade #fighterjetmanufacturing #fighterjetfactory #howmilitaryaircraftaremade #aircraftmanufacturing #aircraftproduction #aerospacemanufacturing #aerospaceengineering #jetfighterproduction #fighteraircraftassembly #aircraftassembly #aircraftfactory #militaryaircraftmanufacturing #jetaircraftmanufacturing #compositeaircraftmanufacturing #precisionengineering #aerospacetechnology #aircraftcomponents #aircraftengineering #manufacturingprocess #howitsmade</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396710/3396710_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-02T03:00:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396709</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396709/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inter 6</video:title>
      <video:description>#Inter #time #grêmio</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396709/3396709_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:59:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One club legends</video:title>
      <video:description>#Football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396708/3396708_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T02:59:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ataque da Aranha Caranguejeira.</video:title>
      <video:description>#AtaquedaAranhaCaranguejeira</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396707/3396707_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-02T02:59:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396706</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396706/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Shield Wall Rising</video:title>
      <video:description>Banners at the Mountain Gate | Synthwave &amp; Epic Electronic Music Descubre Banners at the Mountain Gate, un tema instrumental dinámico y envolvente que fusiona ritmos de synthwave y música electrónica épica para transportarte a un viaje de exploración y fantasía. Sobre la producción y el concepto: Sonido y Energía: Melodías de sintetizador potentes y una progresión rítmica llena de impulso, ideal para acompañar momentos de acción, aventura y concentración. Arte Visual: Una ilustración de estilo comic/retro-moderno que representa un majestuoso portal de piedra en la cima de una montaña, banderas ondeando con símbolos rúnicos y un deslumbrante atardecer cósmico. Ideal para creadores de contenido, amantes de la música instrumental electrónica y quienes buscan bandas sonoras para videos cortos, Shorts y proyectos visuales. Escucha más producciones en el catálogo y suscríbete para no perderte los próximos lanzamientos. #VikingTrance #MusicVikingElectro #FolkTranceInstrumental #ShieldWallRising #VikingRockStereo #EpicInstrumentalMusic #Trance138BPM #MusicaVikingaElectronica #VikingMetalElectronic #WorkoutMusicEpic #GamingMusicInstrumental</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396706/3396706_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-02T02:59:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🚨 QUER CONSEGUIR AS 4.000 HORAS DO YOUTUBE AINDA EM 2026?</video:title>
      <video:description>🚨 QUER CONSEGUIR AS 4.000 HORAS DO YOUTUBE AINDA EM 2026? Neste vídeo, você vai descobrir estratégias práticas para aumentar suas horas de exibição no YouTube e trabalhar para alcançar uma das principais metas necessárias para a monetização do canal. Você vai entender: ✅ O que realmente conta para as 4.000 horas ✅ Quantas visualizações podem ser necessárias ✅ Por que vídeos longos são importantes ✅ Como aumentar a retenção dos espectadores ✅ Como usar Shorts para atrair novos inscritos ✅ Como utilizar playlists para aumentar o tempo de exibição ✅ Como as lives podem contribuir para as horas ✅ O que evitar para não prejudicar o canal ✅ Como acompanhar sua evolução pelo YouTube Studio ✅ Como transformar as 4.000 horas em pequenas metas alcançáveis 💡 IMPORTANTE: não basta simplesmente conseguir visualizações. O objetivo é criar conteúdos que façam as pessoas permanecerem assistindo e continuarem consumindo outros vídeos do seu canal. 📊 Se você está começando um canal, este vídeo pode ajudar a montar uma estratégia mais inteligente para buscar as 4.000 horas de exibição em 2026. 👍 Gostou do conteúdo? Deixe o seu like e inscreva-se no canal para acompanhar mais estratégias sobre YouTube, monetização, renda extra e criação de conteúdo. 💬 Comente abaixo: quantas horas de exibição seu canal já tem? #RENDAEXTRA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396705/3396705_720p.mp4</video:content_loc>
      <video:duration>425</video:duration>
      <video:publication_date>2026-09-02T02:59:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Paisagem 6</video:title>
      <video:description>Landscape #Running #scenery #training</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396704/3396704_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T02:59:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sem pressa ...</video:title>
      <video:description>Animais e inspirações .... Às vezes, a pressa nos faz esquecer que a vida não é apenas uma sequência de metas batidas. A verdadeira evolução acontece no silêncio dos dias comuns, na paciência de recomeçar e na forma como reagimos aos imprevistos. #Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396703/3396703_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T02:59:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mensagem de fé 2</video:title>
      <video:description>Fé e esperança #Fé</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396702/3396702_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:58:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Agence de GEO _ 5000€_mois Facilement avec Metricool</video:title>
      <video:description>Les hommes qui réussissent ont un point commun : ils prennent soin d&apos;eux. Chaque journée est une nouvelle occasion de donner le meilleur. Découvrez GIGANTX, le complément alimentaire pensé pour accompagner votre énergie, votre confiance et votre bien-être. Reprenez le contrôle. Révélez votre potentiel. Commandez dès aujourd&apos;hui et rejoignez des milliers d&apos;hommes qui ont choisi GIGANTX. https://nplink.net/0pcaf6rw Chaque jour où vous attendez est un jour où vous repoussez votre évolution. #agenceGEO5000€facilementmetricool</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396701/3396701_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T02:58:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trilha 2</video:title>
      <video:description>passeio com amigos #Viagens</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396700/3396700_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T02:58:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Top 10 New Favorite Chinese Dramas 2026/2026年十大最受欢迎的中国新剧</video:title>
      <video:description>Top 10 New Favorite Chinese Dramas 2026/2026年十大最受欢迎的中国新剧 #China #Japão #usa #canada #reinounido #Brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396698/3396698_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-02T02:58:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O poder das palavras</video:title>
      <video:description>Cuidado com o que voce fala #Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396697/3396697_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:58:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desenhos antigos 2</video:title>
      <video:description>Nostalgia #Desenhos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396696/3396696_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:58:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>smart girl 2</video:title>
      <video:description>Dad thought he knew better.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396695/3396695_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-02T02:58:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gato apronta e se pendura nas toalhas 😂🐱</video:title>
      <video:description>Esse gato não pode ver uma toalha que já quer transformar tudo em brinquedo 😂🐱 Se pendurando como se fosse a coisa mais normal do mundo! 😹 #gato #gatoengraçado #gatobrincando #gatonastoalhas #gatosependurando #gatofofo #gatosengraçados #animaisengraçados #vídeodegato #brincadeiradegato #pet #humor #diversão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396694/3396694_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T02:58:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ORE A DEUS 🙏🏻</video:title>
      <video:description>Stop complaining about life and pray to God. Certain things will happen in your life; if you pray, God will answer you—He will change your heart. If you only complain, you will only face setbacks. Believe in God&apos;s power, and know that only good things will happen in your life. Amen. #Deus #jesus #fyp #brasil #motivation #shorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396693/3396693_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-02T02:58:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Amazon Flood Practical Effects 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396692/3396692_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:58:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #40</video:title>
      <video:description>Que tal um banho de piscinas!!!! #funny #fun #dog #funnydogs #dogshorts #cute #pets #petshorts #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #animalshorts #shortsengraçados #animaisengraçados #vídeosengraçados #petsengraçados #videosddecachorros</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396691/3396691_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:58:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trolamos o Amigo kk</video:title>
      <video:description>Ele foi trolado pelos amigos #rir #comédia #pegadinha #engraçado #trolagem #divertido #Eua #china #india #brincadeiras #passatempo #global #mundial #amigos #homem #mulher #entretenimento</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396690/3396690_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T02:57:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dê uma olhada em Porta Tempero Giratório 16 Potes Vidro Organizador de Condimentos Cozinha por R$54,</video:title>
      <video:description>Dê uma olhada em Porta Tempero Giratório 16 Potes Vidro Organizador de Condimentos Cozinha por R$54,97 - R$59,97. Compre na Shopee agora! https://s.shopee.com.br/7psv0Pu1bn #Shoppee #shopping #venda #produto</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396689/3396689_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T02:57:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Psicose (1960) Dublado</video:title>
      <video:description>Após roubar 40 mil dólares para se casar com o namorado, uma mulher foge durante uma tempestade e decide passar a noite em um hotel que encontra pelo caminho. Ela conhece o educado e nervoso proprietário do estabelecimento, Norman Bates, um jovem com um interesse em taxidermia e com uma relação conturbada com sua mãe. O que parece ser uma simples estadia no local se torna uma verdadeira noite de terror. #terror</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396688/3396688_720p.mp4</video:content_loc>
      <video:duration>6531</video:duration>
      <video:publication_date>2026-09-02T02:57:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EUA26</video:title>
      <video:description>eua26 #eua26</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396687/3396687_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T02:57:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396686</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396686/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminhão 4</video:title>
      <video:description>#Caminhão #descarga</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396686/3396686_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T02:57:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Dam Bursts Across Miniature Valley 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396685/3396685_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:57:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING VOLCANO ERUPTION</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396684/3396684_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:56:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐱😂 O cara só queria brincar, mas o gato levou a sério!</video:title>
      <video:description>Uma brincadeira simples que acabou virando uma cena hilária 😂🐱 Quem se divertiu mais: o cara ou o gato? 😹❤️ #gato #gatoengraçado #gatobrincando #homembrincandocomgato #brincadeiracomgato #gatofofo #animaisengraçados #vídeosdegatos #gatodivertido #momentoengraçado #pet #diversão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396683/3396683_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-02T02:56:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chácara  de Laranja</video:title>
      <video:description>Chácara de Laranja muito linda belas frutas #Laranja #chácara #roça #sítio</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396682/3396682_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:56:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING TSUNAMI 15</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396681/3396681_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:56:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bastidores 3 Universo dos Fãs</video:title>
      <video:description>Bastidores Universo dos Fãs é só festa #Descontração</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396680/3396680_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-02T02:56:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, JEOVÁ MINHA FORTALEZA.</video:title>
      <video:description>Louvor gospel #louvor #gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396679/3396679_720p.mp4</video:content_loc>
      <video:duration>150</video:duration>
      <video:publication_date>2026-09-02T02:56:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #39</video:title>
      <video:description>Dando uma voltinha de bicicleta!!! #funny #fun #cute #pets #petshorts #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #animalshorts #shortsengraçados #animaisengraçados #vídeosengraçados #vídeosdegatos #petsengraçados #funnymonkeys #babymonkeys #macaquinhos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396678/3396678_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:56:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING DESERT EXPLOSIONS 9</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396677/3396677_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:55:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎵 “Alma do Campo — Uma Jornada de Paz e Emoção | Sertanejo Instrumental”</video:title>
      <video:description>🌾 ALMA DO CAMPO — UMA JORNADA DE PAZ E EMOÇÃO 🎵 Uma viagem pelas paisagens do campo brasileiro, onde a natureza, o silêncio e a música se encontram para contar uma história sem precisar de palavras. 🎶 Uma trilha sonora instrumental e cinematográfica, inspirada no sertanejo raiz, com violão, viola caipira e sanfona, criada para transmitir sentimentos de paz, nostalgia, liberdade e conexão com a vida simples do interior. 🌅 Deixe a música acompanhar cada paisagem, cada estrada, cada momento de contemplação e cada lembrança. Se você gosta de música sertaneja instrumental, música para relaxar, natureza, vida no campo e paisagens rurais brasileiras, este vídeo foi feito para você.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396676/3396676_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T02:55:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prêmio</video:title>
      <video:description>#Prêmio #meta</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396675/3396675_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:55:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RITMO MARACATU /  MARACATU RHYTHM / 마라카투 리듬</video:title>
      <video:description>Ritmo do Brasil maracatu / Brazilian rhythm, maracatu / 브라질 리듬, 마라카투 #Ritmomaracatu #Maracaturhythm #마라카투리듬</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396674/3396674_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T02:55:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>30 Louvores Para Acalmar a Alma</video:title>
      <video:description>#músicaevangélica #louvor #adorar #gospel #hinoslouvoresdeadoração #melhoresmúsicasgospel #músicasgospel2026 #louvoresmaistocados #hinosparasentirapresença #músicasgospelparadormir #louvores2026 #músicagospelinstrumental #gospelantigas #hinosevangélicos #deusdepromessas #músicasgospelinternacionais #adorarcomhinos #louvorgospel #topmúsicasgospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396673/3396673_720p.mp4</video:content_loc>
      <video:duration>6912</video:duration>
      <video:publication_date>2026-09-02T02:55:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🇮🇩 JAYAPURA 2025: My Amazing Trip &amp; Stay in Indonesia’s Beautiful Papua! 🌴✈️</video:title>
      <video:description>From exploring the beautiful city of Jayapura to enjoying my unforgettable stay, this 2025 trip was full of amazing views, new experiences, great food, and unforgettable memories! 🇮🇩🌴✈️ Come along and experience Jayapura through my journey! 🔥🎥 #travel #jayapuracity #indonesia #png #beautifulcity #papua</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396672/3396672_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-09-02T02:54:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Application Mariage _ Succès Viral TikTok, Business à 20k€</video:title>
      <video:description>Les hommes qui réussissent ont un point commun : ils prennent soin d&apos;eux. Chaque journée est une nouvelle occasion de donner le meilleur. Découvrez GIGANTX, le complément alimentaire pensé pour accompagner votre énergie, votre confiance et votre bien-être. Reprenez le contrôle. Révélez votre potentiel. Commandez dès aujourd&apos;hui et rejoignez des milliers d&apos;hommes qui ont choisi GIGANTX. https://nplink.net/0pcaf6rw Chaque jour où vous attendez est un jour où vous repoussez votre évolution. #applicationmariagesuccèsviralTikTokbusiness20k€</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396671/3396671_720p.mp4</video:content_loc>
      <video:duration>98</video:duration>
      <video:publication_date>2026-09-02T02:54:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>No more Neymar, Cristiano , Messi of world cup...</video:title>
      <video:description>... #F</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396670/3396670_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T02:54:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING TSUNAMI 12</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396669/3396669_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:54:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Smart Monkey 2</video:title>
      <video:description>Smart Monkey #SmartMonkey</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396668/3396668_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T02:54:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396667</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396667/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Conheça o caminho de Moisés na praia de Barra Grande Maragogi Brasil</video:title>
      <video:description>Nesse vídeo, levei você para conhecer um dos cenários mais incríveis do nosso litoral. Se você ama viajar, apreciar a natureza e se conectar com boas vibrações à beira-mar, este lugar é para você. #paraisotropicalpraiasparadisíacasBrasilnaturezavidasaudáveldescansoparaisolaserlindaspraiasverãolitoralbrasileiroestilodevidaturismodicasdeviagembrasilbeachlitoralbrasileironaturezabrasilpraiasdonordeste</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396667/3396667_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T02:54:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING  3</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396666/3396666_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:54:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The secret identity of the new Captain America #Avengers #Marvel #Shorts</video:title>
      <video:description>😱 What if the Captain America we see in *Avengers: Doomsday* isn&apos;t actually the hero we know? There is a theory that has Marvel fans intrigued. In the comics, there is an alternate version of Steve Rogers known as Captain Hydra. #Marvel #cmu #capitãoamerica #vingadores</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396665/3396665_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-02T02:54:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cat dance 18</video:title>
      <video:description>Best of best</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396664/3396664_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-02T02:54:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #38</video:title>
      <video:description>Como um cantor!!! #funny #fun #funnycats #cute #pets #petshorts #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #animalshorts #shortsengraçados #animaisengraçados #vídeosengraçados #petsengraçados #papagaio #parrots #birds</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396663/3396663_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:53:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Passageiros</video:title>
      <video:description>Filme passageiros</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396662/3396662_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-02T02:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lagarto.</video:title>
      <video:description>#Lagarto</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396661/3396661_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-02T02:53:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EP 01 | Everything between us//우리 사이의 모든 것 ll</video:title>
      <video:description>EP 01 | 우리 사이의 모든 것 ll #everythingbetweenus #로맨스 #단편드라마 #재회 #재결합/ EP 01 | Everything between us ll #everythingbetweenus #romance #shortdrama #reunited #reunion #Inglêscoreano</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396660/3396660_720p.mp4</video:content_loc>
      <video:duration>146</video:duration>
      <video:publication_date>2026-09-02T02:53:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gta vi leek cyberleek</video:title>
      <video:description>cyberleeek #cyberleekgtavi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396659/3396659_720p.mp4</video:content_loc>
      <video:duration>132</video:duration>
      <video:publication_date>2026-09-02T02:53:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Antarctic: What Is Really Hidden Beneath the Ice?</video:title>
      <video:description>Antarctica is one of the most mysterious places on Earth. Beneath kilometers of ice lies a hidden world that humans have barely explored — and scientists continue to make discoveries that challenge our understanding of the frozen continent. Ancient landscapes, enormous mountains, subglacial lakes, buried rivers, extreme environments, and evidence of a very different Antarctica from millions of years ago reveal a story far more fascinating than its frozen surface suggests. In this video, we go beneath the ice to explore the secrets, discoveries, and unanswered questions surrounding the most isolated continent on Earth. ❄️ What is hidden beneath Antarctica&apos;s ice? 🏔️ Are there mountains buried beneath kilometers of ice? 💧 What mysterious lakes and rivers exist underground? 🌿 Did Antarctica once have forests and a warmer climate? 🔬 What are scientists discovering beneath the frozen surface? 🌎 Could Antarctica reveal secrets about Earth&apos;s ancient past? The deeper scientists look, the more extraordinary Antarctica becomes. What else could be hiding beneath the ice? #antarctica #antarcticamysteries #antarcticasecrets #hiddenantarctica #beneaththeice #whatisbeneathantarctica #antarcticabeneaththeice #secretsbeneaththeice #antarcticadiscoveries #antarcticaunexplored #unexploredantarctica #mysteriousantarctica #antarcticmysteries #antarcticahiddenworld #hiddenworldbeneaththeice #antarcticasecretsrevealed #antarcticafacts #antarcticascience #antarcticexploration #antarcticadocumentary #antarcticamysterydocumentary #ancientantarctica #ancientworldbeneaththeice #ancientantarcticaforest #antarcticamountains #mountainsbeneaththeice #antarcticlakes #subglaciallakes #antarcticarivers #hiddenrivers #antarcticicesheet #antarcticice #secretsofantarctica #unexplainedantarctica #strangedisco</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396658/3396658_720p.mp4</video:content_loc>
      <video:duration>236</video:duration>
      <video:publication_date>2026-09-02T02:53:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>André Rieu - Conquest of Paradise</video:title>
      <video:description>A magnificent live orchestral performance by André Rieu and his Johann Strauss Orchestra, delivering a grand, uplifting rendition of Vangelis&apos;s iconic theme Conquest of Paradise filled with soaring choir harmonies and breathtaking stage presence. #AndreRieuConquestOfParadiseJohannStraussOrchestraVangelisClassicalMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396657/3396657_720p.mp4</video:content_loc>
      <video:duration>281</video:duration>
      <video:publication_date>2026-09-02T02:52:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Houve Uma Vez Um Verão</video:title>
      <video:description>Durante a Segunda Guerra Mundial, o adolescente Herman Raucher aproveita o verão no condado de Nantucket com seus amigos Oscy e Benji, ambos obcecados por sexo. Lá, Herman conhece a recém-casada Dorothy, de 20 e poucos anos, cujo marido foi convocado para lutar na guerra. Enquanto seus amigos tentam seduzir garotas da mesma idade, Herman faz amizade com a mulher mais velha e acaba se apaixonando por ela. #Filme</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396656/3396656_720p.mp4</video:content_loc>
      <video:duration>6250</video:duration>
      <video:publication_date>2026-09-02T02:52:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>6 ARANHAS EXÓTICAS E RARAS</video:title>
      <video:description>6 aranhas exóticas de vários países.... #Animals</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396655/3396655_720p.mp4</video:content_loc>
      <video:duration>496</video:duration>
      <video:publication_date>2026-09-02T02:52:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #37</video:title>
      <video:description>Nada como brincar na água!!! #funny #fun #cute #pets #petshorts #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #animalshorts #shortsengraçados #animaisengraçados #vídeosengraçados #vídeosdegatos #petsengraçados #dog #funnydogs #dogshorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396653/3396653_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T02:51:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu peto</video:title>
      <video:description>#Meupeto</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396652/3396652_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T02:51:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minha Aula Bateria Musica: Wake me up when September ends</video:title>
      <video:description>Hoje compartilho um pouco da minha aula de bateria tocando “Wake Me Up When September Ends”, um dos grandes sucessos do Green Day. 🎸🥁 Neste vídeo, mostro minha execução da bateria e pratico as principais partes da música, trabalhando ritmo, tempo, viradas e dinâmica. 🎵 Música: Wake Me Up When September Ends 🎤 Artista: Green Day 🥁 Instrumento: Bateria / Drum Cover Se você curtiu o vídeo, deixe seu like 👍, inscreva-se no canal e compartilhe com outros amantes de bateria e rock! 💬 Comente: qual música do Green Day você gostaria de ver na bateria? #GreenDayWakeMeUpWhenSeptemberEndsDrumCoverBateriaDrummerRockBateriaRockDrumPlaythrough</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396651/3396651_720p.mp4</video:content_loc>
      <video:duration>157</video:duration>
      <video:publication_date>2026-09-02T02:51:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Samba Brasil</video:title>
      <video:description>Ritmo samba na bateria do Brasil . Samba rhythm in Brazil&apos;s drum section. 브라질 드럼 섹션의 삼바 리듬. #RitmosambaBrasil #Braziliansambarhythm #브라질삼바리듬</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396650/3396650_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-02T02:51:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DJ LKS RIT INTERNATIONAL - _매일 당신과 싸워요, 멈추고 반성했어요, 자신을 찾았어요, 모든 게 짜</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866 #musicasmaistocadas2024 #musicasinternacionais #melhoresmusicasinternacionais2024 #musicasinternacionaismaistocadas #musicasromanticas #maioressucessos2024 #maioressucessos #acousticsongs2024 #popmage #englishsongs #englishsongs2024 #musicasinternacionais2024 #musicaseletronicas2024 #musicaseletronicas #musicasromanticasinternacionais #maistocadas2024 #musicasinternacionaismaistocadas2024 #cancioneseningles #musicaeningles #topsongs2024musicasmaistocadas2023 #melhoresmusicasinternacionais2023 #maioressucessos2023 #acousticsongs2023 #englishsongs2023 #musicasinternacionais2023 #musicaseletronicas2023 #maistocadas2023 #musicasinternacionaismaistocadas2023 #topsongs2023</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396649/3396649_720p.mp4</video:content_loc>
      <video:duration>169</video:duration>
      <video:publication_date>2026-09-02T02:50:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Back to the Future / 백 투 더 퓨처</video:title>
      <video:description>Back to the Future / 백 투 더 퓨처 Marty McFly, a 17-year-old high school student, is accidentally sent 30 years into the past in a time-traveling DeLorean invented by his close friend, the maverick scientist Doc Brown.&quot; 힐 밸리에 사는 주인공 마티 맥플라이는 평범한 고등학생이다. 평소 친하게 지내던 괴짜 발명가 에메트 브라운 박사(닥)가 스포츠카 드로리안을 개조해 타임머신을 만드는 데 성공하지만, 뜻밖의 사고로 박사가 테러범들에게 총격을 당하고 위험에 처한다. 테러범들을 피해 드로리안을 타고 도망치던 마티는 30년 전인 1955년의 과거로 시간 여행을 하게 된다.그곳에서 젊은 시절의 아버지 조지와 어머니 로레인을 만나게 되지만, 실수로 어머니가 자신에게 연애감을 품게 되면서 부모님이 결혼하여 자신이 태어날 확률 자체가 사라질 위기에 처한다. 마티는 자신의 존재를 구하기 위해 1955년의 닥 브라운의 도움을 받아 부모님을 서로 사랑에 빠지게 만들고, 무사히 1985년의 현재로 돌아가기 위해 고군분투한다. #BacktotheFuture백투더퓨처</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396648/3396648_720p.mp4</video:content_loc>
      <video:duration>103</video:duration>
      <video:publication_date>2026-09-02T02:50:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atiradora de Elite</video:title>
      <video:description>moda de viola #modão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396647/3396647_720p.mp4</video:content_loc>
      <video:duration>212</video:duration>
      <video:publication_date>2026-09-02T02:50:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ChatGPT _ Auditez et Facturez des Entreprises Facilement</video:title>
      <video:description>Les hommes qui réussissent ont un point commun : ils prennent soin d&apos;eux. Chaque journée est une nouvelle occasion de donner le meilleur. Découvrez GIGANTX, le complément alimentaire pensé pour accompagner votre énergie, votre confiance et votre bien-être. Reprenez le contrôle. Révélez votre potentiel. Commandez dès aujourd&apos;hui et rejoignez des milliers d&apos;hommes qui ont choisi GIGANTX. https://nplink.net/0pcaf6rw Chaque jour où vous attendez est un jour où vous repoussez votre évolution. #ChatGPTauditezfacturezentreprisesfacilement</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396646/3396646_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-02T02:50:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396645</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396645/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING FIRE IN THE CITY 3</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396645/3396645_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:50:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #36</video:title>
      <video:description>Tá difícil, para quieto com esse pé!!! #funny #fun #cat #cats #gatinhos #catshorts #funnycats #cute #pets #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #animalshorts #shortsengraçados #animaisengraçados #vídeosengraçados #vídeosdegatos #petsengraçados</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396644/3396644_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T02:50:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amor Sublime</video:title>
      <video:description>Modão dos bons . #Modão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396643/3396643_720p.mp4</video:content_loc>
      <video:duration>227</video:duration>
      <video:publication_date>2026-09-02T02:50:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mjolnir vs. Captain America&apos;s Shield: Which Material Is Stronger?</video:title>
      <video:description>Captain America&apos;s shield is made from the unique Vibranium alloy that absorbs all impact, making it physically the toughest material. Thor&apos;s hammer Mjolnir is forged from Uru metal in a dying star and enchanted by Odin with divine magic. While the shield holds firm and endures almost any blow, the hammer channels cosmic power that can crack even the strongest defense — the ultimate defense versus the ultimate enchanted weapon. #Thor #Odin #escudo #hero #contos #febspot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396641/3396641_720p.mp4</video:content_loc>
      <video:duration>102</video:duration>
      <video:publication_date>2026-09-02T02:49:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, SÓ UM VOLTOU.</video:title>
      <video:description>Louvor gospel. #louvor #gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396640/3396640_720p.mp4</video:content_loc>
      <video:duration>219</video:duration>
      <video:publication_date>2026-09-02T02:49:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHORA NÃO BEBÊ FORRÓ 2026</video:title>
      <video:description>FORRÓ ADAPTAÇÃO JM XAVIER #FORRÓ</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396639/3396639_720p.mp4</video:content_loc>
      <video:duration>190</video:duration>
      <video:publication_date>2026-09-02T02:49:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AS 4 ESPÉCIES ALIENÍGENAS e o DIA DA REVELAÇÃO - THIAGO LIMA</video:title>
      <video:description>👽 **QUAIS SERIAM AS 4 ESPÉCIES ALIENÍGENAS E O QUE PODE ACONTECER NO DIA DA REVELAÇÃO?** O fenômeno extraterrestre continua cercado de perguntas, relatos e teorias que despertam a curiosidade de pessoas no mundo inteiro. Neste vídeo, **Thiago Lima** aborda uma das questões mais intrigantes da ufologia: a suposta existência de diferentes espécies alienígenas e a possibilidade de um futuro momento de revelação. 🛸 Quem seriam essas supostas espécies? 🌌 De onde elas poderiam ter vindo? 👁️ O que os relatos de contato dizem sobre suas características? 📡 E o que poderia significar um eventual **“Dia da Revelação”** para a humanidade? Neste conteúdo, você conhecerá diferentes teorias e interpretações relacionadas ao fenômeno extraterrestre, explorando um assunto que permanece envolto em mistério e controvérsia. ⚠️ **Importante:** as informações apresentadas devem ser entendidas como relatos, hipóteses e interpretações relacionadas à ufologia, e não como fatos científicos comprovados. 👉 **Assista até o final e descubra por que essas teorias continuam despertando tanta curiosidade.** #ThiagoLimaAlienígenasExtraterrestresUfologiaDiaDaRevelaçãoUFOOVNIVidaExtraterrestreMistériosContatoExtraterrestre</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396638/3396638_720p.mp4</video:content_loc>
      <video:duration>1318</video:duration>
      <video:publication_date>2026-09-02T02:49:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Bridge Collapse 10</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396637/3396637_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:48:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GOTAS de orvalho</video:title>
      <video:description>GOTAS de ORVALHO limpeza de memoria #Hooponopono #GRATIDÃO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396636/3396636_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-09-02T02:48:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #35</video:title>
      <video:description>Coitadinho do gatinho!!! #funny #fun #cat #cats #gatinhos #catshorts #funnycats #cute #pets #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #animalshorts #shortsengraçados #animaisengraçados #vídeosengraçados #vídeosdegatos #petsengraçados #dog #funnydogs #dogshorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396635/3396635_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-02T02:48:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tamanho GG</video:title>
      <video:description>Gigante</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396634/3396634_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T02:48:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Passeio rio largo</video:title>
      <video:description>Dia de lazer #Viagens #Brasil #rio #lazer</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396633/3396633_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-02T02:48:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brave Looks Good on Me</video:title>
      <video:description>#music #song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396632/3396632_720p.mp4</video:content_loc>
      <video:duration>134</video:duration>
      <video:publication_date>2026-09-02T02:47:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Craziest DJ You’ll Ever See 😂🎧</video:title>
      <video:description>When the DJ booth gets REALLY weird… 💀😂 Would you dance to this beat? 🎶🔥</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396631/3396631_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T02:47:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DJ LKS RIT INTERNATIONAL - 술을 마시고, 길거리를 넘어지며 개처럼 못살아 #dorama #ost</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396629/3396629_720p.mp4</video:content_loc>
      <video:duration>201</video:duration>
      <video:publication_date>2026-09-02T02:47:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING VOLCANO ERUPTION 4</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396628/3396628_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:47:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Roça  de Mandioca</video:title>
      <video:description>Linda roça de mandioca pra quem gosta de vídeos da roça #Mandioca #roça #linda</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396627/3396627_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T02:46:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #34</video:title>
      <video:description>Hummm que delícia essa TV!!!! #funny #fun #cat #cats #gatinhos #catshorts #cute #pets #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #dog #funnydogs #dogshorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396626/3396626_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T02:46:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Container Port Storm Simulation 4</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396625/3396625_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:46:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396624</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396624/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Créer une App _ Coût, Rapidité, Simplicité et Potentiel Financier</video:title>
      <video:description>Les hommes qui réussissent ont un point commun : ils prennent soin d&apos;eux. Chaque journée est une nouvelle occasion de donner le meilleur. Découvrez GIGANTX, le complément alimentaire pensé pour accompagner votre énergie, votre confiance et votre bien-être. Reprenez le contrôle. Révélez votre potentiel. Commandez dès aujourd&apos;hui et rejoignez des milliers d&apos;hommes qui ont choisi GIGANTX. https://nplink.net/0pcaf6rw Chaque jour où vous attendez est un jour où vous repoussez votre évolution. #créerappcoûtrapiditésimplicitépotentielfinancier</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396624/3396624_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T02:46:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FORRÓ CHOREI DE SAUDADADE NA PEGADA DO BIRÍBA.</video:title>
      <video:description>NA PEGADA DO BIRÍBA. ADAPTAÇÃO JM XAVIER #FORRÓ</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396623/3396623_720p.mp4</video:content_loc>
      <video:duration>243</video:duration>
      <video:publication_date>2026-09-02T02:46:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>alma gêmea</video:title>
      <video:description>❤️ &quot;Alma Gêmea&quot; é uma canção que toca o coração de quem já viveu um amor verdadeiro. Uma história de saudade, esperança e reencontro, embalada pelo melhor sertanejo romântico. Se essa música emocionou você, deixe seu ❤️, inscreva-se no canal e compartilhe com quem mora para sempre no seu coração #AlmaGêmea #AlmaGemea #músicaAlmaGêmea #músicabrasileira #músicaromântica #músicadeamor #músicabrasileiraromântica #amor #romance #cançãoromântica #músicapopularbrasileira #MPB #músicaparacasal #músicasdeamor #Brazilianmusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396622/3396622_720p.mp4</video:content_loc>
      <video:duration>359</video:duration>
      <video:publication_date>2026-09-02T02:46:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Escorpião quase mata jovem</video:title>
      <video:description>Uma jovem moça ao colocar sua peruca quase é surpreendida pelo escorpião 🦂 #Escorpião #moça #peruca</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396621/3396621_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T02:46:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING Village Avalanche 1</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396620/3396620_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:46:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What If the Zombie Apocalypse Really Happened? How Would Humanity Survive?</video:title>
      <video:description>Imagine waking up one morning to a world where the dead are no longer staying dead. A mysterious outbreak begins spreading from city to city. Governments struggle to contain it, hospitals become overwhelmed, communication networks fail, and millions of people suddenly face an enemy that doesn&apos;t feel fear, pain, or exhaustion. But could a real-world “zombie apocalypse” actually happen? In this video, we explore the science behind zombie-like behavior, how a highly contagious outbreak could spread, what could happen during the first days of a global crisis, and whether modern civilization could survive such a scenario. 🧟 Could a real zombie outbreak happen? 🦠 What kind of disease could cause zombie-like behavior? 🏙️ How quickly could a major city collapse? 🌎 What would happen if the outbreak became global? 📡 How would governments and emergency services respond? 🧬 Could humanity survive a worldwide outbreak? From science and epidemiology to human behavior and societal collapse, we explore one of the most terrifying hypothetical scenarios imaginable. If the zombie apocalypse began tomorrow… would humanity be ready? #zombieapocalypse #zombieapocalypseexplained #whatifthezombieapocalypsehappened #zombieoutbreak #zombieoutbreakscenario #realzombieapocalypse #couldzombiesexist #canzombiesexist #zombievirus #zombieinfection #zombiedisease #zombiepandemic #zombieapocalypsescenario #zombiesurvival #howtosurviveazombieapocalypse #survivalapocalypse #apocalypsescenario #endoftheworld #worldendingscenarios #globaloutbreak #globalpandemic #infectiousdisease #contagiousdisease #mysteriousoutbreak #viraloutbreak #zombievirusexplained #scienceofzombies #zombiescience #reallifezombies #zombietheory #zombietheories #zombieapocalypsedocumentary #zombiedocumentary #apocalypsedocumentary #hyp</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396619/3396619_720p.mp4</video:content_loc>
      <video:duration>374</video:duration>
      <video:publication_date>2026-09-02T02:46:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Segue o bando!</video:title>
      <video:description>#rpgdemesa #rpg #memes</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396618/3396618_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:46:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus Transforma Derrotas em Vitórias 🙏✨ #Fé</video:title>
      <video:description>Jesus Transforma Derrotas em Vitórias 🙏✨ #Fé #Jesus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396617/3396617_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-02T02:45:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396616</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396616/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ROBÔS HUMANOIDES PIDEM SUBSTITUIR O AMOR HUMANO?</video:title>
      <video:description>#RobôsHumanoides #InteligênciaArtificial #Robôs Robô humanoide pode substituir o amor humano? À medida que a inteligência artificial aprende a reconhecer emoções, conversar e responder de maneira cada vez mais humana, uma pergunta começa a ficar difícil de ignorar: podemos criar vínculos emocionais com uma máquina? Neste documentário, exploramos os novos robôs humanoides hiper-realistas, a inteligência artificial capaz de interpretar emoções, a companhia, a intimidade e a possibilidade de uma máquina ocupar um espaço emocional que antes pertencia exclusivamente às relações humanas. O que começa como tecnologia pode terminar em algo muito mais complexo: um vínculo. E talvez a pergunta mais inquietante seja: Se ela não sente... o que significa quando somos nós que começamos a sentir? #Cienciasetecmologia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396616/3396616_720p.mp4</video:content_loc>
      <video:duration>388</video:duration>
      <video:publication_date>2026-09-02T02:45:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING TSUNAMI 14</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396615/3396615_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:45:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, CENSO DO POVO.</video:title>
      <video:description>Louvor gospel. #louvor #gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396614/3396614_720p.mp4</video:content_loc>
      <video:duration>349</video:duration>
      <video:publication_date>2026-09-02T02:45:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivação 53</video:title>
      <video:description>Para você que está pensando em desistir #motivação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396613/3396613_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:45:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🇧🇷 Club de Regatas Vasco da Gama</video:title>
      <video:description>Curte nosso Projeto? Colabore com Pix: dnz.football.one@gmail.com #vascodagama #vasco</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396612/3396612_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-02T02:45:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #33</video:title>
      <video:description>Pulando de felicidade !!! #funny #fun #cat #cats #gatinhos #catshorts #cute #pets #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #dog #fuunydogs #dogshorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396611/3396611_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:45:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMAKING FIRE IN THE CITY 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396610/3396610_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:44:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Passeio pra rio largo</video:title>
      <video:description>Aventureiro nato, resolvi levar meu filho pra uma aventura</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396609/3396609_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-02T02:44:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DJ LKS RIT INTERNATIONAL - 우우우우우 우우우 베이비 우우우우우우 베이비 #dorama #ost</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866 #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396608/3396608_720p.mp4</video:content_loc>
      <video:duration>224</video:duration>
      <video:publication_date>2026-09-02T02:44:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Bridge Collapse 1</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396607/3396607_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:43:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fez xixi no lugar errado kk</video:title>
      <video:description>Ela fez xixi aonde tinha formigas kk #rir #comédia #pegadinha #engraçado #trolagem #divertido #Eua #china #india #brincadeiras #passatempo #global #mundial #amigos #homem #mulher #entretenimento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396606/3396606_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-02T02:43:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>golaço do flamengo</video:title>
      <video:description>puga chuta de longe e faz golaço #viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396605/3396605_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T02:43:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #31</video:title>
      <video:description>Amor de mãe #funny #fun #cute #pets #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos #monkeyshorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396604/3396604_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T02:43:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I need romance ep 1</video:title>
      <video:description>Corea #ineedromance</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396603/3396603_720p.mp4</video:content_loc>
      <video:duration>2723</video:duration>
      <video:publication_date>2026-09-02T02:43:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING DESERT EXPLOSIONS 8</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396602/3396602_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:43:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bella Ciao (Epic Rock Orchestra) | The Most Powerful Version You&apos;ll Ever Hear</video:title>
      <video:description>An explosive, high-energy reimagining of the iconic resistance anthem that merges crushing rock guitars, massive orchestral strings, and thunderous percussion into a dramatic cinematic masterpiece. #BellaCiaoEpicRockOrchestraRockSymphonyCinematicMusicEpicMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396601/3396601_720p.mp4</video:content_loc>
      <video:duration>267</video:duration>
      <video:publication_date>2026-09-02T02:42:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Esse cadeirante não fica quieto kkk</video:title>
      <video:description>Vídeo sobre publicidade #Brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396600/3396600_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-02T02:42:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Campeão no free fire</video:title>
      <video:description>#Frefire #game</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396599/3396599_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T02:42:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396598</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396598/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING VOLCANO ERUPTION 6</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396598/3396598_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:42:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devenez Riche avec les Témoignages Clients_ Business à 240% Croissance</video:title>
      <video:description>Les hommes qui réussissent ont un point commun : ils prennent soin d&apos;eux. Chaque journée est une nouvelle occasion de donner le meilleur. Découvrez GIGANTX, le complément alimentaire pensé pour accompagner votre énergie, votre confiance et votre bien-être. Reprenez le contrôle. Révélez votre potentiel. Commandez dès aujourd&apos;hui et rejoignez des milliers d&apos;hommes qui ont choisi GIGANTX. https://nplink.net/0pcaf6rw Chaque jour où vous attendez est un jour où vous repoussez votre évolution. #devenezrichetémoignagesclientsbusiness240croissance</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396597/3396597_720p.mp4</video:content_loc>
      <video:duration>89</video:duration>
      <video:publication_date>2026-09-02T02:42:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gatos levando sustos com pepino</video:title>
      <video:description>#gatoslevandosustoscompepino</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396596/3396596_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-02T02:41:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>part selanjutnya 65</video:title>
      <video:description>dramachina #fyp</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396595/3396595_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-02T02:41:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUANDO A CHUVA CHEGA EM JANEIRO NOSERTÃO SERTANEJO NORDESTINO</video:title>
      <video:description>QUANDO A CHUVA CHEGA EM JANEIRO NOSERTÃO SERTANEJO NORDESTINO ADAPTAÇÃO JM XAVIER #SERTANEJO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396594/3396594_720p.mp4</video:content_loc>
      <video:duration>271</video:duration>
      <video:publication_date>2026-09-02T02:41:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING TSUNAMI 13</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396593/3396593_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:41:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny videos</video:title>
      <video:description>Sekedar hiburan #Video #funny #news</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396592/3396592_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T02:41:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vinho 2</video:title>
      <video:description>#Gato #vinho</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396591/3396591_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-02T02:41:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Amazon Flood Practical Effects 3</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396590/3396590_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:41:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Que Fazer Se Seu Amor Beijar Outro</video:title>
      <video:description>Blog https://comparadorinteligente.com.br</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396589/3396589_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-02T02:40:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dê uma olhada em Mop Giratório 360 Cabo 140cm Balde Centrífuga Cesto Inox 14L 2 Refis Microfibra Esf</video:title>
      <video:description>AJF-VUC-PRL Insira esse código na shoppee https://s.shopee.com.br/1BM135tGiD #Vendas #shoppee #produtos #ecommerce #comércioeletrônico</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396587/3396587_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-02T02:40:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful muslim couple in golden yellow — traditional village (atau) Elegant Islamic couple — tradi</video:title>
      <video:description>Beautiful muslim couple in matching golden yellow traditional clothes. Elegant woman in hijab and man in traditional attire, in front of a beautiful bamboo house surrounded by flowers. Peaceful and blessed traditional Indonesian village life. #muslimcouple #goldenyellow #traditional #bamboohouse #islamic #indonesia #culture #elegant #village #hijab #traditionalclothing</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396586/3396586_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T02:40:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dar valor a pessoas especiais</video:title>
      <video:description>Dar valor a pessoas especiais #Pessoasespeciais</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396585/3396585_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T02:40:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>What If the Internet Suddenly Disappeared Worldwide? The First 24 Hours</video:title>
      <video:description>Imagine waking up tomorrow and discovering that the internet has completely disappeared — everywhere on Earth. No websites. No social media. No online banking. No instant messaging. No cloud services. No GPS-dependent apps. Billions of people and businesses would suddenly lose access to the digital infrastructure they depend on every day. But what would happen next? In this video, we explore what could happen during the first hours, days, and weeks of a worldwide internet blackout — from financial markets and banks to hospitals, transportation, communication, supply chains, governments, and everyday life. 🌐 What happens during the first minutes? 🏦 Could banks and financial markets stop functioning? ✈️ How would airlines and transportation be affected? 🏥 What would happen to hospitals and emergency services? 🚚 Could global supply chains collapse? 📡 How would billions of people communicate? 🌎 Could modern civilization function without the internet? The internet is invisible to most of us — until it disappears. If the entire world went offline tomorrow, how long could modern society keep functioning? #whatiftheinternetdisappeared #internetshutdown #globalinternetblackout #worldwideinternetoutage #internetblackout #whathappensiftheinternetgoesdown #worldwithoutinternet #internetcollapse #globalinternetcollapse #internetoutage #internetapocalypse #internetdisaster #globalblackout #digitalblackout #internetfailure #internetgoesdown #internetstoppedworking #lifewithoutinternet #whatiftheinternetstopped #internetshutdownexplained #globalinternetshutdown #internetcrisis #digitalcrisis #technologycrisis #globaltechnologycrisis #internetinfrastructure #globalcommunication #bankingwithoutinternet #bankswithoutinternet #financialsystemcollapse #stockmarketshutdown #hospitalswithouti</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396584/3396584_720p.mp4</video:content_loc>
      <video:duration>428</video:duration>
      <video:publication_date>2026-09-02T02:40:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DJ Part-Time aux Mariages_ Son Business de Photobooth Viral!</video:title>
      <video:description>Les hommes qui réussissent ont un point commun : ils prennent soin d&apos;eux. Chaque journée est une nouvelle occasion de donner le meilleur. Découvrez GIGANTX, le complément alimentaire pensé pour accompagner votre énergie, votre confiance et votre bien-être. Reprenez le contrôle. Révélez votre potentiel. Commandez dès aujourd&apos;hui et rejoignez des milliers d&apos;hommes qui ont choisi GIGANTX. https://nplink.net/0pcaf6rw Chaque jour où vous attendez est un jour où vous repoussez votre évolution. #DJPart-TimeMariagesSonBusinessPhotoboothViral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396583/3396583_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-02T02:39:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396582</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396582/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Bridge Collapse 8</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396582/3396582_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:39:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cerveja 2</video:title>
      <video:description>#Cerveja #garrafa #risada</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396581/3396581_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-02T02:39:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cuidado com o boi</video:title>
      <video:description>#Cuidadocomoboi</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396580/3396580_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T02:39:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>estrada velha</video:title>
      <video:description>🌾 Cuando la viola caipira habla, el corazón recuerda sus raíces. Un modão sertanejo lleno de saudade, amor por la fazenda, caballos, amaneceres y la fuerza de quienes viven del campo. Si esta canción tocó tu alma, dale Me Gusta, suscríbete y comparte para que el sertanejo raíz siga vivo. 🤠🎶🌅 #estradavelha #músicasertaneja #sertanejoraiz #sertanejoantigo #músicasertanejaantiga #sertanejoromântico #músicacaipira #modadeviola #violacaipira #estradadeterra #vidanocampo #saudadedopassado #lembrançasdeinfância #nostalgiasertaneja #históriasdointerior #amoresaudade #sertãobrasileiro #músicadointerior #sertanejoapaixonado #músicaromânticabrasileira #saudadedaroça #lembrançasdocampo #cançãosertaneja #músicaderaiz #sertanejotradicional</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396579/3396579_720p.mp4</video:content_loc>
      <video:duration>298</video:duration>
      <video:publication_date>2026-09-02T02:38:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rá vs. Apófis — E  Ra vs. Apophis: Battle</video:title>
      <video:description>Ra, the Sun God and creator of all, battles Apophis, the giant serpent of eternal darkness, every single night. While Ra brings light, life, and order to the universe, Apophis seeks to swallow the sun and return all creation to endless void and chaos. It is the ultimate struggle: existence itself against total destruction — and if Ra falls even once, everything vanishes forever. #Brasil #deuses #Thor #herói #chinaEgito</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396578/3396578_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-02T02:38:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Engarrafamento Nervoso</video:title>
      <video:description>ENGARRAFAMENTO NERVOSO! 🚗🚕🚙💥 Trânsito completamente parado, muita buzina e aquela tensão de quem só quer chegar ao destino! 😰🚦 Quem já ficou preso em um congestionamento desses sabe como é! 👀 Assista até o final e comenta: você teria paciência ou ficaria nervoso? 😂 #engarrafamentonervoso #trânsitopesado #congestionamento #trânsitocaótico #trânsitoparado #motoristas #buzina #trânsitobrasileiro #vídeodetrânsito #trânsitoaovivo #viral #vídeosvirai</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396577/3396577_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-02T02:38:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396576</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396576/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #30</video:title>
      <video:description>Pedalando para manter a forma #funny #fun #dog #dogs #dogshorts #cute #pets #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396576/3396576_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:38:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Dam Bursts Across Miniature Valley 4</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396575/3396575_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:37:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎵 DISCOVER CRISTIAN’S CHANNEL ON FEBSPOT! 🔥 Music, Curiosities &amp; MORE — FOLLOW NOW!</video:title>
      <video:description>Music, amazing curiosities, and entertaining content all in one place! 🎵✨ Discover Cristian’s channel on Febspot and enjoy music, interesting facts, entertaining videos, and fresh content made for anyone who loves discovering something new. 👉 Follow Cristian’s channel on Febspot and stay tuned for the next videos! 🔔 🎶 Music 🧠 Interesting Curiosities 🔥 Entertaining Videos ✨ Fresh Content 🌎 Something New to Discover Don’t miss out — visit the channel and follow now! #Cristian #CristianFebspot #Febspot #Febspotchannel #music #musicvideos #newmusic #bestmusic #interestingfacts #curiosities #amazingfacts #funfacts #entertainment #entertainingvideos #viralvideos #interestingvideos #musicandcuriosities #digitalcreator #contentcreator #Braziliancreator #newcontent #followCristian #Febspotmusic #Febspotvideos #discovernewmusic #musicchannel #curiositychannel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396574/3396574_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T02:37:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kit de carpete</video:title>
      <video:description>#Carro</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396573/3396573_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T02:37:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 10</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396572/3396572_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:37:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coelho 2</video:title>
      <video:description>#Desenho #coelho #engraçado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396571/3396571_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T02:37:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING DESERT EXPLOSIONS 10</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396570/3396570_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:36:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Izingane zesthembu Episode 3 season 4 Reality TV show About polygamy kids growing up</video:title>
      <video:description>IZINGANE ZESITHEMBU a reality show from the South Africans richest polygamist Mr Mseleku, watch as his kids from five wives delicate the everyday life challenges of growing up jn south Africa #Viral #digital #production #TVshows #realityshows #drama #entertainment</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396569/3396569_720p.mp4</video:content_loc>
      <video:duration>1355</video:duration>
      <video:publication_date>2026-09-02T02:36:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 9</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396568/3396568_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Maravilha de Deus 🙏🏽🙌🏽☺️🥰</video:title>
      <video:description>#Praia #viagem #turismo #férias #Descanso #lazer #refúgio</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396567/3396567_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T02:36:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dropshipping &amp; IA _ L&apos;opportunité immense en 2026</video:title>
      <video:description>Les hommes qui réussissent ont un point commun : ils prennent soin d&apos;eux. Chaque journée est une nouvelle occasion de donner le meilleur. Découvrez GIGANTX, le complément alimentaire pensé pour accompagner votre énergie, votre confiance et votre bien-être. Reprenez le contrôle. Révélez votre potentiel. Commandez dès aujourd&apos;hui et rejoignez des milliers d&apos;hommes qui ont choisi GIGANTX. https://nplink.net/0pcaf6rw Chaque jour où vous attendez est un jour où vous repoussez votre évolution. #DropshippingIALopportunitéimmense</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396566/3396566_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-02T02:36:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Mountain Village Avalanche Sequence 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396565/3396565_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:35:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #29</video:title>
      <video:description>Gato voador!!! #funny #fun #cat #cats #gatinhos #catshorts #cute #pets #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396564/3396564_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T02:35:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 26</video:title>
      <video:description>Rir #Canadá #ReinoUnido #Eua #Austrália #Brasil #NovaZelândiaeregiõesgeográficaspremiumselecionadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396563/3396563_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T02:35:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 8</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396562/3396562_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:35:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Secrets of the Knights Templar: The Mystery Behind the Legendary Order 2</video:title>
      <video:description>For nearly two centuries, the Knights Templar stood among the most powerful and mysterious organizations of the Middle Ages. Founded to protect pilgrims traveling to the Holy Land, the Templars became incredibly wealthy and influential — before suddenly being arrested, persecuted, and officially disbanded in the early 14th century. But what happened to their legendary treasure? Did they really discover ancient secrets beneath the Temple Mount? And what became of the Templars after their dramatic fall? In this video, we explore the most fascinating mysteries surrounding the Knights Templar, separating historical evidence from legends that have survived for centuries. ⚔️ The rise of the Knights Templar 🏰 Their enormous wealth and hidden treasures 📜 The mysterious accusations against the Order 🗝️ Lost treasures and secret documents ⛪ Their connection to ancient religious sites 👁️ The legends surrounding their disappearance The Templars left behind more questions than answers — and their story continues to inspire historians, explorers, and mystery seekers around the world. What did the Knights Templar really know… and what secrets disappeared with them? #knightstemplar #templarknights #knightstemplarsecrets #knightstemplarmysteries #templarssecrets #templarsecrets #knightstemplartreasure #templartreasure #losttemplartreasure #knightstemplarhistory #knightstemplardocumentary #knightstemplarexplained #mysteryoftheknightstemplar #templarmystery #templarmysteries #secretsofthetemplars #hiddensecretsofthetemplars #templartreasuremystery #losttreasures #medievalmysteries #medievalhistory #ancientmysteries #secretsocieties #mysteriousorganizations #templarlegends #knightstemplarlegends #templarconspiracy #templarconspiracytheories #holygrailtemplars #templarsandtheholygrail #temp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396561/3396561_720p.mp4</video:content_loc>
      <video:duration>360</video:duration>
      <video:publication_date>2026-09-02T02:35:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro praiano cia de rodeio guto paglioni!   Praiano Bull – Guto Paglioni Rodeo Company</video:title>
      <video:description>Touro praiano cia de rodeio guto paglioni! Praiano Bull – Guto Paglioni Rodeo Company</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396560/3396560_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-02T02:34:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING  CITY 3</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396559/3396559_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:34:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>（AI）独立劇集特撮：女性実験体仮面ライダ</video:title>
      <video:description>（AI）独立劇集特撮：女性実験体仮面ライダ #（AI）独立劇集特撮：女性実験体仮面ライダ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396558/3396558_720p.mp4</video:content_loc>
      <video:duration>1845</video:duration>
      <video:publication_date>2026-09-02T02:34:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 7</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396557/3396557_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:34:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bora Rir!  Divirta-se - Funny Pets #28</video:title>
      <video:description>Pegando uma carona!!! #funny #fun #cat #cats #gatinhos #catshorts #cute #pets #funnypets #funnyanimals #animals #animalshort #funnyshorts #babypets #funnyvideos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396556/3396556_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:34:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Professora 2</video:title>
      <video:description>#Professora #quadro #giz</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396555/3396555_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-02T02:34:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muita ventania</video:title>
      <video:description>Vento forte em tangará da serra Mato Grosso #vento</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396554/3396554_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-02T02:34:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Airport Runway Disaster Effects Test 3</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396553/3396553_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:34:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>part selanjutnya 64</video:title>
      <video:description>drama china #fyp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396552/3396552_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-02T02:34:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>eua26</video:title>
      <video:description>eua #eua26</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396551/3396551_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-02T02:33:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 6</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396550/3396550_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:33:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 25</video:title>
      <video:description>Rir #Canadá #ReinoUnido #Eua #Austrália #NovaZelândiaeregiõesgeográficaspremiumselecionadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396549/3396549_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T02:33:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING TSUNAMI 18</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396548/3396548_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:33:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Silk blockbuster dance performance 🔥🔥</video:title>
      <video:description>Silk blockbuster dance performance 🔥🔥 mujra masti video</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396547/3396547_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T02:33:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BRO THINKS HE IS MBAPPE 🤣</video:title>
      <video:description>. #soccer #Soccerfootball</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396546/3396546_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:33:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lokasi pemancingan bawal</video:title>
      <video:description>Pemancingan ikan bawal #Ikanbawal #pemancingan #mancingmania</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396545/3396545_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T02:33:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 24</video:title>
      <video:description>Rir #Canadá #ReinoUnido #Eua #Austrália #NovaZelândiaeregiõesgeográficaspremiumselecionadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396544/3396544_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-02T02:33:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396543</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396543/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING Village Avalanche 5</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396543/3396543_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:32:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>rancho antigo</video:title>
      <video:description>🏡🌾 &quot;Rancho Antigo&quot; es un viaje al corazón del campo brasileño. Una canción llena de saudade, recuerdos, familia y el amor eterno por las raíces, con la inconfundible emoción de la viola caipira. Si esta historia llegó a tu corazón, dale Me Gusta, suscríbete y compártela para que el sertanejo raíz siga emocionando generaciones. 🤠🎻🇧🇷 #ranchoantigo #músicasertaneja #sertanejoantigo #sertanejoraiz #músicasertanejaantiga #sertanejoromântico #músicacaipira #modadeviola #músicadointerior #vidanocampo #saudadedorancho #lembrançasdopassado #amornocampo #históriasdosertão #violacaipira #músicabrasileira #nostalgiasertaneja #sertanejoapaixonado #sertanejotradicional #músicasromânticasbrasileiras</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396542/3396542_720p.mp4</video:content_loc>
      <video:duration>327</video:duration>
      <video:publication_date>2026-09-02T02:32:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 5</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396541/3396541_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:32:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brasil 5</video:title>
      <video:description>#Brasil #cantar #pessoas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396540/3396540_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T02:32:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING VOLCANO ERUPTION 9</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396539/3396539_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:32:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Veja como ela alcançou zonas tão distante!😆😅🥰</video:title>
      <video:description>Assista o vídeo até ao final, e veja a surpresa que lhe aconteceu 😂 #Alcance #surpresadistante</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396538/3396538_720p.mp4</video:content_loc>
      <video:duration>338</video:duration>
      <video:publication_date>2026-09-02T02:32:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Foi só uma botadinha amor</video:title>
      <video:description>E tu ja se apaixonou euta</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396537/3396537_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:32:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DLS - Jogo Contra os melhores da África</video:title>
      <video:description>Esse jogo no DLS foi pegado, mas com o melhor time possível, da para ganhar. #DLS #Jogos #Futebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396536/3396536_720p.mp4</video:content_loc>
      <video:duration>224</video:duration>
      <video:publication_date>2026-09-02T02:31:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vida de professor</video:title>
      <video:description>#Humor</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396535/3396535_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T02:31:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 4</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396534/3396534_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:31:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 23</video:title>
      <video:description>Rir #Canadá #ReinoUnido #Austrália #NovaZelândiaeregiõesgeográficaspremiumselecionadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396533/3396533_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:31:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minha mãe não tva esperando por essa</video:title>
      <video:description>Um susto de leve na minha mãe kkkkk #Brincadeira</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396532/3396532_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T02:31:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJY-NBZ-YJP  Insira este código na barra de pesquisa para achar o produto. #shopee</video:title>
      <video:description>CJY-NBZ-YJP Insira este código na barra de pesquisa para achar o produto. #shopee #Vendas #shoppee #produtos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396531/3396531_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T02:31:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro mundo acabado, cia de rodeio california! Bull Mundo Acabado, Califórnia Rodeo Company!!</video:title>
      <video:description>Touro mundo acabado, cia de rodeio california! Bull Mundo Acabado, Califórnia Rodeo Company!!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396530/3396530_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T02:31:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Humor 25</video:title>
      <video:description>#Risadas #humor</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396529/3396529_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-02T02:31:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>part selanjutnya 63</video:title>
      <video:description>drama china #fyp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396528/3396528_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-02T02:30:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Izingane zesthembu Episode 2 season 4</video:title>
      <video:description>Mseleku Izingane Zes’thembu DRAMA 😱 Things Get Tense in the Mseleku Famil #TVrealityshow #shows #drama #reality #viralvideo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396527/3396527_720p.mp4</video:content_loc>
      <video:duration>2121</video:duration>
      <video:publication_date>2026-09-02T02:30:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 22</video:title>
      <video:description>Rir #Canadá #ReinoUnido #Austrália #NovaZelândiaeregiõesgeográficaspremiumselecionadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396526/3396526_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T02:30:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 3</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396525/3396525_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:30:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING FLOODS ON UNDERGROUND 1</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396524/3396524_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:30:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 21</video:title>
      <video:description>Rir #Canadá #ReinoUnido #Austrália #NovaZelândiaeregiõesgeográficaspremiumselecionadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396523/3396523_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:30:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FORTALEZA E ceará</video:title>
      <video:description>Menor em tudo meu rival kkkkkkk #Futebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396522/3396522_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T02:30:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New season new look 🤧</video:title>
      <video:description>Subscribe. #Soccer</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396521/3396521_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T02:29:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 20</video:title>
      <video:description>Rir #Canadá #ReinoUnido #Austrália #NovaZelândiaeregiõesgeográficaspremiumselecionadas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396520/3396520_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T02:29:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carro 7</video:title>
      <video:description>#Carro #trator</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396519/3396519_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T02:29:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Collapse of the Global Economy: Are We Heading Toward a Financial Crisis?</video:title>
      <video:description>The global economy is more interconnected than ever — but what happens when the system begins to break down? From rising debt and inflation to financial instability, geopolitical tensions, banking crises, and fragile markets, several warning signs can raise an unsettling question: How vulnerable is the global economy to a major collapse? In this video, we explore how a global economic crisis could unfold, what factors could trigger it, how financial markets and banks might be affected, and what history can teach us about the consequences of major economic downturns. 💰 The hidden vulnerabilities of the global economy 🏦 Could a banking crisis trigger a worldwide collapse? 📉 What happens when financial markets crash? 🌎 How interconnected economies amplify crises 💵 The impact of debt, inflation, and currency instability ⚠️ What a global financial collapse could mean for ordinary people A global economic collapse may sound like something from a dystopian movie — but understanding the risks can help us understand how modern economies really work. Are we witnessing the warning signs of the next great financial crisis? #globaleconomiccollapse #globaleconomy #economiccollapse #globalfinancialcrisis #financialcrisis #economiccrisis #globaleconomiccrisis #worldeconomy #globaleconomycollapse #economiccollapseexplained #financialcollapse #globalfinancialcollapse #economiccrisisexplained #worldfinancialcrisis #globalrecession #economicrecession #financialmarketcrash #stockmarketcrash #bankingcrisis #bankcollapse #inflation #globalinflation #nationaldebt #globaldebt #debtcrisis #currencycrisis #economicinstability #financialinstability #globalmarkets #stockmarket #economyexplained #economics #financialsystem #globalfinancialsystem #economicdisaster #financialdisaster #recessionexplain</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396518/3396518_720p.mp4</video:content_loc>
      <video:duration>341</video:duration>
      <video:publication_date>2026-09-02T02:29:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K 2</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarsSportsCarsCarsAutomotiveEngineSoundCars4KNightCars</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396517/3396517_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:29:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Amazon Flood Practical Effects 4</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396516/3396516_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:29:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMAKING FIRE IN THE CITY</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396514/3396514_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:28:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lençóis Maranhenses: Um Paraíso de Lagoas e Dunas</video:title>
      <video:description>Imagine o deserto encontrando o céu: as dunas dos Lençóis Maranhenses revelam lagoas de águas cristalinas, formando uma paisagem surreal. No vídeo, você atravessa os lençóis, mergulha nas lagoas, caminha entre as dunas e fecha com o pôr do sol perfeito no horizonte. Venha sentir esse destino único! #LençóisMaranhenses #Viagem #TurismoNacional #Natureza #Ecoturismo #Dunas #Lagoas #PôrDoSol #Brasil #Lençóis</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396513/3396513_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-02T02:28:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nasceu o bebê da Pêssega e do laranja</video:title>
      <video:description>#Novelas #frutas #histórias #fyp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396512/3396512_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-02T02:28:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inter 5</video:title>
      <video:description>#Inter #time</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396511/3396511_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-02T02:28:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RAWAL PINDI FLOOD</video:title>
      <video:description>RAJA BAZAR I LIKE RIVER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396510/3396510_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-02T02:27:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LANÇAMENTO DO HINO Ó MEU SENHOR JESUS QUE ESTÁ VOLTANDO</video:title>
      <video:description>QUERIDOS IRMÃOS ESTOU PRECISANDO DE PATROCINADOR PRA MIM REGRAVAR NA MK MUSIC NO RIO DE JANEIRO ME AJUDE #hino #lançamento #brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396509/3396509_720p.mp4</video:content_loc>
      <video:duration>249</video:duration>
      <video:publication_date>2026-09-02T02:27:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Assista ao vídeo, concentre seu olhar no centro da espiral.</video:title>
      <video:description>Assista ao vídeo, concentre seu olhar no centro da espiral.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396508/3396508_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-02T02:27:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING TSUNAMI 25</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396507/3396507_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:26:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You Were My Home ❤️ | Emotional Romantic Lofi Song — Lofi Man</video:title>
      <video:description>Some people become more than a part of your life. They become home. “You Were My Home” is an original emotional romantic lofi song about remembering a love that made ordinary moments feel special — and learning to be grateful even after the relationship ends. For everyone who has ever looked back at an old photograph and remembered how it felt to love someone completely. 🎧 Lofi Man — Music for the moments words can&apos;t explain. 💔 Previous song: “The Last Message” Subscribe to Lofi Man for new original songs every week. Music and visual elements created with the assistance of generative AI under original creative direction for Lofi Man. #LofiMan #lofimusic #romanticsongs #lovesongs #sadsongs #emotionalmusic #relaxingmusic #chillmusic #originalsongs #aimusic #músicasromânticas #músicasdeamor #músicastristes #músicasemocionantes #músicagospel #louvor #músicasparaorar #músicasparadormir #músicaspararelaxar #músicaparamadrugada #heartbreaksongs #lovemusic #christianmusic #gospelsongs #relaxingsongs #animelofi #lofigirl</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396506/3396506_720p.mp4</video:content_loc>
      <video:duration>245</video:duration>
      <video:publication_date>2026-09-02T02:26:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grêmio 4</video:title>
      <video:description>#Grêmio #time</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396505/3396505_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T02:26:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING VOLCANO ERUPTION 10</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396504/3396504_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:26:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Melhores Momentos de Humor (Kaue e sua Mãe) Humor Viral</video:title>
      <video:description>Melhores Momentos de Humor #Comedy #humor #risadas #gargalhadas #rir</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396503/3396503_720p.mp4</video:content_loc>
      <video:duration>1078</video:duration>
      <video:publication_date>2026-09-02T02:26:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Izingane-Zesthembu-Season-4-Episode-1-Tv reality show</video:title>
      <video:description>Tensions rise as Lwandle chooses his own path, despite his family&apos;s objections. 🙆‍♀️ Catch #IzinganeZeSthembu​ . #tvrealityshow #shows #viral #digital</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396502/3396502_720p.mp4</video:content_loc>
      <video:duration>1931</video:duration>
      <video:publication_date>2026-09-02T02:26:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro Comanche, cia de rodeio André de mogi! Comanche the bull, André de Mogi Rodeo Company!</video:title>
      <video:description>Touro Comanche, cia de rodeio André de mogi! Comanche the bull, André de Mogi Rodeo Company!</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396501/3396501_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-02T02:25:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cria em mim um coração adorador | Oração para Buscar a Deus de Todo Coração</video:title>
      <video:description>Senhor, limpa o meu coração de tudo o que me afasta da Tua presença e renova em mim o desejo ardente de Te buscar. Muitas vezes, a rotina, as preocupações e as distrações do dia a dia tentam esfriar a nossa fé. Mas hoje, fazemos esta oração com um coração sincero: &quot;Deus, transforma a minha vida e cria em mim um coração que Te busca de todo o coração!&quot; Se você sente que precisa renovar suas forças, aproximar-se mais de Deus e viver uma entrega sincera, medite assistindo este vídeo Jeremias vinte e nove versículo treze – &quot;Buscar-me-eis e me achareis quando me buscardes de todo o vosso coração.&quot; Inscreva-se no canal para não perder nenhum momento de oração e edificação! Deixe seu Like se esta oração abençoou a sua vida. Escreva nos comentários: &quot;Senhor, meu coração pertence a Ti!&quot; Compartilhe este vídeo com alguém que precisa dessa palavra hoje. #OraçãoDeusIntimidadeComDeusFéDevocionalPalavraDeDeusTransformaçãoBuscaADeus</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396499/3396499_720p.mp4</video:content_loc>
      <video:duration>624</video:duration>
      <video:publication_date>2026-09-02T02:25:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING DESERT EXPLOSIONS 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396498/3396498_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:25:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best and transitions football 💀</video:title>
      <video:description>Subscribe.. #Soccer</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396497/3396497_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T02:25:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dois tipos de pessoas</video:title>
      <video:description>Humor quem vc é</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396496/3396496_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T02:25:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CYBERLEEK ARRESTED MEME</video:title>
      <video:description>CYBERLEEK #CYBERLLER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396495/3396495_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T02:25:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>(Monster coming off the wall)</video:title>
      <video:description>#Monstercomingoffthewall</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396494/3396494_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-02T02:24:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING TSUNAMI 16</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396493/3396493_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:24:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Príncipe encantado</video:title>
      <video:description>Príncipe encantado #Alegria</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396491/3396491_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T02:23:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Container Port Storm Simulation 1</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396490/3396490_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:23:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hilarious videos that will make you die of laughter</video:title>
      <video:description>Hilarious videos that will make you die of laughter #humorfunnyvideos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396489/3396489_720p.mp4</video:content_loc>
      <video:duration>1405</video:duration>
      <video:publication_date>2026-09-02T02:23:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filho Do CEO que era calado chamou a entregadora de mãe  e todos ficarão chocado 🤯</video:title>
      <video:description>#Surpresa #carinho *minmo #surpresacarinhocasamento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396488/3396488_720p.mp4</video:content_loc>
      <video:duration>7989</video:duration>
      <video:publication_date>2026-09-02T02:22:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pirates of The Caribbean - He&apos;s a Pirate/Davy Jones // Danish National Symphony Orchestra</video:title>
      <video:description>A breathtaking orchestral performance conducted by the Danish National Symphony Orchestra, bringing to life the iconic themes He&apos;s a Pirate and Davy Jones with epic arrangements, intense drama, and exceptionally high-level execution. #PiratesOfTheCaribbeanDanishNationalSymphonyOrchestraHesAPirateDavyJonesHansZimmer</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396487/3396487_720p.mp4</video:content_loc>
      <video:duration>283</video:duration>
      <video:publication_date>2026-09-02T02:22:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Can’t Wait for GTA 6! 🔥🎮</video:title>
      <video:description>The hype is unreal! 🔥 I’m counting down the days until the release of GTA 6. New cities, new characters, new adventures… I seriously can’t wait to play! 🚗💨💥 Who else is excited for GTA 6? 🎮🔥 . . . . . #Thehypeisunreal🔥I’mcountingdownthedaysuntilthereleaseofGTA6Newcities #newcharacters #newadventures…Iseriouslycan’twaittoplay🚗GTA6GrandTheftAutoVIGTAVIGamingGamerRockstarGamesVideoGamesGTAVIHype</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396486/3396486_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-02T02:22:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Professora</video:title>
      <video:description>O melhor trabalho do mundo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396485/3396485_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T02:22:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396484</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396484/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Professor 4</video:title>
      <video:description>Professor fofinho demais, cultura é oque ele ama, aprender e ler incrível como é fofinho #Cultura #anime #história #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396484/3396484_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:22:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Messi 99</video:title>
      <video:description>🔥 Messi em ação! ⚽🐐 Confira os melhores momentos, dribles e jogadas de Lionel Messi! 🇦🇷🔥 #MessiLionelMessiMessiHighlightsMessiGoalsMessiGameMessiSkillsMessiMagicFootballSoccerArgentinaInterMiamiGOATFootballHighlightsFutebolMessiFans</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396483/3396483_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T02:22:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Amazon Flood Practical Effects 1</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396482/3396482_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:22:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MESA PREPARADA COM O SENHOR JESUS</video:title>
      <video:description>LOUVANDO AO SENHOR JESUS NA FSZENDA #viagem #fazenda #brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396481/3396481_720p.mp4</video:content_loc>
      <video:duration>202</video:duration>
      <video:publication_date>2026-09-02T02:21:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mensagem 5</video:title>
      <video:description>Lição aprender de Deus</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396480/3396480_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-02T02:21:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Airport Runway Disaster Effects Test 1</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396479/3396479_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:21:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396478</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396478/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Please 15</video:title>
      <video:description>Please</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396478/3396478_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:21:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIVERSAO</video:title>
      <video:description>#DIVERSAO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396477/3396477_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T02:20:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING  CITY 4</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396476/3396476_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:20:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brasil futebol</video:title>
      <video:description>Fortaleza Ce</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396475/3396475_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T02:20:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396474</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396474/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Secrets of the Knights Templar: The Mystery Behind the Legendary Order</video:title>
      <video:description>For nearly two centuries, the Knights Templar stood among the most powerful and mysterious organizations of the Middle Ages. Founded to protect pilgrims traveling to the Holy Land, the Templars became incredibly wealthy and influential — before suddenly being arrested, persecuted, and officially disbanded in the early 14th century. But what happened to their legendary treasure? Did they really discover ancient secrets beneath the Temple Mount? And what became of the Templars after their dramatic fall? In this video, we explore the most fascinating mysteries surrounding the Knights Templar, separating historical evidence from legends that have survived for centuries. ⚔️ The rise of the Knights Templar 🏰 Their enormous wealth and hidden treasures 📜 The mysterious accusations against the Order 🗝️ Lost treasures and secret documents ⛪ Their connection to ancient religious sites 👁️ The legends surrounding their disappearance The Templars left behind more questions than answers — and their story continues to inspire historians, explorers, and mystery seekers around the world. What did the Knights Templar really know… and what secrets disappeared with them? #knightstemplar #templarknights #knightstemplarsecrets #knightstemplarmysteries #templarssecrets #templarsecrets #knightstemplartreasure #templartreasure #losttemplartreasure #knightstemplarhistory #knightstemplardocumentary #knightstemplarexplained #mysteryoftheknightstemplar #templarmystery #templarmysteries #secretsofthetemplars #hiddensecretsofthetemplars #templartreasuremystery #losttreasures #medievalmysteries #medievalhistory #ancientmysteries #secretsocieties #mysteriousorganizations #templarlegends #knightstemplarlegends #templarconspiracy #templarconspiracytheories #holygrailtemplars #templarsandtheholygrail #temp</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396474/3396474_720p.mp4</video:content_loc>
      <video:duration>339</video:duration>
      <video:publication_date>2026-09-02T02:20:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Last Message 💔 | Emotional Heartbreak Lofi Song — Lofi Man</video:title>
      <video:description>Sometimes the hardest goodbye is the one that comes through a message. “The Last Message” is an original emotional heartbreak lofi song about receiving a final message from someone you still love — and realizing that sometimes love remains even when the relationship has to end. Listen with headphones and let the rain tell the rest of the story. 🎧 Lofi Man — Music for the moments words can&apos;t explain. ❤️ Previous song: “I Still Love You” Subscribe to Lofi Man for new original songs every week. Music and visual elements created with the assistance of generative AI under original creative direction for Lofi Man. #LofiMan #lofimusic #romanticsongs #lovesongs #sadsongs #emotionalmusic #relaxingmusic #chillmusic #originalsongs #aimusic #músicasromânticas #músicasdeamor #músicastristes #músicasemocionantes #músicagospel #louvor #músicasparaorar #músicasparadormir #músicaspararelaxar #músicaparamadrugada #heartbreaksongs #lovemusic #christianmusic #gospelsongs #relaxingsongs #animelofi #lofigirl</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396473/3396473_720p.mp4</video:content_loc>
      <video:duration>303</video:duration>
      <video:publication_date>2026-09-02T02:20:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING DESERT EXPLOSIONS 6</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396472/3396472_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:20:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neymar skills 2013 ☠💀</video:title>
      <video:description>Subscribe.. #Soccer</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396471/3396471_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:19:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tigre tenta atacar homem</video:title>
      <video:description>#Tigretentaatacarhomem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396470/3396470_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T02:19:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING  CITY 6</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396469/3396469_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:19:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thailand pattaya Street</video:title>
      <video:description>#tailandia #Street #soi5 #soi6 #girl #mulhere #rua #pattaya</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396468/3396468_720p.mp4</video:content_loc>
      <video:duration>1802</video:duration>
      <video:publication_date>2026-09-02T02:19:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396467</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396467/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu Coração Ainda Chama Você ❤️ | Uma História de Amor, Saudade e Reencontro | Música Romântica</video:title>
      <video:description>❤️ MEU CORAÇÃO AINDA CHAMA VOCÊ Você já tentou seguir em frente... mas percebeu que seu coração ainda chamava por alguém? &quot;Meu Coração Ainda Chama Você&quot; é uma música romântica original do Carmo Studio sobre saudade, amor verdadeiro e aquele sentimento que o tempo não conseguiu apagar. A vida continuou. Os dias passaram. Novos caminhos apareceram. Mas algumas lembranças permanecem. Um sorriso. Uma voz. Um lugar. Uma fotografia. Uma música que traz de volta tudo aquilo que você tentou guardar no passado. Porque existem pessoas que podem sair da nossa rotina... Mas nunca saem completamente do nosso coração. Essa é uma história sobre duas pessoas que seguiram caminhos diferentes, mas descobriram que alguns sentimentos continuam vivos mesmo depois da distância. E talvez o destino ainda tenha uma última surpresa. 🎧 Coloque os fones, aumente o volume e deixe essa história tocar sua alma. #meucoraçãoaindachamavocê #meucoracaoaindachamavoce #músicaromântica #musicaromantica #músicadeamor #musicadeamor #históriadeamor #historiadeamor #saudade #amoresaudade #amorverdadeiro #amorperdido #amorquepermanece #reencontro #reencontrodeamor #voltapramim #voltepramim #amoreterno #casalapaixonado #romance #músicaemocionante #musicaemocionante #baladaromântica #baladaromantica #musicaoriginal #carmostudio #lovesong #romanticsong</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396467/3396467_720p.mp4</video:content_loc>
      <video:duration>480</video:duration>
      <video:publication_date>2026-09-02T02:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING Village Avalanche 3</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396466/3396466_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:18:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Serena Williams: Believe in yourself, even when nobody else does. 013</video:title>
      <video:description>Jackie Chan: Every setback is another chance to become stronger. #music</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396464/3396464_720p.mp4</video:content_loc>
      <video:duration>162</video:duration>
      <video:publication_date>2026-09-02T02:18:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Almost Healed</video:title>
      <video:description>#music #song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396463/3396463_720p.mp4</video:content_loc>
      <video:duration>201</video:duration>
      <video:publication_date>2026-09-02T02:18:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lenda Viking &amp; Tradição An ancestral</video:title>
      <video:description>Sob o gelo e a neve das terras do Norte, as pedras antigas recordam a força daqueles que vieram antes. Diante das estátuas dos velhos deuses e gigantes, uma guerreira Viking mantém viva a chama dos seus antepassados. Nenhuma tempestade ou inverno eterno conseguirá apagar a memória e o espírito daqueles que resistem. Assista a esta jornada épica pelas montanhas geladas, acompanhada por uma poderosa canção nórdica sobre honra, família e sobrevivência. #viking #norsesong #nordicmusic #vikingwarrior #vikingwoman #norsemythology #epicmusic #folkmusic #shieldmaiden #wintervibe #fantasymusic #ancientgiants #frozenlandscape #vikinglore #cinematicvideo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396462/3396462_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-09-02T02:18:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Airport Runway Disaster Effects Test 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396461/3396461_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:18:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita fitness com ovos</video:title>
      <video:description>Venha conferir uma receita fácil ,Fitness e bem saborosa para dia a dia . #receitasreceitasemaltareceitasfitness</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396460/3396460_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T02:18:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396459</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396459/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Denzel Washington: Stay focused, work hard, and trust your purpose. 012</video:title>
      <video:description>Arnold Schwarzenegger: Success comes from showing up every day. #music</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396459/3396459_720p.mp4</video:content_loc>
      <video:duration>155</video:duration>
      <video:publication_date>2026-09-02T02:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396458</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396458/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ponto de vista do avô</video:title>
      <video:description>Aquele tipo de avô que é antigo e tem muitas histórias #Família #cotidiano #avô #histórias #humor #fy #react</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396458/3396458_720p.mp4</video:content_loc>
      <video:duration>93</video:duration>
      <video:publication_date>2026-09-02T02:17:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396457</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396457/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filmmaking Dam Bursts Across Miniature Valley 7</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396457/3396457_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:17:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396456</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396456/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viagem do equilíbrio</video:title>
      <video:description>Será que ela consegue fazer isso mesmo, incrível habilidade haaaaa #Confiança #anime #aventura #humor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396456/3396456_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:17:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396455</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396455/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Terrorista da tiro no próprio pé</video:title>
      <video:description>#Terroristadatironoprópriopé</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396455/3396455_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T02:17:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396454</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396454/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING FLOODS ON UNDERGROUND 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396454/3396454_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:17:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING VOLCANO ERUPTION 11</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396453/3396453_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:16:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396452</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396452/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A resenha foi grande chega kkk</video:title>
      <video:description>A resenha foi grande chega kkk</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396452/3396452_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-02T02:16:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396451</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396451/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best goals 2025</video:title>
      <video:description>#soccer</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396451/3396451_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T02:16:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396450</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396450/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING  CITY 2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396450/3396450_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:16:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌈 VAI PRA FAZENDA DESCANSAR E PESCAR DEPOIS VOLTA PRA GANHAR ALMAS PRA JESUS</video:title>
      <video:description>Fazenda #viagem #brasil #goiás</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396449/3396449_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T02:16:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K</video:title>
      <video:description>MATTE BLACK SUPERCAR AT NIGHT 🖤🔥 | Engine Sound + Highway in 4K #SupercarrosCarrosEsportivosCarrosAutomotivoSomDoMotorCarros4KCarrosNoturnos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396448/3396448_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T02:15:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comédia jeito Diferente O Velho mais Novo</video:title>
      <video:description>Comédia jeito Diferente O Velho mais Novo Mais Novo Personagem Comédia de Elvis Amaral &quot;Comediante, contando piadas e histórias. O Velho mais Novo que você vai conhecer, porque idade é só um detalhe quando se tem bom humor!&quot; VEM COMÉDIA DIFERENTE AGORA BEM AI INSCREVA - SE #Comédia #Humor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396447/3396447_720p.mp4</video:content_loc>
      <video:duration>468</video:duration>
      <video:publication_date>2026-09-02T02:15:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396446</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396446/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING  2</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396446/3396446_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:15:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMAKING DESERT EXPLOSIONS</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396445/3396445_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:15:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>👉 COMO ENCONTRAR JOGADORES BONS E BARATOS NO FM26 (GUIA COMPLETO)</video:title>
      <video:description>🔥 OS MELHORES JOGADORES BONS E BARATOS NO FM26! (NÍVEL 13-14) 💰⚽ Nesse vídeo de Football Manager 2026, eu mostro como encontrar jogadores baratos, escondidos e com nível alto (13-14) para você montar um elenco forte sem gastar muito dinheiro! Se você quer ganhar partidas, montar um time competitivo e economizar nas transferências, esse vídeo é pra você! 👊 ⚽ O QUE VOCÊ VAI APRENDER: ✔ Como encontrar jogadores baratos no FM26 ✔ Jogadores com nível 13 e 14 que valem muito a pena ✔ Dicas de scouting para contratar melhor ✔ Como montar um elenco forte gastando pouco ✔ Estratégias para dominar o modo carreira 💰 POR QUE ISSO FUNCIONA? No FM26, muitos jogadores baratos têm potencial escondido, e com a estratégia certa você consegue montar um time muito forte sem gastar milhões! 🔥 ASSISTA ATÉ O FINAL Você vai ver jogadores que quase ninguém usa e que podem mudar seu time completamente! 📌 MAIS VÍDEOS DO CANAL: 👉 Dicas de tática FM26 👉 Jogadores bons e baratos 👉 Guias de carreira FM26 👉 Estratégias para ganhar mais jogos 💬 COMENTA AÍ: Qual jogador barato você já encontrou no FM26? 👇 🔔 INSCREVA-SE NO CANAL Se você curte Football Manager 26, dicas, táticas e scouting, se inscreve e ativa o sininho! 🚀 🏷️ HASHTAGS: #FM26FootballManager2026FM26DicasJogadoresBaratosFM26FM26CarreiraScoutingFM26FM26GuiaFM26Transferencias</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396444/3396444_720p.mp4</video:content_loc>
      <video:duration>1667</video:duration>
      <video:publication_date>2026-09-02T02:15:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Forróbodo</video:title>
      <video:description>Forróbodo música forró #Alegria</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396443/3396443_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-02T02:14:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O incrível benefício  da maça  para a saude</video:title>
      <video:description>Mostrando os benefícios que a maça traz para a sua saúde</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396442/3396442_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-02T02:14:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UMA TIGRESA VAI ALIMENTAR SEU FILHOTE</video:title>
      <video:description>Essa tigresa foi caçar pra alimentar seu filhote. #savana #tigre #filhote</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396441/3396441_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T02:14:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nostradamus: The Prophecies That Seem to Predict the Future</video:title>
      <video:description>For centuries, the name Nostradamus has been associated with some of the most mysterious prophecies in history. Born in 1503, the French astrologer and physician wrote hundreds of cryptic verses that many people believe predicted major events long after his death. But did Nostradamus really foresee the future — or have his words been interpreted after the events happened? In this video, we explore the most famous predictions attributed to Nostradamus, the strange connections people have made to historical events, and the mysteries surrounding his enigmatic writings. 🔮 Who was Nostradamus? 📜 What did his famous prophecies actually say? 🌎 Did he predict wars, disasters, and major historical events? 🧩 Why do his verses seem to match events centuries later? ⏳ Can Nostradamus really predict the future? Some predictions seem astonishing. Others may have very different explanations. Was Nostradamus truly seeing the future… or are we seeing the past through his words? #nostradamus #nostradamuspredictions #nostradamusprophecies #nostradamuspredictionsexplained #nostradamusprophecy #predictionsofnostradamus #nostradamusfuturepredictions #nostradamusmysteries #nostradamussecrets #famousnostradamuspredictions #nostradamusquatrains #nostradamuspropheciesexplained #nostradamus2026 #nostradamus2027 #predictionsaboutthefuture #futurepredictions #famousprophecies #mysteriousprophecies #unexplainedpredictions #historicalpredictions #propheticpredictions #predictionsthatcametrue #predictionsthatseemtohavecometrue #futureprophecy #prophecymysteries #mysteriouspredictions #ancientprophecies #historicalmysteries #unsolvedmysteries #mysterydocumentary #nostradamusdocumentary #whowasnostradamus #thepropheciesofnostradamus #didnostradamuspredictthefuture #nostradamusandthefuture #famousseers #p</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396440/3396440_720p.mp4</video:content_loc>
      <video:duration>381</video:duration>
      <video:publication_date>2026-09-02T02:14:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivação 52</video:title>
      <video:description>Miri #Motivação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396439/3396439_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-02T02:14:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Messi &amp; Neymar vs Fernandinho #football</video:title>
      <video:description>... #football</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396438/3396438_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T02:13:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HAQEEKAT</video:title>
      <video:description>REMEBAR ALWAS FOR YOUR SUCCESS</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396437/3396437_720p.mp4</video:content_loc>
      <video:duration>133</video:duration>
      <video:publication_date>2026-09-02T02:13:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Educação 2</video:title>
      <video:description>Todos estudando frutinhas fofinha #Educação #anime #história #humor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396434/3396434_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:12:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“The moment she hugged him, his heart started beating fast…!?” ❤️</video:title>
      <video:description>#Filme</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396433/3396433_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T02:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>الرجل_العنكبوت_انقاذ_باتمان_Spider-Man_Rescue_batman_vs_iron_man_vs_venom_funny_Game_GTA_5_superhero</video:title>
      <video:description>الرجل_العنكبوت_انقاذ_باتمان_Spider-Man_Rescue_batman_vs_iron_man_vs_venom_funny_Game_GTA_5_superhero</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396432/3396432_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-02T02:11:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Belezas do Litoral Brasileiro em Praias Incríveis</video:title>
      <video:description>Venha conhecer as belezas do litoral brasileiro! Neste vídeo, você vai ver paisagens paradisíacas com águas cristalinas, falésias, piscinas naturais, dunas e praias cercadas pela Mata Atlântica — do nascer ao pôr do sol. Um convite perfeito para planejar sua próxima viagem e explorar destinos imperdíveis! #LitoralBrasileiro #PraiasDoBrasil #Turismo #Viagem #Natureza #Drone #PraiaParadisíaca #Norde #Praias</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396431/3396431_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-02T02:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Maen seruduk aja si dogi</video:title>
      <video:description>Maen seruduk aja si dogi #Komedi #hiburan #lucu</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396430/3396430_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T02:11:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flamengo x Mirassol Brasileirão série A Chamada</video:title>
      <video:description>#Flamengo #Mirassol #futebol #bet</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396429/3396429_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T02:09:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎬 mulher ciumenta</video:title>
      <video:description>#viralvideocomedianovelinhafilme</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396428/3396428_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-02T02:09:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Booking your travel with Trip.com #trip.com</video:title>
      <video:description>Booking your travel with Trip.com #trip.com https://bit.ly/Mytrip-com Tech-review, Tech-review.guru, tech, review, comparative review #BookingyourtravelwithTripcom #tripcom #travel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396427/3396427_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-02T02:09:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 19</video:title>
      <video:description>Rir #Europa #incluindoDE #FR #IT #ES #PL</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396426/3396426_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T02:09:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Maria Khan blockbuster dance t</video:title>
      <video:description>Maria Khan blockbuster dance performance 🔥</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396425/3396425_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T02:09:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 18</video:title>
      <video:description>Rir #Europa #incluindoDE #FR #IT #ES #PL</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396424/3396424_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T02:08:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My love for you knows no bounds | 당신을 향한 내 사랑에는 끝이 없습니다.</video:title>
      <video:description>My love for you knows no bounds | 당신을 향한 내 사랑에는 끝이 없습니다. #dorama #doramas #dorama2022 #dorama2023 #doramabrasil #doramadublado #doramacoreano #doramanetflix #doramasnetflix #truebeautydorama #melhoresdoramas #kdrama #resumendedoramas #doramasdubladosem #drama #doramadubladonetflix #ondeassistirdoramas #cdrama #bellezaverdaderadorama #belezaverdadeiradorama #jdrama #dramas #shortdrama #koreandrama #shortsdrama #melhoresdoramasdanetflix #shortdramas #dramacoreano #newdrama #doramasdubladosemportugues #cdramashorts #kdramashorts #belezaverdadeiradoramanetflix</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396423/3396423_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-02T02:08:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 17</video:title>
      <video:description>Rir #Europa #incluindoDE #FR #IT #ES #PL</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396422/3396422_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T02:08:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dedar Multan stage drama full jhakaas 6</video:title>
      <video:description>Dedar Multan stage drama full jhakaas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396421/3396421_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-02T02:07:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Certa Noite, um Jovem Chamado... | Uma História Emocionante de Fé e Esperança</video:title>
      <video:description>Certa noite, um jovem chamado... viveu uma experiência que mudaria sua vida para sempre. 🌙✨ Nesta emocionante história, você vai acompanhar uma jornada de **fé, esperança, reflexão e superação**, mostrando que, mesmo nos momentos mais difíceis, nunca devemos perder a esperança. 🙏 Assista até o final e descubra a mensagem especial que essa história traz para o seu coração. Se você gosta de **histórias emocionantes, mensagens de fé, histórias para refletir, motivação e esperança**, este vídeo foi feito para você. 👍 Deixe seu like, compartilhe com alguém especial e inscreva-se no canal para receber mais histórias e mensagens. #Certanoite #umjovemchamado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396420/3396420_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T02:07:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396419</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396419/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fazer isso com a semente de abóbora é uma delícia e você não sabia</video:title>
      <video:description>Fazer isso com a semente de abóbora é uma delícia e você não sabia #Sementedeabóbora #sementedeabóboradorrada #abóbora</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396419/3396419_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T02:07:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carros 3</video:title>
      <video:description>#carrosVelozesefuriosos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396418/3396418_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T02:06:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Para Deus, nada é impossível.”</video:title>
      <video:description>Ora, a fé é a certeza daquilo que esperamos.” (Hebreus 11:1) “Tudo é possível ao que crê.” (Marcos 9:23) #Ora #afééacertezadaquiloqueesperamos”Hebreus111“Tudoépossívelaoquecrê”Marcos923</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396417/3396417_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-02T02:06:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Se balançando no abismo.</video:title>
      <video:description>#Sebalançandonoabismo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396416/3396416_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-02T02:06:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396415</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396415/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neymar 33</video:title>
      <video:description>Melhores gols de Neynar #Neymargoolsgolsgolmelhoreslanceslancesjogosfutebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396415/3396415_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T02:06:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O silêncio é como uma panela de pressão</video:title>
      <video:description>Nem sempre guardado tudo pode ser uma boa opção... #Silêncio #relacionamento #cansaçoemocional #invalidação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396414/3396414_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T02:05:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cultura 2</video:title>
      <video:description>Homenzinho trabalhando #Trabalho #animes #humor</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396413/3396413_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T02:05:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele esperando o Trem desviar</video:title>
      <video:description>Ele esperando o Trem desviar #Trem #carro #suspense</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396411/3396411_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-02T02:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏆 Bora caçar verificados! 13</video:title>
      <video:description>🐎⚔️ CAÇADOR DE VERIFICADOS — MONTADO NO CAVALO! Bem-vindo à minha caçada! Não sou pro, não jogo perfeito, mas tenho o MELHOR parceiro do jogo: MEU CAVALO! 🐎 Lutando, caçando verificados e subindo rumo ao Desafiante — montado o tempo todo! Sem enrolação, só ação! 🔔 Se inscreve pra acompanhar eu e meu cavalo na próxima caçada! 👍 Curte se você também já jogou de cavalo! 💬 Comenta: &quot;Cavalo é vida!&quot; 🐎 #Desviral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396410/3396410_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T02:05:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>￼SKIN1004 Madagascar Centella Asiatica Ampoule Facial Serum 55ml, 100ml</video:title>
      <video:description>Sérum facial SKIN1004 Madagascar Centella Ampoule, com Centella Asiática, perfeito para quem busca uma rotina de skincare mais suave e focada em hidratação e cuidado com a pele. Disponível em 55 ml e 100 ml. #SKIN1004MadagascarCentella #sérumdeCentellaAsiática #skincarecoreano</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396409/3396409_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T02:05:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I Still Love You 💔 | Emotional Romantic Lofi Song — Lofi Man</video:title>
      <video:description>Sometimes someone leaves your life, but never really leaves your heart. “I Still Love You” is an original emotional romantic lofi song about missing someone, remembering the moments you shared, and learning that sometimes love remains even after goodbye. Put on your headphones, listen to the rain, and let the memories come back. 🎧 Lofi Man — Music for the moments words can&apos;t explain. Subscribe to Lofi Man for new original songs every week. Music and visual elements created with the assistance of generative AI under original creative direction for Lofi Man. #LofiMan #lofimusic #romanticsongs #lovesongs #sadsongs #emotionalmusic #relaxingmusic #chillmusic #originalsongs #aimusic #músicasromânticas #músicasdeamor #músicastristes #músicasemocionantes #músicagospel #louvor #músicasparaorar #músicasparadormir #músicaspararelaxar #músicaparamadrugada #heartbreaksongs #lovemusic #christianmusic #gospelsongs #relaxingsongs #animelofi #VIRAL</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396408/3396408_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-02T02:04:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brian Cars</video:title>
      <video:description>#CarroBrianVelozesEFuriosos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396406/3396406_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T02:03:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Essa música gospel vai tocar sua alma e renovar sua fé. 🙏👉 Curta, comente e se inscreva no canal!</video:title>
      <video:description>Uma canção de adoração profunda, feita para momentos de oração, descanso e intimidade com Deus. Que o Espírito Santo fale com você através dessa música. ✨ Se abençoar sua vida, deixe seu like e se inscreva. #músicagospelvaitocarsuaalmaerenovarsuafé🙏👉Curta #comenteeseinscrevanocanal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396405/3396405_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-09-02T02:03:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to make money with</video:title>
      <video:description>Complete analysis and updated information on withdrawals para saber mais, me chama no whats:939594326 #Howtomakemoney</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396404/3396404_720p.mp4</video:content_loc>
      <video:duration>191</video:duration>
      <video:publication_date>2026-09-02T02:03:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396403</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396403/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My Cowboy is Such a Playboy❤️Tayland❤️Thai Mix Hindi Songs❤️Korean Mix Hindi Songs❤️Dramalist Haven</video:title>
      <video:description>My Cowboy is Such a Playboy❤️Tayland❤️Thai Mix Hindi Songs❤️Korean Mix Hindi Songs❤️Dramalist Haven</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396403/3396403_720p.mp4</video:content_loc>
      <video:duration>1797</video:duration>
      <video:publication_date>2026-09-02T02:03:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Moda da roça</video:title>
      <video:description>Viver no Compo é melhor que na cidade #Campo #roça #interior</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396402/3396402_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:02:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Is There Life on Mars? The Mystery That Could Change Everything</video:title>
      <video:description>For centuries, humanity has looked toward Mars and wondered: Are we truly alone in the universe? The Red Planet may appear cold, dry, and lifeless today — but billions of years ago, Mars may have had liquid water, a thicker atmosphere, and conditions that could have supported life. In this video, we explore the most intriguing evidence and mysteries surrounding the possibility of life on Mars, from ancient water channels and organic molecules to mysterious discoveries made by robotic missions on the Martian surface. 🔴 Did Mars once have the conditions for life? 🧬 Have organic molecules been discovered on Mars? 💧 Where did the ancient Martian water go? 🤖 What have NASA&apos;s missions actually discovered? 👽 Could microbial life still exist beneath the Martian surface? The evidence raises fascinating questions — but the ultimate answer remains unknown. If life ever existed on Mars, what would that mean for humanity? #lifeonmars #istherelifeonmars #marslife #lifeonmarsmystery #marsmysteries #evidenceoflifeonmars #signsoflifeonmars #ancientlifeonmars #microbiallifeonmars #alienlife #extraterrestriallife #marsdiscoveries #marsfacts #marssecrets #marsunexplained #mysteriesofmars #nasamars #nasadiscoveries #marsrover #marsrovers #curiosityrover #perseverancerover #marsexploration #marsscience #ancientmars #wateronmars #ancientwateronmars #organicmoleculesonmars #marsatmosphere #lifebeyondearth #lifebeyondourplanet #searchforlife #aliencivilizations #extraterrestriallifeforms #mysteriousdiscoveries #spacemysteries #unexplainedspacemysteries #redplanet #secretsoftheredplanet #couldtherebelifeonmars #marsdocumentary #spacedocumentary #astronomy #universemysteries</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396401/3396401_720p.mp4</video:content_loc>
      <video:duration>361</video:duration>
      <video:publication_date>2026-09-02T02:02:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Faça já a sua viagem com Trip.com #trip.com 2</video:title>
      <video:description>https://bit.ly/Mytrip-com Faça já a sua viagem com Trip.com #trip.com Tech-review, Tech-review.guru, tech, review, comparative review</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396399/3396399_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T02:02:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BMW 😮‍💨🔥</video:title>
      <video:description>Você teria essa BMW? #Bmw</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396398/3396398_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-02T02:02:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396397</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396397/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doom At Your Service / 둠이 당신을 위해 준비되어 있습니다</video:title>
      <video:description>&quot;불행은 당신의 손에 달려 있다&quot;에서, 인생 최악의 불운을 겪는 젊은 여성은 하늘에 이 불운을 끝내달라고 간청하지만, 그녀의 소원이 이루어지면서 그녀의 마음과 영혼은 위태로워진다. #dorama #doramas #dorama2022 #dorama2023 #doramanetflix #doramacoreano #truebeautydorama #doramasdubladosem #drama #doramadubladonetflix #kdrama #cdrama #belezaverdadeiradorama #bellezaverdaderadorama #jdrama #dramacorto #shortdrama #koreadrama #dramakorea #koreandrama #shortsdrama #shortdramas #newdrama #dramacoreano #dramaost #kdramashorts #cdramashorts #belezaverdadeiradoramanetflix #westdrama #dramacina #newkoreandrama #newkdrama #dramachino #hindidrama #chinadrama #dramachina #asiandrama #koreandramatour</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396397/3396397_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T02:02:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uma pequena apresentação da banda fanfarra escolar.</video:title>
      <video:description>Uma pequena apresentação da banda fanfarra de uma escola do município de Bom Conselho.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396396/3396396_720p.mp4</video:content_loc>
      <video:duration>255</video:duration>
      <video:publication_date>2026-09-02T02:01:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>￼ABIB Quick sunstick Protection bar SPF50+ PA++++ 22g</video:title>
      <video:description>Protetor solar em bastão Abib Quick Sunstick SPF50+ PA++++, prático para levar na bolsa e reaplicar ao longo do dia. Uma opção para quem gosta de proteção solar em um formato fácil e rápido de usar. 22g. #protetorsolarembastão #protetorsolarfacial #protetorsolarSPF50 #skincarecoreano #K-beautyproteçãosolarfacial #achadinhosdeskincare #produtosdeskincarecoreano #belezacoreana</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396395/3396395_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T02:01:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Faça já a sua viagem com Trip.com #trip.com</video:title>
      <video:description>Faça já a sua viagem com Trip.com #trip.com #travel #bookingyourtravel #tripcom</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396394/3396394_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T02:01:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mistério 3</video:title>
      <video:description>#Curiosidademistério</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396393/3396393_720p.mp4</video:content_loc>
      <video:duration>651</video:duration>
      <video:publication_date>2026-09-02T02:01:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When Crocodiles Evolved Like Whales</video:title>
      <video:description>In the early twentieth century the Highley unusual skull of a crocodile was discovered In the 100 million year old rocks of central Egypt. Unfortunately this specimen was destroyed in the 2nd world war and this unusual creature was never found again. However, in 2009 a similar creature was discovered in Niger offering clues of what its large relative would have been like.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396392/3396392_720p.mp4</video:content_loc>
      <video:duration>713</video:duration>
      <video:publication_date>2026-09-02T02:00:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>w4ty68o0</video:title>
      <video:description>aedfgybjiko #eua</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396391/3396391_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-02T02:00:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stunning Beauty That Will Catch Your Eye</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396390/3396390_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T02:00:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>primeiro arco de pvc feito por mim .</video:title>
      <video:description>arco e flecha caseiro de pvc é o primeiro a fazer a mão . #pvc #arcoeflchasdepvc</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396389/3396389_720p.mp4</video:content_loc>
      <video:duration>363</video:duration>
      <video:publication_date>2026-09-02T02:00:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Salvando tubarão</video:title>
      <video:description>#Salvandotubarão</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396388/3396388_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T01:59:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Otter Cubs Left with Their Mother</video:title>
      <video:description>Otter Cubs Left with Their Mother. A baby otter was left behind by its mother on the river bank, but we were confused about what to do #reelsfypviralmountainclimbersmountainclimbershikers</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396387/3396387_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-02T01:59:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Girl Is Simply Stunning</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396386/3396386_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T01:58:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lewis Capaldi - Alguém Que Você Amou - REGGAE DO MARANHÃO 2026</video:title>
      <video:description>Lewis Capaldi - Alguém Que Você Amou - REGGAE DO MARANHÃO 2026 #LewisCapaldi-AlguémQueVocêAmou-REGGAEDOMARANHÃO2026</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396385/3396385_720p.mp4</video:content_loc>
      <video:duration>205</video:duration>
      <video:publication_date>2026-09-02T01:58:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Naustagia</video:title>
      <video:description>#musicaregge</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396384/3396384_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T01:58:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Raio destruindo arvore</video:title>
      <video:description>#Raiodestruindoarvore</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396383/3396383_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T01:58:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396382</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396382/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criativo vídeo</video:title>
      <video:description>Vídeo de dançando com Shakira cover #Dançahumor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396382/3396382_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T01:58:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Musibah banjir nepal</video:title>
      <video:description>Banjir bandang di nepal, banyak yang meninggal dunia #Nepal #musibah #tragedi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396381/3396381_720p.mp4</video:content_loc>
      <video:duration>151</video:duration>
      <video:publication_date>2026-09-02T01:58:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gato lindo filhotinho</video:title>
      <video:description>Gato filhote bebendo água na torneira #Gato #gatinhofilhote #filhote #filhotinho #gatofofo #cat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396380/3396380_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T01:58:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautfull russean</video:title>
      <video:description>beautfull russean #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396379/3396379_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T01:57:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny videos</video:title>
      <video:description>Funny videos #Funny #Comedy #videos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396378/3396378_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T01:57:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O poder de uma bomba atômica.</video:title>
      <video:description>#Opoderdeumabombaatômica</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396377/3396377_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-02T01:56:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396376</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396376/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Miniatura Ferrari PuroSangue</video:title>
      <video:description>Miniatura Ferrari Puro Sangue #Miniaturavolecionador</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396376/3396376_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T01:56:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hair style 29</video:title>
      <video:description>Hair rainbow for girls, ideas #Hair #Rainbow #Pinterest #Tiktok #Girls</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396375/3396375_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T01:56:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bebida</video:title>
      <video:description>#Bebida #loira</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396374/3396374_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T01:55:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Story Behind New Zealand&apos;s Weird Animals</video:title>
      <video:description>New Zealand is the most remote large land mass in the world being located over 1000 miles away from its nearest neighbouring continent. This isolation has created New Zealand&apos;s unique ecosystems but all is not as its seems New Zeland actually has incredibly complicated geological and ecological history that local animals have been in conflict with still shaping them to this day.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396373/3396373_720p.mp4</video:content_loc>
      <video:duration>1226</video:duration>
      <video:publication_date>2026-09-02T01:55:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fogão a lenha</video:title>
      <video:description>Fogão forno e churrasqueira arte em alvenaria #Brasil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396372/3396372_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T01:55:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396370</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396370/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ fui jogar uma partida de futebol quando cheguei minha mulher tava em cima da cama me esperando co</video:title>
      <video:description>GTA fui jogar uma partida de futebol quando chegar a mulher tava em cima da cama esperando com arma #gtahistóriaGTASanAndreasGTACJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396370/3396370_720p.mp4</video:content_loc>
      <video:duration>76</video:duration>
      <video:publication_date>2026-09-02T01:54:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você Foi Meu Segredo Mais Bonito ❤️ | Uma História de Amor em Silêncio | Música Romântica</video:title>
      <video:description>❤️ VOCÊ FOI MEU SEGREDO MAIS BONITO E se você tivesse amado alguém profundamente... mas nunca tivesse conseguido dizer? &quot;Você Foi Meu Segredo Mais Bonito&quot; é uma música romântica original do Carmo Studio sobre aquele amor que nasceu em silêncio, cresceu nos pequenos gestos e ficou guardado no coração. Um olhar que dizia mais que palavras. Um sorriso que escondia sentimentos. Uma vontade de confessar... E o medo de perder até aquilo que já existia. Alguns amores não precisam de declarações para serem verdadeiros. Eles vivem nos detalhes. Nas lembranças. Nas palavras que nunca foram ditas. Nos momentos que poderiam ter sido diferentes. E talvez essa seja a parte mais dolorosa de amar alguém em silêncio: Você sabe exatamente o que sentiu... mas a outra pessoa talvez nunca tenha descoberto. 🎧 Coloque os fones, aumente o volume e permita que essa história toque seu coração. 💬 Agora quero saber de você: Você já amou alguém em silêncio? Já existiu uma pessoa que foi seu &quot;segredo mais bonito&quot;? Se quiser, conte sua história nos comentários. ❤️ Se essa música tocar sua alma, deixe seu gostei, compartilhe com alguém especial e inscreva-se no Carmo Studio para acompanhar novas histórias de amor transformadas em música. 🎵 CARMO STUDIO Cada música é um novo capítulo. Cada capítulo conta uma história. E toda história de amor merece ser lembrada. #vocêfoimeusegredomaisbonito #vocefoimeusegredomaisbonito #músicaromântica #musicaromantica #músicadeamor #musicadeamor #amorsecreto #amoremsilêncio #amoremsilencio #amornãocorrespondido #amornãorevelado #históriadeamor #historiasdeamor #amorimpossível #amorverdadeiro #saudade #paixão #músicaemocionante #musicaemocionante #baladaromântica #baladaromantica #declaraçãodeamor #musicaoriginal #carmostudio #lovesong #romanticsong</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396369/3396369_720p.mp4</video:content_loc>
      <video:duration>480</video:duration>
      <video:publication_date>2026-09-02T01:54:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quando vai separar briga acabou caindo do cavalo 🐴🐴 kkk</video:title>
      <video:description>Confucao atrapalhada #Confucaoatrapalhada</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396368/3396368_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-02T01:54:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Notificação de Geladeira</video:title>
      <video:description>🥃 Bem-vindo ao canal Balada &amp; Boteco — a trilha sonora oficial da sua sexta-feira, daquela recaída de madrugada e da volta por cima na pista! #SertanejoSofrenciaSertanejoUniversitarioBaladaEBotecoMusicaSertanejaModaoRecaida</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396367/3396367_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T01:54:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jinx!</video:title>
      <video:description>Jinx, O BL manhwa mais must-to-read #BL #manhwa #recap</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396366/3396366_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T01:54:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ encontrei a mulher do poço no GTA San Andreas</video:title>
      <video:description>GTA encontrei a mulher do poço no GTA San Andreas enfrentei ela #gtahistórialendaGTACJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396365/3396365_720p.mp4</video:content_loc>
      <video:duration>134</video:duration>
      <video:publication_date>2026-09-02T01:53:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ encontrei um monstro no GTA San Andreas</video:title>
      <video:description>GTA encontrei um monstro no GTA San Andreas olha só isso CJ #gtalendahistóriaGTASanAndreasCJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396364/3396364_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-02T01:52:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396363</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396363/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Modo Avião e Superaçao</video:title>
      <video:description>a trilha sonora oficial da sua sexta-feira, daquela recaída de madrugada e da volta por cima na pista! #SertanejoSofrenciaSertanejoUniversitarioBaladaEBotecoMusicaSertanejaModaoRecaida</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396363/3396363_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T01:52:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Te fuiste billo s Caracas Boys</video:title>
      <video:description>Té fuiste billo s Caracas Boys</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396362/3396362_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-09-02T01:52:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivação 51</video:title>
      <video:description>#Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396361/3396361_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T01:52:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Why did the Giant Ground Sloths Vanish</video:title>
      <video:description>Ground Sloths (not all giant) had a massive presence in all South American ecosystems and many North American ones too. They weren&apos;t some ancient creature that went extinct millions of years ago, they were seamlessly incorporated into habitats alongside animals still living today. Then in a blink of an eye, in evolutionary terms, they went completely extinct.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396360/3396360_720p.mp4</video:content_loc>
      <video:duration>1094</video:duration>
      <video:publication_date>2026-09-02T01:52:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bêbado 2</video:title>
      <video:description>#Palestra #bêbado #polícia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396359/3396359_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-02T01:51:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396358</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396358/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>futebol 2</video:title>
      <video:description>Melhores lances</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396358/3396358_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T01:51:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Essa foi boa</video:title>
      <video:description>Essa foi boa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396357/3396357_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-02T01:51:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>IN SEARCH OF-ROCK PAULEIRA0</video:title>
      <video:description>rock do bõm #rock #musica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396356/3396356_720p.mp4</video:content_loc>
      <video:duration>152</video:duration>
      <video:publication_date>2026-09-02T01:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396355</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396355/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>INIMIGO DO FIM</video:title>
      <video:description>A trilha sonora oficial da sua sexta-feira, daquela recaída de madrugada e da volta por cima na pista! #BaladaeBoteco #sertanejouniversitario #sofrencia #sertanejo2026 #musicassertanejas #sertanejooriginal #modaomoderno #sertanejolofi #musicaparabeber #sertanejodebar #recaidasertanejo #terminoesuperacao #sertanejomotioncomic #animacaosertanejo #sertanejotriste #playlistsertanejo #sertanejolancamento #agroebalada #canaldarksertanejo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396355/3396355_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T01:51:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inter 4</video:title>
      <video:description>#Inter #grêmio #troféu</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396353/3396353_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T01:50:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nikola Tesla&apos;s Greatest Inventions: The Genius Who Changed the World</video:title>
      <video:description>Nikola Tesla was one of the most brilliant and mysterious inventors in history. His ideas helped shape the modern world, from alternating current and electric motors to wireless technology and groundbreaking experiments with electricity. But how far ahead of his time was Tesla really? In this video, we explore Tesla&apos;s most remarkable inventions, experiments, and visionary ideas — and discover how many of his concepts continue to influence technology today. ⚡ The invention that transformed electricity 🔌 Alternating current and the induction motor 📡 Tesla&apos;s vision of wireless communication 💡 The Tesla Coil and high-voltage experiments 🚗 Wireless power and futuristic technology 🧠 The ideas that made Tesla decades ahead of his time Some of Tesla&apos;s inventions changed the world. Others remain surrounded by mystery and controversy. Was Nikola Tesla truly one of the greatest inventors who ever lived? #nikolatesla #nikolateslainventions #teslainventions #nikolateslagreatestinventions #inventionsofnikolatesla #teslagenius #nikolateslagenius #teslatechnology #nikolateslatechnology #tesladiscoveries #nikolatesladiscoveries #teslacoil #alternatingcurrent #ACelectricity #inductionmotor #wirelesselectricity #wirelesspower #teslawirelesspower #teslaexperiments #teslainventionsexplained #teslascience #teslasecrets #teslamysteries #forgotteninventions #revolutionaryinventions #greatestinventorsinhistory #famousinventors #historyofelectricity #historyoftechnology #electricalinventions #electricityhistory #futuristicinventions #visionaryinventor #geniusinventor #sciencemysteries #technologymysteries #tesladocumentary #nikolatesladocumentary #teslabiography #teslainventionsthatchangedtheworld</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396352/3396352_720p.mp4</video:content_loc>
      <video:duration>415</video:duration>
      <video:publication_date>2026-09-02T01:49:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rizada</video:title>
      <video:description>#Risadas #chapéu</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396351/3396351_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-02T01:49:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to Increase RAM on Laptop and PC Without Buying More RAM | Windows 10/11</video:title>
      <video:description>How to Increase RAM on Laptop and PC Without Buying More RAM | Windows 10/11 Does your laptop or PC have low RAM and run slowly? In this video, I&apos;ll show you how to increase virtual RAM in Windows 10 and Windows 11 by using part of your computer&apos;s storage as virtual memory. You&apos;ll learn how to properly configure Windows virtual memory and the paging file, step by step, so your system can manage available memory more effectively when your physical RAM is not enough. 📌 In this video, you&apos;ll learn: • How to increase virtual RAM in Windows 10 • How to increase virtual RAM in Windows 11 • How to properly configure virtual memory • How to increase the paging file size • How to configure the Windows paging file • How to improve PC performance with low RAM • How to speed up a slow laptop without buying more RAM • How to optimize Windows 10 and Windows 11 for computers with low RAM 💡 Who can benefit from this method? This configuration can be especially useful for laptops and desktop computers with limited RAM, especially when Windows needs more memory than the amount physically installed. ⚠️ IMPORTANT: Virtual RAM does not physically increase the amount of RAM installed in your computer, nor does it replace a physical RAM upgrade. Windows simply uses part of your storage as virtual memory to help manage memory when your physical RAM is insufficient. 👍 If you find this tutorial helpful, LIKE the video and SUBSCRIBE to the channel for more Windows 10 and Windows 11 tutorials, optimization tips, and PC troubleshooting guides. 💬 Are you having problems with RAM, Windows, or your PC&apos;s performance? Let me know in the comments, and I may turn your question into a future tutorial. 🔎 Related topics: How to increase RAM Increase RAM without buying memory Virtual RAM in Windows 11 Virtual</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396349/3396349_720p.mp4</video:content_loc>
      <video:duration>339</video:duration>
      <video:publication_date>2026-09-02T01:49:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você ainda não chegou lá, mas já mudou</video:title>
      <video:description>Você ainda não chegou lá… mas também não está no mesmo lugar. Em apenas 60 segundos, acompanhe um começo de dia antes do amanhecer, as quedas, as tentativas e o nascer do sol como prova de que continuar é progresso real. Cinematográfico, emocional e inspirador. #Motivação #Superação #Persistência #Cinematográfico #Esperança #TrilhaSonora #9x16 #Inspiração #Autoconhecimento #Disciplina #Reflexão</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396348/3396348_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-02T01:48:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 34</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396347/3396347_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-02T01:48:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396346</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396346/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chinese-Korean</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396346/3396346_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T01:47:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396345</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396345/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Panela</video:title>
      <video:description>#Panela #casal #rizada</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396345/3396345_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T01:47:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 33</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396344/3396344_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T01:47:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Universo em Tempo Real: Você Vê o Passado</video:title>
      <video:description>Você olha para o céu e, sem perceber, está vendo o passado em “tempo real”! #Será</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396343/3396343_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-02T01:47:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396342</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396342/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 32</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396342/3396342_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-02T01:47:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The CEO’s heart beats only for the heiress❤️Chinese Mix Hindi Songs❤️Çin Klip❤️Dramalist Haven</video:title>
      <video:description>The CEO’s heart beats only for the heiress❤️Chinese Mix Hindi Songs❤️Çin Klip❤️Dramalist Haven</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396341/3396341_720p.mp4</video:content_loc>
      <video:duration>1151</video:duration>
      <video:publication_date>2026-09-02T01:46:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 31</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396340/3396340_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T01:46:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filme de ação 2</video:title>
      <video:description>#Filme</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396339/3396339_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T01:46:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ovelha</video:title>
      <video:description>#Ovelha #tombo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396338/3396338_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T01:46:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Steve Jobs: da rejeição ao impossível</video:title>
      <video:description>Steve Jobs: antes das vitrines brilhantes, houve rejeição, críticas e um recomeço doloroso. #Sucesso</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396337/3396337_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T01:46:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 30</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396336/3396336_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-02T01:46:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GOSPEL DNB CYBERPUNK APOCALIPSE 2026 MIX10 MIN. - SHINOKAMI HIKARI</video:title>
      <video:description>GOSPEL DNB CYBERPUNK APOCALIPSE 2026 MIX10 MIN. - SHINOKAMI HIKARI #GOSPELDNBCYBERPUNKAPOCALIPSE2026MIX10MIN-SHINOKAMIHIKARI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396335/3396335_720p.mp4</video:content_loc>
      <video:duration>673</video:duration>
      <video:publication_date>2026-09-02T01:45:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 29</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396334/3396334_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-02T01:45:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Garrafinhas 2</video:title>
      <video:description>#Garrafinhas #brincar #criança</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396333/3396333_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-02T01:45:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Planárias: o bicho que “desliga” o cérebro</video:title>
      <video:description>Você já ouviu falar de um bicho capaz de “desligar” o próprio cérebro? Parece lenda, mas é biologia: algumas planárias entram em estagnação, desacelerando metabolismo e funções do corpo para sobreviver e retomam tudo quando o ambiente melhora. #Curiosidade</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396332/3396332_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-02T01:45:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mek big mon bawl</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396331/3396331_720p.mp4</video:content_loc>
      <video:duration>97</video:duration>
      <video:publication_date>2026-09-02T01:45:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396330</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396330/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 28</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396330/3396330_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T01:45:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I caught three fish at once on an artificial lure.</video:title>
      <video:description>I caught three fish at once on an artificial lure. #fishing #artificiallute</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396329/3396329_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T01:45:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Contrato de Sofrência</video:title>
      <video:description>a trilha sonora oficial da sua sexta-feira, daquela recaída de madrugada e da volta por cima na pista! Aqui você encontra lançamentos inéditos de Sertanejo Universitário, Sofrência e Modão Moderno, combinados com estética visual única em motion comic e ambiências noturnas. São músicas 100% originais produzidas para quem ama uma boa letra de bar, histórias reais de término, amores de balada e superação. #Sertanejo #sofrencia #sertanejoUniversitario #musicaSertaneja</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396328/3396328_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T01:45:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Te extraño en silencio</video:title>
      <video:description>Es cuando tú estraña a esa persona que no está a tu lado</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396327/3396327_720p.mp4</video:content_loc>
      <video:duration>196</video:duration>
      <video:publication_date>2026-09-02T01:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 27</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396326/3396326_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-02T01:44:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Husband in action 2026 movie in Hindi dubbed</video:title>
      <video:description>#Koreanmovie #Hindidubbed</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396325/3396325_720p.mp4</video:content_loc>
      <video:duration>6566</video:duration>
      <video:publication_date>2026-09-02T01:44:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Incidente de Valparaíso: a disputa que mudou a guerra</video:title>
      <video:description>Uma disputa financeira durante a Guerra do Pacífico, em 1885, mudou o rumo de uma guerra: o Incidente de Valparaíso. Entenda como bloqueios, tarifas, cobranças e acusações levaram a intervenção diplomática e a um reajuste forçado de responsabilidades — com impacto direto no abastecimento e na logística militar. #História</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396324/3396324_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-02T01:44:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kendala saat bermain</video:title>
      <video:description>kendala para pemain profesional kebelet saat bertanding di ajang internasional #sepakbola</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396323/3396323_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-02T01:43:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐋 Majestic Blue Whale Swimming in Deep Ocean - AI Cinematic</video:title>
      <video:description>AI-generated footage of a giant blue whale swimming through deep ocean waters. Sunlight rays filter through as the gentle giant moves with incredible realism. Created with advanced AI. #shorts #whale #ocean #ai #cinematic #whale #ocean #underwater #AI #cinematic #sea #marine #animals #shorts #nature</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396322/3396322_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T01:43:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 26</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396321/3396321_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T01:43:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bolas</video:title>
      <video:description>#Bolas #copos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396320/3396320_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-02T01:43:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lisboa: Encanto, Sabor e História em Cada Esquina</video:title>
      <video:description>Já pensou em desembarcar em Lisboa e sentir que cada esquina guarda uma nova história? #Viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396318/3396318_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-02T01:43:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Most Played International Songs of 2025 💗 Top 100 Acoustic International Pop Songs 💗 Top Hits</video:title>
      <video:description>A vibrant and eye-catching YouTube thumbnail for an international pop music compilation. The design features a beautiful young woman with wavy auburn hair holding an acoustic guitar, surrounded by warm golden lighting, glowing hearts, musical notes, sparkles, and a cozy atmosphere. Large bold typography highlights “INTERNATIONAL MUSIC,” “MOST PLAYED 2025,” “TOP 100 ACOUSTIC,” and “TOP HIT #5.” The overall style is modern, emotional, romantic, energetic, and highly clickable, with strong pink, white, black, and golden accents. Perfect for a YouTube playlist featuring the biggest international pop and acoustic hits. #KeywordsTagseminglêsinternationalmusic #internationalpopmusic #pophits2025 #top100songs #bestpopsongs #mostplayedsongs2025 #acousticsongs #acousticpop #acoustichits #relaxingpopmusic #romanticsongs #lovesongs #emotionalsongs #popularsongs #tophits #musicplaylist #popmusicplaylist #internationalhits #bestinternationalsongs #trendingsongs #viralsongs #softpop #chillpop #acousticplaylist #romanticpopsongs #beautifullovesongs #greatestpophits #topmusic2025 #hitsongs #musiccompilation #tophit5 #relaxingmusic #backgroundmusic #easylistening #femaleacousticsinger #guitarmusic #acousticguitarsongs #Englishsongs #Englishpopsongs #playlist2025</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396317/3396317_720p.mp4</video:content_loc>
      <video:duration>8202</video:duration>
      <video:publication_date>2026-09-02T01:43:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatinho fofo 3</video:title>
      <video:description>um gato fazendo um bolo de morango #bolo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396316/3396316_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T01:43:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As melhores filme de luta 3</video:title>
      <video:description>### fala rapaziada estão bom As melhores filme de luta ano 2026 ### deixar seu comentário e curtida e escreve no canal</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396315/3396315_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-02T01:43:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gat gat gato gato</video:title>
      <video:description>Gato brincando gato gato #gatgatgatogato</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396313/3396313_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:42:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_10.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_10.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396312/3396312_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-02T01:42:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 25</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396311/3396311_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T01:42:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396310</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396310/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_09.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_09.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396310/3396310_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T01:42:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VOCÊ NÃO É RICO. SÓ ESTÁ ENDIVIDADO PARA PARECER!” 🔥💳</video:title>
      <video:description>Sobre rico de aparecia #Dinheiro #sucesso #motivaçao #motivation</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396309/3396309_720p.mp4</video:content_loc>
      <video:duration>264</video:duration>
      <video:publication_date>2026-09-02T01:42:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 24</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396308/3396308_720p.mp4</video:content_loc>
      <video:duration>116</video:duration>
      <video:publication_date>2026-09-02T01:42:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Entre Telas e Corações ❤️ | Quando Dois Corações se Encontram Além da Distância</video:title>
      <video:description>❤️ ENTRE TELAS E CORAÇÕES Algumas histórias começam com um simples &quot;oi&quot;. Outras começam entre mensagens, chamadas de vídeo e noites inteiras conversando. &quot;Entre Telas e Corações&quot; é uma música romântica original do Carmo Studio que conta a história de duas pessoas que descobriram que o verdadeiro amor pode nascer mesmo quando quilômetros as separam. Porque algumas conexões atravessam telas... E encontram um lugar definitivo no coração. 🎧 Coloque os fones de ouvido e viva essa emocionante história de amor do começo ao fim. 💬 Agora queremos saber: Você acredita que um grande amor pode começar pela internet? Conte sua história nos comentários. ❤️ Se esta música emocionou você, deixe seu gostei, compartilhe com alguém especial e inscreva-se no Carmo Studio. 🎵 Carmo Studio Onde toda história de amor se transforma em música. #entretelasecorações #entretelasecoracoes #músicaromântica #musicaromantica #músicadeamor #musicadeamor #amoràdistância #amoradistancia #relacionamentoàdistância #relacionamentoadistancia #históriadeamor #historiasdeamor #amorpelainternet #amorverdadeiro #romance #músicaemocionante #musicaemocionante #carmostudio #músicaoriginal #musicaoriginal #romanticpopballad #cinematicromanticpop #lovesong #romanticsong</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396307/3396307_720p.mp4</video:content_loc>
      <video:duration>254</video:duration>
      <video:publication_date>2026-09-02T01:42:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>José: da prisão ao perdão</video:title>
      <video:description>Preso numa situação sem saída, José enfrenta rejeição, escravidão e prisão, mas nunca perde a fé. #Religião</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396306/3396306_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T01:42:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_08.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_08.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396305/3396305_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T01:42:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>humor 23</video:title>
      <video:description>humor #humor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396304/3396304_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T01:41:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_07.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_07.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396303/3396303_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T01:41:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_06.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_06.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396302/3396302_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T01:41:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fogos 2</video:title>
      <video:description>#Céu #fogos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396301/3396301_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-02T01:41:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_05.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_05.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396300/3396300_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T01:41:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Biuck gnx</video:title>
      <video:description>Buick GNX — The American Muscle Car That Shocked the World. 🔥🇺🇸</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396299/3396299_720p.mp4</video:content_loc>
      <video:duration>165</video:duration>
      <video:publication_date>2026-09-02T01:41:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Está viva Viviana del Sol salsa</video:title>
      <video:description>Está viva Viviana del Sol 😎 salsa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396298/3396298_720p.mp4</video:content_loc>
      <video:duration>224</video:duration>
      <video:publication_date>2026-09-02T01:40:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Consciência: ponte ou filtro da realidade?</video:title>
      <video:description>Você já se perguntou se a realidade existe “lá fora” ou se nasce junto com a sua percepção? #Realidade</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396297/3396297_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-02T01:40:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_04.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_04.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396296/3396296_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T01:40:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_03.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_03.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396294/3396294_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T01:40:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This is the kind of scene that pulls everyone in. 🎥🍿</video:title>
      <video:description>This is the kind of scene that pulls everyone in. 🎥🍿</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396293/3396293_720p.mp4</video:content_loc>
      <video:duration>281</video:duration>
      <video:publication_date>2026-09-02T01:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌅 Drop the Horizon 2026 🌊 딥 &amp; 멜로딕 하우스 | 선셋 바이브 4K</video:title>
      <video:description>🌅 DROP THE HORIZON 2026 🌊 딥 하우스, 멜로딕 하우스, 그리고 몽환적인 일렉트로닉 사운드가 강력하게 믹스된 음악으로 지평선 너머로 탈출하세요. 부드러운 베이스라인, 감성적인 멜로디, 그리고 영화 같은 사운드가 어우러져 석양, 밤 드라이브, 그리고 순수한 자유를 만끽하는 순간에 완벽한 사운드트랙을 선사합니다. 🎧 DROP THE HORIZON 2026 🌊 딥 하우스 🌅 석양의 분위기 🎹 멜로딕 하우스 💫 몽환적인 일렉트로닉 🌴 편안하고 힐링되는 사운드 🔥 깊은 베이스와 부드러운 그루브 📺 4K UHD 영상 경험 석양 감상, 드라이브, 공부, 업무, 휴식, 해변의 밤, 루프탑 라운지, 여행, 명상, 그리고 늦은 밤 감상에 완벽합니다. 눈을 감고 심호흡을 하며 음악에 몸을 맡겨 지평선 너머로 떠나보세요. 한계도, 경계도 없습니다. 오직 지평선 너머의 음악만이 있을 뿐입니다. 🌅🌊🎧 #DroptheHorizon2026 #딥하우스2026 #멜로딕하우스 #감성적인딥하우스 #선셋하우스 #칠하우스 #럭셔리딥하우스 #야간드라이브음악 #트로피칼딥하우스 #이비자딥하우스 #딥하우스플레이리스트 #칠아웃일렉트로닉음악 #4KUHD음악</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396292/3396292_720p.mp4</video:content_loc>
      <video:duration>195</video:duration>
      <video:publication_date>2026-09-02T01:40:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Colher</video:title>
      <video:description>#Colher #soja #grêmio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396291/3396291_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T01:40:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>banda Rock em Replay</video:title>
      <video:description>banda voltada para o rock. musicas dos anos 2000 #músico #cmp22 #Hadcore #charlebrow</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396290/3396290_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T01:40:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_02.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_02.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396289/3396289_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T01:40:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rise of the Tomb Raider Part =_01.mp4</video:title>
      <video:description>Rise of the Tomb Raider Part =_01.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396288/3396288_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T01:39:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Verdade: descoberta ou construção?</video:title>
      <video:description>Você já parou para pensar se a verdade é algo que descobrimos ou algo que construímos? #Verdade</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396287/3396287_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T01:39:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As melhores filme de luta 2</video:title>
      <video:description>### fala rapaziada estão bom As melhores filme de luta ### deixar seu comentário e curtida e escreve no canal</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396286/3396286_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T01:39:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stickman caveman riding wooden</video:title>
      <video:description>Stickman caveman riding wooden #Stickman #caveman #riding #wooden</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396284/3396284_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:38:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The child didn&apos;t like what he said.</video:title>
      <video:description>The guy trolled the kid. #fy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396283/3396283_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-02T01:38:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>IMI Igreja Mundial Internacional</video:title>
      <video:description>IMI Igreja Mundial Internacional</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396282/3396282_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T01:38:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Mysteries of Antarctica: Secrets Hidden Beneath the Ice</video:title>
      <video:description>At the bottom of the world lies a frozen continent filled with mysteries. Antarctica is one of the most isolated and unexplored places on Earth — but what could be hidden beneath its enormous sheets of ice? From ancient landscapes buried beneath kilometers of ice to mysterious lakes, unexplored regions, strange discoveries, and scientific enigmas, Antarctica continues to challenge our understanding of the planet. In this video, we explore some of the most fascinating mysteries surrounding the frozen continent and uncover the questions that scientists and explorers are still trying to answer. ❄️ Secrets beneath the Antarctic ice 🌍 Ancient landscapes hidden for millions of years 🧊 Mysterious subglacial lakes 🔬 Unexplained scientific discoveries 🗺️ The most unexplored places on Earth 👁️ Mysteries that continue to fuel speculation Antarctica may look like a frozen wasteland… but beneath the ice, an entirely different world could be waiting to be discovered. What secrets are still hidden beneath Antarctica? #antarcticamysteries #mysteriesofantarctica #antarcticasecrets #secretsofantarctica #antarcticamystery #hiddensecretsofantarctica #antarcticaunexplored #unexploredantarctica #antarcticabeneaththeice #secretsbeneaththeice #antarcticice #antarcticadiscoveries #mysteriousantarctica #antarcticaunexplained #antarcticastrangediscoveries #ancientantarctica #ancientworldbeneaththeice #antarcticahiddenworld #antarcticmysteries #antarcticafacts #antarcticasecretsrevealed #unexploredplacesonearth #mostmysteriousplacesonearth #unexplainedmysteries #unsolvedmysteries #hiddenworld #subglaciallakes #antarcticresearch #antarcticexploration #mysteriousdiscoveries #ancientearth #secretshiddenbeneaththeice</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396281/3396281_720p.mp4</video:content_loc>
      <video:duration>387</video:duration>
      <video:publication_date>2026-09-02T01:38:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>La Dron de tu amor Gualberto ibareto</video:title>
      <video:description>LaDron dé tú amor Gualberto ibareto</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396280/3396280_720p.mp4</video:content_loc>
      <video:duration>246</video:duration>
      <video:publication_date>2026-09-02T01:37:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A dona aranha subiu pela parede</video:title>
      <video:description>🎵🌈 Bem-vindos ao Mundo da Maria - Músicas Infantis! 🌈🎵 O Mundo da Maria é um canal criado com muito amor para levar alegria, diversão e aprendizado às crianças por meio da música, da imaginação e de histórias encantadoras. Aqui você encontrará músicas infantis originais, canções educativas, animações coloridas, personagens carismáticos e aventuras que estimulam a criatividade, a curiosidade e os bons valores desde os primeiros anos de vida. Inspirado no sorriso da pequena Maria, este canal nasceu com a missão de transformar momentos simples em lembranças especiais para toda a família. Cada vídeo é produzido com carinho para proporcionar entretenimento seguro, leve e divertido para bebês, crianças e seus familiares. 🎶 Músicas infantis originais 🌟 Histórias e aventuras encantadoras 🎨 Animações divertidas e educativas 💖 Conteúdo feito com amor para toda a família Inscreva-se e embarque nessa jornada cheia de música, imaginação e alegria! #music #musica #infantil #desenho</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396279/3396279_720p.mp4</video:content_loc>
      <video:duration>211</video:duration>
      <video:publication_date>2026-09-02T01:37:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatinho marshmellow 2</video:title>
      <video:description>#gato #gatinho #gatinhos #cat #catlove</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396276/3396276_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T01:37:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rr Parnamirim</video:title>
      <video:description>Rn</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396275/3396275_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:37:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As melhores filme de luta</video:title>
      <video:description>###Fala fala rapaziada estão bom As melhores filme de luta ### deixar seu comentário e curtida e escreve no canal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396274/3396274_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-02T01:37:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FETISH LOONER - globofilia - inflatofilia</video:title>
      <video:description>curte baloes, bexigas, cheiro, som, textura, poppers, no poppers... #looners</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396271/3396271_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-09-02T01:36:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>trik tendangan bebas</video:title>
      <video:description>salah satu trik tendangan bebas yg menghasilkan gol #sepakbola</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396270/3396270_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T01:36:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Life After the Dinosaurs: The Beginning of the Reign of Mammals.</video:title>
      <video:description>After the meteor wiped out the dinosaurs 66 million years ago, the planet wasn&apos;t left empty. The Cenozoic Era witnessed the rise of the most fascinating and lethal monsters ever to walk the Earth: three-meter-tall birds with beaks capable of crushing bones, colossal snakes that swallowed whole alligators, and predatory mammals that dominated hostile landscapes.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396269/3396269_720p.mp4</video:content_loc>
      <video:duration>702</video:duration>
      <video:publication_date>2026-09-02T01:36:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Goodbye Friend - DJ LKS RIT INTERNATIONAL</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866 #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396268/3396268_720p.mp4</video:content_loc>
      <video:duration>220</video:duration>
      <video:publication_date>2026-09-02T01:35:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I love 7</video:title>
      <video:description>Casal Koreano vivem viagem Romântica #LoveKorea</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396267/3396267_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T01:35:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sucesso é Decisão, Não Desculpa</video:title>
      <video:description>Você vive adiando tudo com “desculpas prontas”? Nesse vídeo, você aprende a transformar procrastinação em ação com metas que incomodam, foco como disciplina e passos mesmo tremendo. Pare de negociar com o medo e construa sucesso com decisões diárias — mesmo imperfeito. #Produtividade #Disciplina #Metas #Foco #Procrastinação #Autodesenvolvimento #Mentalidade #Ação #Coragem #Superação #Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396265/3396265_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T01:35:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>트웰브 | 공식 예고편</video:title>
      <video:description>우리 세상을 구하기 위한 장대한 전투가 곧 시작됩니다. 천사와 악마가 격돌합니다.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396264/3396264_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-02T01:35:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As melhores filme de ação 2</video:title>
      <video:description>###fala fala rapaziada estão bom Aa melhores filme de luta ano 2026 ### ### deixar seu comentário e curtida e escreve no canal***2</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396263/3396263_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T01:34:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carro transforme</video:title>
      <video:description>Carro transforme</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396262/3396262_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T01:34:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon Ball Z 3</video:title>
      <video:description>Simply the best anime of all time.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396261/3396261_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T01:34:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>South korea beauty queen👑</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396259/3396259_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T01:33:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vença Seu Limite: Corte Distrações e Aja Agora</video:title>
      <video:description>Você veio para vencer o próprio limite, não para viver no automático. Neste vídeo, aprenda a decidir com precisão: faça a pergunta “isso me aproxima ou me esvazia?&quot; #Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396258/3396258_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-02T01:33:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hey is everything alright - DJ LKS RIT INTERNATIONAL</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866 #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396257/3396257_720p.mp4</video:content_loc>
      <video:duration>199</video:duration>
      <video:publication_date>2026-09-02T01:33:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Dimetrodon Lived Through an Ice Age</video:title>
      <video:description>The mesozoic or the dinosaur era msy as well have been an alien planet due to how different and unrecognisable the ecosystems were. However, oddly just before this period before the dinosaurs evolved the landscapes and creatures would have actually been more familiar in some ways. The earth&apos;s global temperatures were similar today and the largest carnivorous creature of the time was more closely related to mammals than reptiles, however, that is where the similarities end. As dimetrodon lived hundreds of millions of years ago they diverged from mammals in many ways. Dimetrodon and this strange period in the earths history is all explained in this video</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396255/3396255_720p.mp4</video:content_loc>
      <video:duration>1012</video:duration>
      <video:publication_date>2026-09-02T01:32:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semua Sound Horeg Sudah pada ready</video:title>
      <video:description>Karnaval Dayurejo Prigen #KarnavalDayurejo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396254/3396254_720p.mp4</video:content_loc>
      <video:duration>223</video:duration>
      <video:publication_date>2026-09-02T01:32:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aubrey</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396252/3396252_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:32:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vc tem 10 segundos</video:title>
      <video:description>Seja e veja isso agora #viraljesuschistfejesusmotivacional</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396251/3396251_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T01:31:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FILMMAKING  METEORITES STRIKING DESERT</video:title>
      <video:description>filmmaking, behind the scenes, filmmaking behind the scenes, movie making, Hollywood filmmaking, movie production, film production, special effects, VFX, visual effects, practical effects, miniature VFX, miniature filmmaking, movie magic, Hollywood special effects, cinematic effects, film crew, film set, camera crew, cinematography, movie effects, disaster movie, action movie effects, volcano VFX, tsunami VFX, explosion effects, green screen, green screen effects, miniature sets, model sets, filmmaking techniques, special effects behind the scenes, VFX behind the scenes, practical VFX, cinematic filmmaking, Hollywood VFX, movie magic behind the scenes, film industry, filmmaking techniques, movie set, camera equipment, film crew behind the scenes, realistic movie effects, blockbuster effects, cinematic production #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396250/3396250_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T01:31:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Semua Sound Horeg Sudah pada ready.</video:title>
      <video:description>Karnaval Dayurejo Prigen #KarnavalDayurejo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396249/3396249_720p.mp4</video:content_loc>
      <video:duration>138</video:duration>
      <video:publication_date>2026-09-02T01:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As melhores filme de ação</video:title>
      <video:description>### fala rapaziada estão bom*** Aa melhores filme de luta esse ano 2026 ### deixar seu comentário e curtida e escreve no canal ***</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396248/3396248_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-02T01:31:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 10</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 10 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396246/3396246_720p.mp4</video:content_loc>
      <video:duration>3073</video:duration>
      <video:publication_date>2026-09-02T01:30:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>zdsw422</video:title>
      <video:description>tr6yfhbcgy #oo80ojnmkli</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396245/3396245_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T01:30:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Regra dos 3 Bolsos: Saia do Improviso Financeiro</video:title>
      <video:description>Você acha que orçamento é só “preencher planilha”? O segredo é outro: é um sistema anti-improviso para você parar de deixar o dinheiro decidir por você. Aprenda a regra dos 3 bolsos (Reservas, Pagas e Vida), com exemplo prático: de R$ 2.000, separe R$ 400, R$ 1.200 e R$ 400. Pegue sua renda do próximo pagamento e comece hoje! #EducaçãoFinanceira #OrçamentoPessoal #Finanças</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396243/3396243_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T01:30:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New beauty hacks for beautiful cheeks</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396242/3396242_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T01:29:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396240</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396240/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Espíritos me a companharam</video:title>
      <video:description>Fiz uma investigação Sobrenatural em um cemitério #investigaçãoSobrenaturalCaruaru</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396240/3396240_720p.mp4</video:content_loc>
      <video:duration>1705</video:duration>
      <video:publication_date>2026-09-02T01:29:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396239</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396239/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This Tiny Fried Chicken Is Too Satisfying 🤯</video:title>
      <video:description>🍗🔥 What happens when you make crispy fried chicken… but TINY? Watch this miniature chicken go from a tiny seasoned piece of meat to an unbelievably crispy, golden-brown bite in a handcrafted miniature kitchen. Listen to the satisfying sizzle, crackle, bubbling oil and that final crispy crunch. 🤤 Would you try this tiny fried chicken? 👀 #ASMRMiniatureCookingTinyFoodFoodASMRCrispyChickenSatisfyingShorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396239/3396239_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:29:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#cat #orangecat</video:title>
      <video:description>#Animals #cat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396238/3396238_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T01:29:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Juros Compostos: o Segredo para Multiplicar Seu Dinheiro</video:title>
      <video:description>Juros não é só “o problema”: é também o seu plano de fuga. Neste vídeo, explicamos como os **juros compostos** transformam aportes mensais em patrimônio ao longo do tempo — e por que **atrasar** pode custar caro. Entenda o exemplo com R$ 200/mês e veja como começar hoje com **aporte automático** e consistência. #JurosCompostos #Investimentos #EducaçãoFinanceira #RendaFixa #AporteAutomático #Finanças</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396236/3396236_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-02T01:28:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Batman</video:title>
      <video:description>Na noturna Gothan chuvosa o batman vai atrás do jocker e seus capangas #RAINBatman</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396235/3396235_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:28:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ELECTRONIC VIBES 🔥 | Deep &amp; Chill Electronic Music</video:title>
      <video:description>Step into a world of electronic vibes. 🎧🔥 Enjoy this powerful mix of deep, chill and atmospheric electronic music — perfect for relaxing, driving, working, gaming or simply escaping into the sound. 🎶 Turn up the volume and enjoy the journey. If you enjoy electronic music, follow for more tracks and mixes. #electronicmusic #edm #deephouse #chillmusic #electronicvibes #dancemusic #relaxingmusic #deepmusic #chillelectronic #housemusic #electronicmix #edmmix #backgroundmusic #studymusic #drivingmusic #nightdrive #atmosphericmusic #loungemusic #techno #clubmusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396234/3396234_720p.mp4</video:content_loc>
      <video:duration>384</video:duration>
      <video:publication_date>2026-09-02T01:28:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOST CITIES DISCOVERED IN THE AMAZON ( ENGLISH SUBTITLES)</video:title>
      <video:description>For centuries, the Amazon rainforest was often portrayed as an untouched wilderness. But recent archaeological discoveries are changing that view. Using LiDAR technology, researchers have revealed enormous networks of ancient settlements, roads, plazas, canals, and monumental earthworks hidden beneath the forest. In Ecuador’s Upano Valley, thousands of structures reveal a complex urban landscape that existed more than 2,000 years ago. And in 2026, researchers reported more than 20,000 pre-Columbian earthworks across parts of southwestern Amazonia, suggesting that ancient populations may have been far larger and more organized than previously believed.lost The discoveries are rewriting our understanding of the Amazon — and raising a fascinating question: how many ancient cities are still hidden beneath the jungle? #DOCUMENTÁRIO #história #mistério #civilizaçãoantiga #amazônia #educação #ciência #entretenimento #arqueologia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396232/3396232_720p.mp4</video:content_loc>
      <video:duration>370</video:duration>
      <video:publication_date>2026-09-02T01:28:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vale a pena investir ?/ Is it worth investing?</video:title>
      <video:description>💡 Não espere sobrar dinheiro para começar. Aprenda a organizar seu dinheiro para que uma parte dele trabalhe por você. Seu futuro financeiro começa com as decisões que você toma hoje. #dinheiro #finançaspessoais #economizar #investimentos #RendaExtra</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396230/3396230_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-02T01:27:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As melhores filmes de ação</video:title>
      <video:description>### fala rapaziada estão bom** ### as melhores filme de luta esse anos 2026, não pega assista. ### deixar seu comentário e curtida e escreve no canal***</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396228/3396228_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T01:27:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PNG Boika</video:title>
      <video:description>Around the second city of PNG Lae</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396227/3396227_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-02T01:27:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Russian beautiful girl 3</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396226/3396226_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-02T01:26:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lisboa: história, fado e sabores inesquecíveis</video:title>
      <video:description>Você já imaginou caminhar por uma cidade onde o passado sussurra em cada esquina? Em Lisboa, o charme das colinas e dos azulejos se mistura ao sabor de Alfama, às vistas do Tejo e aos marcos históricos em Belém. Termine o dia com um fado ao entardecer e prove bacalhau de nata, pastéis de nata e caldo verde. Lisboa termina no coração — e dá vontade de voltar! #Lisboa #Alfama #Tejo #TorreDeBelém #Viagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396225/3396225_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-02T01:26:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Portão Do Abismo</video:title>
      <video:description>#Narratiz #históriasreaisdeterror #lendasurbanas #relatossobrenaturais #mistériosnãoresolvidos #suspenseintenso #segredosocultos #medo #sombrias #arrepios #inexplicável #obscuro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396223/3396223_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-09-02T01:26:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tribo da Periferia</video:title>
      <video:description>Imprevisível ao um rap irresistível #Hiphop #brasil #love #nacional</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396222/3396222_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-09-02T01:25:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Portão Do Abismo parte 2</video:title>
      <video:description>#Narratiz #históriasreaisdeterror #lendasurbanas #relatossobrenaturais #mistériosnãoresolvidos #suspenseintenso #segredosocultos #medo #sombrias #arrepios #inexplicável #obscuro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396220/3396220_720p.mp4</video:content_loc>
      <video:duration>262</video:duration>
      <video:publication_date>2026-09-02T01:25:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kit completo na caixa</video:title>
      <video:description>Parafusadeira e furadeira completa na promoção #Promoção</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396219/3396219_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:25:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 09</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 09 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396218/3396218_720p.mp4</video:content_loc>
      <video:duration>2872</video:duration>
      <video:publication_date>2026-09-02T01:25:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lisboa: História, Fado e Pastéis de Nata</video:title>
      <video:description>Lisboa é como um segredo histórico a céu aberto: comece em Alfama e nos miradouros sobre o Tejo, atravesse a Baixa e o Bairro Alto, aproveite o bonde clássico e saboreie pasteis de nata quentinhos. À noite, descubra o fado e finalize em Belém com monumentos e doces tradicionais. Venha viver essa experiência! #Lisboa #Portugal #Alfama #Miradouros #Tejo #BairroAlto #Baixa #Bonde #PastelDeNata #Fad #Viagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396217/3396217_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-02T01:25:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Esporte Clube Bahia derrota o Vitoria dentro do galheiro.</video:title>
      <video:description>Bahia ganha de 2 X 0 e Jean Lucas quase perde a camisa de Aço da puma. #Brasil #campeonatobrasileiro #Bahia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396215/3396215_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-09-02T01:24:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Portão Do Abismo Parte 03</video:title>
      <video:description>#Narratiz #históriasreaisdeterror #lendasurbanas #relatossobrenaturais #mistériosnãoresolvidos #suspenseintenso #segredosocultos #medo #sombrias #arrepios #inexplicável #obscuro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396214/3396214_720p.mp4</video:content_loc>
      <video:duration>373</video:duration>
      <video:publication_date>2026-09-02T01:24:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 08</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 08 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396213/3396213_720p.mp4</video:content_loc>
      <video:duration>3300</video:duration>
      <video:publication_date>2026-09-02T01:24:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele estava escondendo um segredo da família</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396212/3396212_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-02T01:24:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>trabalho</video:title>
      <video:description>trabalho bom e assim</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396211/3396211_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-02T01:23:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 07</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 07 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396210/3396210_720p.mp4</video:content_loc>
      <video:duration>3149</video:duration>
      <video:publication_date>2026-09-02T01:23:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boquenilse na resenha</video:title>
      <video:description>Boquenilse na resenha</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396209/3396209_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T01:23:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lisboa: Um Passeio Entre Fado e Pastéis de Nata</video:title>
      <video:description>Lisboa é aquele tipo de cidade que te faz caminhar sem pressa: miradouros com o Tejo em tons dourados, elétricos pelas ladeiras, bairros históricos cheios de cultura, fado em pequenas casas e sabores irresistíveis como pastéis, bacalhau cremoso e sardinhas grelhadas. Vem sentir a alma portuguesa! #Lisboa #Portugal #Viagem #Roteiro #Miradouros #Tejo #Elétricos #Fado #CulináriaPortuguesa #PastelDeNa #Viagem</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396208/3396208_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-02T01:23:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 06</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 06 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396207/3396207_720p.mp4</video:content_loc>
      <video:duration>3063</video:duration>
      <video:publication_date>2026-09-02T01:22:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gwen tennyson twerk</video:title>
      <video:description>#Twerk #gwentennyson #rule34</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396206/3396206_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-02T01:22:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>THE FLORIST Official Trailer (2026) Dennis Quaid, Jean Reno</video:title>
      <video:description>THE FLORIST Official Trailer (2026) Dennis Quaid, Jean Reno</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396205/3396205_720p.mp4</video:content_loc>
      <video:duration>100</video:duration>
      <video:publication_date>2026-09-02T01:21:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 05</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 05 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396204/3396204_720p.mp4</video:content_loc>
      <video:duration>3030</video:duration>
      <video:publication_date>2026-09-02T01:21:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Linda mulher 👍😜</video:title>
      <video:description>Mulher 👍😜</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396203/3396203_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-02T01:21:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O pagamento é você poder ajudar o próximo.😇🤝🙏😇 3</video:title>
      <video:description>O pagamento é você poder ajudar o próximo.😇🤝🙏😇</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396202/3396202_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-02T01:21:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ami suegra le dicen satanás</video:title>
      <video:description>A mí suegra le dicen satanás</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396201/3396201_720p.mp4</video:content_loc>
      <video:duration>157</video:duration>
      <video:publication_date>2026-09-02T01:21:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mãe mim presta dinheiro até amanhã 😁😁😁</video:title>
      <video:description>#todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396200/3396200_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T01:21:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Which one is your favorite? 2</video:title>
      <video:description>Which one is your favorite?</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396199/3396199_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T01:20:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 04</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 04 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396198/3396198_720p.mp4</video:content_loc>
      <video:duration>3141</video:duration>
      <video:publication_date>2026-09-02T01:20:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>STREET FIGHTER Official Trailer 2 (2026)</video:title>
      <video:description>STREET FIGHTER Official Trailer 2 (2026)</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396197/3396197_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-02T01:20:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tes sederhana ini digunakan untuk menilai seberapa baik kedua mata bekerja</video:title>
      <video:description>Tes sederhana ini digunakan untuk menilai seberapa baik kedua mata bekerja sama saat mengikuti suatu objek yang bergerak semakin dekat ke arah hidung. Dalam kondisi normal, mata kanan dan kiri akan bergerak ke dalam secara bersamaan agar fokus tetap tertuju pada target yang sama. Namun jika salah satu mata mulai bergerak keluar atau kehilangan fokus lebih dulu, hal itu dapat menunjukkan adanya gangguan pada koordinasi penglihatan jarak dekat. Kondisi ini dikenal sebagai insufisiensi konvergensi dan dapat menyebabkan keluhan seperti mata cepat lelah, sulit berkonsentrasi saat membaca, sakit kepala, atau sesekali melihat bayangan ganda. Pemeriksaan sederhana seperti ini sering digunakan untuk mengevaluasi kerja sama kedua mata dan kemampuan otak dalam mengendalikan fokus penglihatan. Sumber: National Eye Institute (NEI) 📍Link cek di bio Ikuti👉 dewafakta 👈 untuk video-video fakta menarik lainnya 📩 DM untuk penghapusan video. ⚠️ Semua gambar adalah milik pemiliknya masing-masing‼️ #fakta</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396196/3396196_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T01:20:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Friends Forever</video:title>
      <video:description>True friends stand by each other through the good times and the bad! #friendstruefriendsfriendsforever</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396195/3396195_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-02T01:20:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Músicas pré save nunca lançados</video:title>
      <video:description>Mc kevin todas as músicas não lançadas. #Estadosunidos #funk #cultura #favela #brasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396194/3396194_720p.mp4</video:content_loc>
      <video:duration>1420</video:duration>
      <video:publication_date>2026-09-02T01:20:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A chegada da bebê!</video:title>
      <video:description>A chegada da bebê #Bebe #grávida #arrumação #sentindo #emoção #realizada</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396193/3396193_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T01:20:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Porrinha</video:title>
      <video:description>Porrinha do marido delicia na bucetinha #Casa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396192/3396192_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T01:20:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Golden” Official Lyric Video | KPop Demon Hunters | Sony Animation</video:title>
      <video:description>✨ “GOLDEN” – Official Lyric Video | KPop Demon Hunters | Sony Animation ✨ Get ready to enter the world of *KPop Demon Hunters* with “Golden” in this exciting official lyric video! 🎶🔥 Follow along with the music and lyrics as the adventure comes to life in a visual experience packed with energy, style, and plenty of excitement. 🎤 Song: Golden 🎬 Movie: KPop Demon Hunters 🎵 Format: Official Lyric Video ✨ Sony Animation | Netflix 👍 Like the video? Hit the like button, subscribe to the channel, and turn on notifications (🔔) to keep up with more music, lyric videos, and musical content. 💬 Comment: What did you think of “Golden”? #Golden #KPopDemonHunters #LyricVideo #KPop #SonyAnimation #Netflix #KPopMusic #OfficialLyricVideo #GoldenSong</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396191/3396191_720p.mp4</video:content_loc>
      <video:duration>199</video:duration>
      <video:publication_date>2026-09-02T01:19:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TULSA KING Season 4 Official Teaser Trailer (2026)</video:title>
      <video:description>TULSA KING Season 4 Official Teaser Trailer (2026)</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396190/3396190_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-02T01:19:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 03</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 03 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396188/3396188_720p.mp4</video:content_loc>
      <video:duration>2696</video:duration>
      <video:publication_date>2026-09-02T01:19:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396186</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396186/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eles mexeram com o cara errado</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396186/3396186_720p.mp4</video:content_loc>
      <video:duration>110</video:duration>
      <video:publication_date>2026-09-02T01:18:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 02</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 02 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396185/3396185_720p.mp4</video:content_loc>
      <video:duration>2725</video:duration>
      <video:publication_date>2026-09-02T01:18:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396184</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396184/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reynaldo armas usted señora</video:title>
      <video:description>Usted señora Reynaldo armas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396184/3396184_720p.mp4</video:content_loc>
      <video:duration>201</video:duration>
      <video:publication_date>2026-09-02T01:18:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kızılcık Şerbeti /  A Força do amor 01</video:title>
      <video:description>Kızılcık Şerbeti / A Força do amor 01 #KızılcıkŞerbetiAForçadoamor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396182/3396182_720p.mp4</video:content_loc>
      <video:duration>2799</video:duration>
      <video:publication_date>2026-09-02T01:17:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396181</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396181/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bem vindo ao Frequência Divina</video:title>
      <video:description>É uma prazer ter vocês no familia Frequência, vamos cantar juntos, aprender e ensinar, trocar ideias, poder chegar ate vocês vai ser uma experiência incrível e levar a palavra de Deus, TODOS SOMOS UM!!!!! #trapdeusrapviralviraliza</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396181/3396181_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T01:16:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YOU ARE NOT WEAK.</video:title>
      <video:description>YOU ARE NOT WEAK. You just need to learn to control what tries to control you. Stop doubting. Stop seeking approval. Train your mind. Strengthen your discipline. Master your actions. True power does not need to be announced. It is built in silence. WYAN VEX 🐺♟️ Control • Mastery • Discipline #WyanVex #Control #Mastery #Discipline #Mindset #Focus #MentalStrength #Mindset #SelfControl #Silence #WyanVexControlMasteryDisciplineMindsetFocusMentalStrengthMindsetSelfControlSilence</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396179/3396179_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T01:16:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Essa é o nosso movimento de música aqui do Maranhão</video:title>
      <video:description>Paredão de radiola hiper mega Itamarati #Dêumaolhadanonossovídeo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396178/3396178_720p.mp4</video:content_loc>
      <video:duration>1767</video:duration>
      <video:publication_date>2026-09-02T01:16:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396177</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396177/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BELA CANÇÃO 🥰</video:title>
      <video:description>I&apos;m in love with this song. 😍🥰 #Música #top #show #viral #sucesso</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396177/3396177_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T01:16:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396176</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396176/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arsenal bungkam Aston Villa 1-0 di Villa Park lewat  gol tunggal Bukayo Saka pada menit ke-59.</video:title>
      <video:description>Fakta Menarik Pertandingan Catatan Bersejarah Saka: Lewat gol tunggalnya, Bukayo Saka resmi menjadi pemain termuda ketiga dalam sejarah Arsenal yang sukses mencetak 60 gol di Premier League, hanya kalah dari legenda klub, Thierry Henry dan Ian Wright. Milestone Istimewa Arteta: Kemenangan ini menandai laga ke-250 Mikel Arteta sebagai manajer di Premier League, sekaligus mempertegas dominasinya dalam adu taktik sesama pelatih asal Spanyol melawan Unai Emery.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396176/3396176_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-02T01:16:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Girl You Can’t Stop Watching</video:title>
      <video:description>Discover a beautiful girl with stunning style and natural beauty. ✨ Watch this amazing video and enjoy the look, fashion, and unforgettable moments. If you love beautiful girls, fashion, beauty, and lifestyle content, this video is for you! #BeautifulGirl #PrettyGirl #GorgeousGirl #CuteGirl #StunningGirl #BeautifulWoman #PrettyWoman #Beauty #FashionGirl #Model #Glamour #GirlStyle #BeautyLifestyle #AttractiveGirl #HotGirl #ViralGirl #TrendingGirl #ViralVideo #Tr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396175/3396175_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-02T01:15:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Talvez a vida esteja apenas mudando de estação. 🌿</video:title>
      <video:description>Nem toda fase difícil significa que você está no caminho errado. Às vezes, a vida apenas precisa de tempo para transformar aquilo que hoje parece vazio em algo novo. Há momentos em que você não precisa correr, insistir ou entender tudo. Precisa apenas continuar. Porque algumas coisas não florescem quando queremos. Florescem quando estamos prontos para recebê-las. 🌻 Talvez você não esteja parado. Talvez esteja florescendo. #natureza #reflexão #motivação #motivation</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396174/3396174_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T01:15:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Mysteries of the Egyptian Pyramids: Secrets That Still Remain Unsolved</video:title>
      <video:description>For thousands of years, the pyramids of Egypt have stood as one of humanity&apos;s greatest mysteries. How were these massive structures built with such incredible precision? Why were they designed the way they were? And what secrets could still be hidden within their ancient chambers? In this video, we explore the most fascinating mysteries surrounding the Egyptian pyramids — from their astonishing engineering and astronomical alignments to hidden chambers, ancient theories, and questions that continue to puzzle researchers. 🔺 The Great Pyramid of Giza 🏺 Ancient Egyptian secrets 🌌 Astronomical mysteries 🧩 Hidden chambers and unexplained discoveries 👁️ Theories that challenge what we think we know The deeper we look, the more mysterious the pyramids become. Are we still missing the greatest secret of ancient Egypt? #egyptpyramids #pyramidsofegypt #greatpyramidofgiza #ancientegypt #egyptianpyramids #mysteriesofthepyramids #pyramidmysteries #secretsofegypt #ancientegyptmysteries #egyptmysteries #greatpyramidmysteries #hiddenchambers #pyramidsecrets #ancientcivilizations #egyptiancivilization #unexplainedmysteries #unsolvedmysteries #archaeologicalmysteries #ancienthistory #archaeology #gizapyramids #pharaohs #egyptiansecrets #lostsecretsofegypt #mysteriousdiscoveries #ancientmysteries #forbiddenarchaeology #hiddensecrets #ancienttechnology #howwerethepyramidsbuilt #pyramidconstruction #secretsofthegreatpyramid #mysteriesofancientegypt</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396173/3396173_720p.mp4</video:content_loc>
      <video:duration>209</video:duration>
      <video:publication_date>2026-09-02T01:15:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396172</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396172/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Esse cara tinha um Queixo que chamava muita atenção</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396172/3396172_720p.mp4</video:content_loc>
      <video:duration>137</video:duration>
      <video:publication_date>2026-09-02T01:15:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você lembra do Lendário COMETÃO? O Ônibus mais cobiçado da época</video:title>
      <video:description>Lendário COMETÃO? O Ônibus mais cobiçado da época #Ônibus #ônibusantigos #nostalgia #velho #saudade #lembranças</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396170/3396170_720p.mp4</video:content_loc>
      <video:duration>275</video:duration>
      <video:publication_date>2026-09-02T01:14:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Most Excited Little Farmer in Indonesia&apos;s Parade</video:title>
      <video:description>`The atmosphere of Indonesia’s Independence Day Parade is so lively `Look at this &quot;little farmer&quot; walking with so much energy. Blue hat, plaid shirt, carrying a bamboo pole while dancing` #Carnaval #Indonesia #Larantuka #parade #Independenceday #cultural #festival #farmer #EastNusaTenggara</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396169/3396169_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:14:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐙 Giant Octopus Underwater - Cinematic AI Short</video:title>
      <video:description>Mind-blowing AI-generated footage of a giant octopus swimming through deep ocean waters. Sunlight rays filter through as the creature moves its tentacles with incredible realism. Created with advanced AI. #shorts #ocean #octopus #ai #cinematic #octopus #ocean #underwater #AI #cinematic #sea #marine #animals #shorts #viral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396168/3396168_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T01:14:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fisher fishing</video:title>
      <video:description>Pescaria 🎣 fishing #Fishing</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396167/3396167_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T01:14:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prepare-se comigo para a manhã do jogo de futebol.</video:title>
      <video:description>Prepare-se comigo para a manhã do jogo de futebol. #futebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396165/3396165_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T01:14:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤟🏾🤟🏾MEGAMETAL🤟🤟</video:title>
      <video:description>The heavy sound of metal is not merely noise; it is a physical and meticulously crafted sonic experience. #HeavyMetalSom</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396164/3396164_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-02T01:13:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Do LIXO AO LUXO</video:title>
      <video:description>Restauração do carro #carrorestauraçãoluxo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396163/3396163_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-02T01:13:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396162</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396162/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Banda Hambre Fragmentado</video:title>
      <video:description>Fragmentado é um estado mental em que a pessoa pode se encontrar, muitas vezes provocado por fatores como fadiga, estresse, sobrecarga emocional ou outras situações da vida. É um grito silencioso por ajuda. E, em muitos casos, quem vive essa condição nem percebe que está passando por ela. Permita-se olhar para si com mais cuidado. Peça ajuda. Ofereça ajuda. #musica #lyric #feliz #n</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396162/3396162_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-02T01:13:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396161</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396161/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sem estilo de desenho animado, sem baixa qualidade, sem imagem desfocada de celular, sem distorção d</video:title>
      <video:description>Sem estilo de desenho animado, sem baixa qualidade, sem imagem desfocada de celular, sem distorção de dispositivo, sem irrealidade. #Semestilodedesenhoanimado #sembaixaqualidade #semimagemdesfocadadecelular #semdistorçãodedispositivo #semirrealidade</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396161/3396161_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T01:13:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic prayers and supplications 2</video:title>
      <video:description>Islamic prayers and supplications</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396160/3396160_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>طبخ جميل</video:title>
      <video:description>طبخ جميل #طبخجميل</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396159/3396159_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T01:12:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mensagem motivacional 3</video:title>
      <video:description>Motivação #Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396158/3396158_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T01:12:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR Mukbang 3</video:title>
      <video:description>#ASMRMukbang</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396157/3396157_720p.mp4</video:content_loc>
      <video:duration>102</video:duration>
      <video:publication_date>2026-09-02T01:12:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396156</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396156/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O SINAL DO ESPAÇO QUE SE REPETE A CADA 16 DIAS #Curiosidades #PontoDeVirada #space #universo #nasa</video:title>
      <video:description>Um sinal real vem do espaço profundo e se repete em intervalos exatos. Cientistas ainda discutem sua origem. Você acredita que já sabemos tudo sobre o universo? 💡 Inscreva-se e ative o sininho 🔔 para não perder os próximos vídeos do canal! 🔹 Siga o Ponto de Virada. #PontoDeViradaCuriosidadesFatosCuriososVocêSabiaMisteriosDoMundoCiênciaUniversoShortsuniversosinaldoespacomistériofatosreaispontodeviradashortsyoutubeshortsnasaespacospace</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396156/3396156_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-02T01:12:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396155</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396155/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐶 Chef Dog’s Pancake Disaster 😂🥞</video:title>
      <video:description>#UnitedStates</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396155/3396155_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T01:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trabalhando na obra 2</video:title>
      <video:description>Trabalhando na obra trabalhando na obr #Desidério</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396154/3396154_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T01:12:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu com meu amor</video:title>
      <video:description>#amorgatosdivertidocomediaticktock</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396153/3396153_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T01:12:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>have we been here before?</video:title>
      <video:description>a beautiful place to get lost in #dreamcoreliminalspacenostalgiasurrealismweirdcoreoddlyfamiliaraestheticsunsetvibesdreamscapelofi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396152/3396152_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-02T01:12:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mensagem motivacional 2</video:title>
      <video:description>Motivação #Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396151/3396151_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:11:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cena cinematográfica ultrarrealista em um portão de Gwanghwamun destruído.</video:title>
      <video:description>Cena cinematográfica ultrarrealista em um portão de Gwanghwamun destruído. #CenacinematográficaultrarrealistaemumportãodeGwanghwamundestruído</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396150/3396150_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T01:11:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Motivação 50</video:title>
      <video:description>Motivacao #Motivação</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396149/3396149_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-02T01:11:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Walkthrough Gameplay - Mafia III - Parte 4 - Missões Delray Hollow - Play Brasil</video:title>
      <video:description>Walkthrough Gameplay - Mafia III - Parte 4 - Missões Delray Hollow - Play Brasil #game #gameplay #mafia3 #mafiaIII</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396148/3396148_720p.mp4</video:content_loc>
      <video:duration>2614</video:duration>
      <video:publication_date>2026-09-02T01:11:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396147</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396147/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Linda canção 🥰</video:title>
      <video:description>아름다운 노래네요 😍 #Música #top #show #viral #febre</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396147/3396147_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-02T01:11:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Genesis of the Abyss</video:title>
      <video:description>Nnice</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396146/3396146_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-02T01:11:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VOCÊ NÃO VAI PARAR DE RIR KKK</video:title>
      <video:description>Você não vai parar de rir kkk #Humor #risada #rir #Gargalhada #comédia #humorviral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396145/3396145_720p.mp4</video:content_loc>
      <video:duration>1833</video:duration>
      <video:publication_date>2026-09-02T01:10:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Captivating K-drama #kdrama feigning surprise</video:title>
      <video:description>Captivating K-drama #kdrama feigning surprise</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396144/3396144_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T01:10:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GOLPES LOUVO</video:title>
      <video:description>LOUVOR #LOUVO24</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396143/3396143_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-02T01:10:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Selfie Lamp</video:title>
      <video:description>Lamp for handphone #lamp #selfielamp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396142/3396142_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:10:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O pagamento é você poder ajudar o próximo.😇🤝🙏😇 2</video:title>
      <video:description>O pagamento é você poder ajudar o próximo.😇🤝🙏😇</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396141/3396141_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-09-02T01:10:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR Mukbang 2</video:title>
      <video:description>#Asmr</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396140/3396140_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T01:10:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Risadas na hora 😭😭</video:title>
      <video:description>#todos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396138/3396138_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-02T01:09:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A mulher precisava se casar para se livrar do tio</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396137/3396137_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-09-02T01:09:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Esse vídeo foi gravado no meu quintal hoje Arara comendo como</video:title>
      <video:description>Esse vídeo foi gravado no meu quintal #Febpot #vídeo #viral #natureza #animais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396136/3396136_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T01:09:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O pagamento é você poder ajudar o próximo.😇🤝🙏😇</video:title>
      <video:description>O pagamento é você poder ajudar o próximo.😇🤝🙏😇</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396135/3396135_720p.mp4</video:content_loc>
      <video:duration>155</video:duration>
      <video:publication_date>2026-09-02T01:09:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DR BADICO</video:title>
      <video:description>BADICO #BADICO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396134/3396134_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:08:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FORROZÃO NOS TECLADOS  2027</video:title>
      <video:description>BORA DANÇAR COM ESSE FORROZÃO #FORROZÃO</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396133/3396133_720p.mp4</video:content_loc>
      <video:duration>137</video:duration>
      <video:publication_date>2026-09-02T01:08:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rap Nelly</video:title>
      <video:description>Rapper internacional Sucesso #EstadosUnidos #rapper</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396132/3396132_720p.mp4</video:content_loc>
      <video:duration>281</video:duration>
      <video:publication_date>2026-09-02T01:07:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>They humiliated her and look what happened (Drama)</video:title>
      <video:description>They humiliated her and look what happened (Drama)</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396131/3396131_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T01:07:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WYAN VEX</video:title>
      <video:description>Enquanto eles falam, eu observo. Enquanto eles pedem permissão, eu me preparo. Quem explica demais revela seus planos. Quem age em silêncio deixa os resultados falarem. Não anuncie. Não peça. Não prove. Observe. Prepare-se. Aja. WYAN VEX 🐺♟️ Controle • Disciplina • Domínio #WyanVex #Controle #Disciplina #Domínio #Foco #ForcaMental</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396130/3396130_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-02T01:07:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Perfeição da Criação de Deus :Colinas, Cachoeiras e Flores Feitas pelas Mãos do Criador.🙏</video:title>
      <video:description>Uma verdadeira celebração da natureza como reflexo da glória e do amor de Deus. Gratidão à Deus por mais um dia 🙏 #feem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396129/3396129_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T01:07:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sitting here - DJ LKS RIT INTERNATIONAL</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866 #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396128/3396128_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-02T01:07:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O que parecia um desastre se tornou um milagre</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396127/3396127_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T01:06:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Guitar Hero 3 - &quot;Through The Fire and Flames&quot; Expert 100% FC (988,582</video:title>
      <video:description>Historical 100% Full Combo run of &quot;Through the Fire and Flames&quot; on Expert in Guitar Hero III , achieving a legendary score of 988,582 points. #GuitarHero3ThroughTheFireAndFlamesDragonForceExpertFCGamingRecord</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396126/3396126_720p.mp4</video:content_loc>
      <video:duration>452</video:duration>
      <video:publication_date>2026-09-02T01:06:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PISA-OLA</video:title>
      <video:description>PISA-OLA #PISA-OLA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396125/3396125_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T01:06:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Onde eu posso comprar? Avião modelo F14 #F14 #avião modelo</video:title>
      <video:description>Isso provavelmente não seria possível sem pelo menos 10.000 dólares. Ele é realmente muito bonito.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396124/3396124_720p.mp4</video:content_loc>
      <video:duration>158</video:duration>
      <video:publication_date>2026-09-02T01:05:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fantasia Sombria</video:title>
      <video:description>Fantasia Sombria #FantasiaSombria</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396123/3396123_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T01:05:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LULA ELE PAGARÁ PELO ERRO QUE COMETEU</video:title>
      <video:description>🚨 “LULA: ELE PAGARÁ PELO ERRO QUE COMETEU” Uma declaração forte de Lula que chama atenção e levanta uma pergunta: quem é a pessoa mencionada e qual foi o erro que teria cometido? 👀 A fala repercutiu e pode gerar muita discussão sobre responsabilidade, justiça e consequências. Assista até o final e entenda o contexto. 💬 Na sua opinião, quem erra deve pagar pelas consequências? #Lula #Brasil #Política #PolíticaBrasileira #Justiça #Notícias #Atualidades #Governo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396122/3396122_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-02T01:05:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu bebê desapareceu da minha barriga</video:title>
      <video:description>Dorama #Viagem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396121/3396121_720p.mp4</video:content_loc>
      <video:duration>155</video:duration>
      <video:publication_date>2026-09-02T01:04:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ainda Escolheria Você 💖 | Uma Canção Para Quem Acredita no Amor Verdadeiro</video:title>
      <video:description>Ainda Escolheria Você Algumas histórias de amor sobrevivem ao tempo. Outras sobrevivem porque duas pessoas escolhem permanecer juntas, todos os dias. &quot;Ainda Escolheria Você&quot; é uma música romântica original que retrata um amor verdadeiro capaz de atravessar os anos, enfrentar desafios e permanecer forte mesmo diante das dificuldades da vida. Com uma atmosfera cinematográfica, piano emocionante, violão acústico e uma interpretação carregada de sentimento, esta canção celebra o amor que resiste ao tempo e continua sendo escolhido todos os dias. ❤️ Se você acredita no amor verdadeiro, compartilhe esta música com alguém especial. #aindaescolheriavocê #músicaromântica #musicaromantica #músicadeamor #musicadeamor #amorverdadeiro #históriadeamor #historiasdeamor #baladaromântica #baladaromantica #músicaemocionante #musicaemocionante #músicaoriginal #musicaoriginal #carmostudio #romanticpopballad #adultcontemporary #lovesong #amoreterno #amorparasempre #casalapaixonado #músicabrasileira #violãoacústico #cinematicpop #saudade #amor #romance #músicaromânticabrasileira</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396120/3396120_720p.mp4</video:content_loc>
      <video:duration>326</video:duration>
      <video:publication_date>2026-09-02T01:04:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milho pra ele e veneno 😭😭</video:title>
      <video:description>#todos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396119/3396119_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-02T01:04:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I feel strange - DJ LKS RIT INTERNATIONAL</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866 #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396118/3396118_720p.mp4</video:content_loc>
      <video:duration>226</video:duration>
      <video:publication_date>2026-09-02T01:04:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Detetive particular 2</video:title>
      <video:description>Direitos e métodos de garantias! #Detetiveparticular #investigador #direito #trabalhista</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396117/3396117_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-02T01:04:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ranking Dilera&apos;s Best Moments</video:title>
      <video:description>RANKEANDO MELHORES MOMENTOS DO DILERA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396116/3396116_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-02T01:04:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“O Mistério dos Buracos Negros Supermassivos” #Curiosidades #PontoDeVirada #universo #space #nasa</video:title>
      <video:description>Um buraco negro supermassivo esconde um dos maiores mistérios do universo — e ele está bem no centro da nossa própria galáxia! 🌌 Sagitário A* tem mais de 4 milhões de vezes a massa do Sol e devora tudo que chega perto. 🤯 Neste vídeo você vai descobrir por que esses monstros cósmicos moldam galáxias inteiras e continuam desafiando a ciência até hoje. Prepare-se para uma viagem rápida e surpreendente pelo coração da Via Láctea. 🚀✨ Se você ama curiosidades do universo, física, galáxias e mistérios espaciais, este vídeo é pra você! 🔔 Siga para mais curiosidades reais sobre o espaço! #universo #espaco #buraconegro #nasa #curiosidades #astronomia #viadelactea #cosmos #science #shorts #viral #mistérios #galaxias #space #blackhole #astrofísica #bigbang #cosmic #universoespacoburaconegronasacuriosidadesastronomiaviadelacteacosmosscienceshortsviralmistériosgalaxiasspaceblackholeastrofísicabigbangcosmicPontoDeViradaCuriosidadesFatosCuriososVocêSabiaMisteriosDoMundoCiênciaUniversoShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396115/3396115_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-02T01:04:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trinca Ferro</video:title>
      <video:description>Pássaros de cantos em competição. #Criador #Pássaros #Aves #Canto</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396114/3396114_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T01:04:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hector vs Achilles — Two Legends, Two Paths ⚔️</video:title>
      <video:description>He was not fighting for glory. He was fighting for his family, his people, and his city. Hector knew exactly what was waiting for him — and still chose to face it. Achilles sought immortality through his name. Hector found immortality through his courage, honor, and sacrifice. Two legends. Two paths. One unforgettable story. Who do you admire more: Hector or Achilles? ⚔️🔥 #HectorAchillesTroyMotivationWarriorMindsetGreekMythologyCourageHonorDisciplineMovieEdit</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396113/3396113_720p.mp4</video:content_loc>
      <video:duration>207</video:duration>
      <video:publication_date>2026-09-02T01:03:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toyota Supra Fast e Furious</video:title>
      <video:description>#carroSupra</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396112/3396112_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T01:03:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>histoire du crocodile et le singe</video:title>
      <video:description>c</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396111/3396111_720p.mp4</video:content_loc>
      <video:duration>194</video:duration>
      <video:publication_date>2026-09-02T01:03:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Perfect Panties: Casual, Special Occasion, or Future Use</video:title>
      <video:description>The Perfect Panties: Casual, Special Occasion, or Future Use</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396110/3396110_720p.mp4</video:content_loc>
      <video:duration>139</video:duration>
      <video:publication_date>2026-09-02T01:03:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drama 84</video:title>
      <video:description>#Dorama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396109/3396109_720p.mp4</video:content_loc>
      <video:duration>142</video:duration>
      <video:publication_date>2026-09-02T01:02:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drama 83</video:title>
      <video:description>#Drama #Dorama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396108/3396108_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-02T01:02:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>xxdswe43</video:title>
      <video:description>467trghfxvb #80pojlkjm</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396107/3396107_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T01:02:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atlético mineiro x Cruzeiro Chamada Copa do brasil</video:title>
      <video:description>#Futebol #cruzeiro #atléticomineiro</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396106/3396106_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T01:02:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dorama 16</video:title>
      <video:description>#Drama #Dorama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396105/3396105_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T01:02:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Telling the story - DJ LKS RIT INTERNATIONAL</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866 #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396104/3396104_720p.mp4</video:content_loc>
      <video:duration>102</video:duration>
      <video:publication_date>2026-09-02T01:01:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Fashion Frenzy</video:title>
      <video:description>A Fashion Frenzy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396103/3396103_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T01:01:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Akon  smack that</video:title>
      <video:description>Rapper internacional #Rap #hiphop #flow</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396102/3396102_720p.mp4</video:content_loc>
      <video:duration>212</video:duration>
      <video:publication_date>2026-09-02T01:01:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Risadas na certa😭😭</video:title>
      <video:description>#todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396101/3396101_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T01:00:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strengths and Weaknesses: Two Women, Two Styles!</video:title>
      <video:description>Strengths and Weaknesses: Two Women, Two Styles!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396099/3396099_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-02T01:00:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você conhece mesmo as regras do rodeio? Do you really know the rules of rodeo?</video:title>
      <video:description>Você conhece mesmo as regras do rodeio? Do you really know the rules of rodeo?</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396098/3396098_720p.mp4</video:content_loc>
      <video:duration>147</video:duration>
      <video:publication_date>2026-09-02T01:00:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>combat master is so funny XD</video:title>
      <video:description>did you already played this game? comment below #combatmaster #fps #combatmasterseason5 #season5 #cod #callofduty #callodfutymw4 #MW4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396097/3396097_720p.mp4</video:content_loc>
      <video:duration>2446</video:duration>
      <video:publication_date>2026-09-02T01:00:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RBO Stage 15 FINAL</video:title>
      <video:description>Aqui está uma sugestão de descrição estruturada, mantendo a energia nostálgica, o humor de &quot;viúvo de MMO&quot; e todas as informações cruciais do seu roteiro, pronta para você usar no seu vídeo do Stage 15! ### O Clímax da Nostalgia ⚔️ E aí, viúvos de MMO! Chegamos ao **Stage 15 FINAL** de *Ragnarok Battle Offline (RBO)*! Aqui consagramos nossa jornada nesse jogo que, lá nos anos 2000, parecia mais uma lenda urbana contada no intervalo do colégio do que um título real. Prepare-se para acompanhar a conclusão épica deste beat &apos;em up 2D maravilhoso no Steam Deck. ### O Que é Ragnarok Battle Offline? 🎮 Se você caiu de paraquedas neste último estágio, a história da concepção desse jogo é fantástica. Ele começou como uma animação em Flash feita por fãs no Japão e fez tanto sucesso que a Gravity oficializou o projeto. O desenvolvimento ficou nas mãos do estúdio *French Bread* — uma galera que na época fazia jogos *doujin* (indies) por hobby, e que hoje é dona de franquias de luta de peso na Evo, como *Melty Blood* e *Under Night In-Birth*. ### Destaques Deste Jogo Visionário 🌟 Muito antes do gênero se consolidar, o RBO já misturava porradaria com sistemas complexos herdados do MMORPG: * **A Fórmula do Beat &apos;em Up Moderno:** Um jogo à frente do seu tempo que antecipou a mistura de ação com RPG vista em títulos como *Castle Crashers* e *Shredder&apos;s Revenge*. * **Classes e Mecânicas Únicas:** São sete classes (uma desbloqueável) onde até o gênero do personagem muda as skills. Arqueiros gerenciam flechas, magos ficam vulneráveis conjurando e mercadores batem mais forte quanto mais dinheiro acumulam. * **Profundidade de Builds:** Sistema de atributos e árvores de habilidades tão complexos que justificavam o uso de simuladores de build na época para você não deixar o boneco injogável. * *</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396096/3396096_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-09-02T01:00:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Axolote: O Animal Que Nunca Cresce e Regenera Qualquer Parte do Corpo! #Curiosidades #PontoDeVirada</video:title>
      <video:description>O Axolote (Axolotl) é um dos animais mais surpreendentes e misteriosos do planeta. Conhecido como “o animal que nunca cresce”, ele mantém sua aparência juvenil por toda a vida, graças ao fenômeno chamado neotenia. Mas o que mais impressiona é sua habilidade inacreditável de regenerar membros, órgãos e até partes do cérebro, chamando a atenção de cientistas do mundo inteiro. Neste vídeo você vai descobrir: ✨ Por que o Axolote nunca atinge a fase adulta ✨ Como funciona sua regeneração biológica ✨ Onde ele vive e por que está ameaçado ✨ Curiosidades reais e pouco conhecidas ✨ Por que ele pode ser a chave para a medicina do futuro Se você gosta de curiosidades, mundo animal, ciência, biologia e animais incríveis, este vídeo foi feito para você! 🔔 Inscreva-se no canal e acompanhe mais vídeos sobre animais surpreendentes, mistérios da natureza e fatos reais que vão explodir sua mente! #axolote #axolotl #curiosidades #animais #natureza #mundoanimal #cientistas #regeneracao #curiosidadesanimais #documentario #fatoscuriosos #mistériosdanatureza #animaldesconhecido #axoloteaxolotlcuriosidadesanimaisnaturezamundoanimalcientistasregeneracaocuriosidadesanimaisdocumentariofatoscuriososmistériosdanaturezaanimaldesconhecidoanimaisincriveisshortsvocesabiamisteriomundoanimal</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396095/3396095_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-02T01:00:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu não estou sozinho !!! 👍😄🖕</video:title>
      <video:description>Reggae 👍😜🤪🇧🇷</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396094/3396094_720p.mp4</video:content_loc>
      <video:duration>339</video:duration>
      <video:publication_date>2026-09-02T01:00:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amazonite em forma de cinzeiro.</video:title>
      <video:description>A Amazonite é uma pedra verde, por vezes azulada que é encomenda em alguns países como por exemplo no Paquistão. Espero que gostem, obrigado por assistir. #Amazonite #pedra #cinzeiro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396093/3396093_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-02T00:59:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Raciocínio lógico</video:title>
      <video:description>Resolução de questões de Raciocínio Lógico</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396092/3396092_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-09-02T00:59:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Open Class Bodybuilder – Chest Assessment.</video:title>
      <video:description>Open Class Bodybuilder – Chest Assessment.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396091/3396091_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-02T00:59:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A mãe pegou todo o dinheiro dele, mas não esperava por ISSO! 😱💔</video:title>
      <video:description>Ele trabalhou duro por 2 anos para juntar seu dinheirinho, mas a própria família o desvalorizou e tirou tudo o que ele tinha. Sem apoio e com o coração partido, ele decidiu entregar seu caminho nas mãos de Deus... e a resposta veio mais rápido do que esperava! 🙏✨ &quot;Deus nunca desampara quem caminha com honestidade e fé.&quot; #fime #animação #historia #novela #shorts #reels #viral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396090/3396090_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-02T00:59:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CANTE O RITMO / 리듬을 따라 부르세요 / Sing the rhythm</video:title>
      <video:description>Dica de estudo para bateria. Solfejo rítmico. Drum practice tip: Rhythmic solfège. 드럼 학습 팁: 리듬 솔페주. #bateria #배터리 #Drums</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396089/3396089_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:59:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎬Scary Movie</video:title>
      <video:description>Film komedi slasher satir ikonik ini memparodikan berbagai film horor populer akhir 90-an, terutama Scream dan I Know What You Did Last Summer, dengan gaya humor yang berlebihan. Kakak beradik Wayans berperan besar dalam proyek ini, dengan Keenan Ivory Wayans sebagai sutradara. Film ini sukses besar di box office dan menjadi salah satu film parodi paling populer pada masanya. Menariknya, film ini sempat memiliki judul sementara seperti Scream If You Know What I Did Last Halloween sebelum akhirnya menggunakan nama legendaris Scary Movie. Meski mendapat ulasan beragam, film ini menjadi fenomena budaya dan melahirkan franchise besar.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396088/3396088_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T00:58:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O animal que congela e volta à vida?</video:title>
      <video:description>Isso parece coisa de filme, mas acontece na natureza! sim acontece esse fato, maravilhoso. Fica aqui a minha pergunta? você já sabia deixa aqui nos comentários!!! #curiosidades #fatos #entretenimentos #curioso</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396087/3396087_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-02T00:58:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>before leaving your room at night</video:title>
      <video:description>IF YOU ENCOUNTER YOUR GRANDMOTHER LIKE THIS IN THE MIDDLE OF THE NIGHT 😱 RUN! Never wake up past midnight if you hear your grandmother in the kitchen... They say there are three rules that can save your life—and anyone who broke one of them was never seen again. This terrifying story will make you think twice before leaving your room at night #terrormisteriohistoriaforyou</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396086/3396086_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-02T00:58:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Butterfly Tattoo: Meaning and Your First Tattoo!!!</video:title>
      <video:description>Butterfly Tattoo: Meaning and Your First Tattoo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396085/3396085_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T00:58:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It will be - DJ LKS RIT INTERNATIONAL</video:title>
      <video:description>**DJ LKS RIT INTERNATIONAL** é um projeto musical focado em trazer batidas envolventes, ritmo contagiante e produções autorais marcantes no cenário internacional. Com uma sonoridade que combina inovação, energia e identidade única, o trabalho abrange diversas faixas originais, *lyric videos* e lançamentos voltados para animar e surpreender o público em qualquer plataforma ou evento. --- **Contatos para Shows, Parcerias e Licenciamento:** * **E-mail:** djlksrit@gmail.com * **Telefone / WhatsApp:** (47) 93388-1866 #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396084/3396084_720p.mp4</video:content_loc>
      <video:duration>196</video:duration>
      <video:publication_date>2026-09-02T00:58:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo nublado</video:title>
      <video:description>Ceu nublado parecendo q vai chover</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396083/3396083_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T00:58:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396082</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396082/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LIVRO DA VIDA</video:title>
      <video:description>Música gospel Letra é profunda mostra que temos que ter vida com Deus e não viver na superficialidade</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396082/3396082_720p.mp4</video:content_loc>
      <video:duration>314</video:duration>
      <video:publication_date>2026-09-02T00:57:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Swapped to a begger but he is apollo</video:title>
      <video:description>Swapped to a begger but he is apollo #drama #love #story #movie #fyp #trending</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396081/3396081_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-02T00:57:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Scania 🤪</video:title>
      <video:description>Música boa 😜👍</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396080/3396080_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-02T00:57:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LANÇAMENTO DJ LKS RIT INTERNACIONAL - EMPTY OPTION - VERSION 2 #internacional #musicasinternacionais</video:title>
      <video:description>#popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396079/3396079_720p.mp4</video:content_loc>
      <video:duration>204</video:duration>
      <video:publication_date>2026-09-02T00:56:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>bro wtf is happening in valorant mobile 💀</video:title>
      <video:description>#valorant #valorantmobile #china #fps #valorantclips #car #fyp #fypp #febspot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396078/3396078_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-09-02T00:56:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Thiago Mega x Egua comitiva! Thiago Mega x Mare entourage.</video:title>
      <video:description>Thiago Mega x Egua comitiva! Thiago Mega x Mare entourage.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3396077/3396077_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-09-02T00:56:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CLEIDE</video:title>
      <video:description>Música</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396076/3396076_720p.mp4</video:content_loc>
      <video:duration>232</video:duration>
      <video:publication_date>2026-09-02T00:55:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A ATITUDE DESPRESSÍVEL DO GARRO</video:title>
      <video:description>#Neymar #Neymarjr #Santos #Futebol #Brasileirão #Libertadores</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396075/3396075_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T00:55:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não deixa vidro espalhado pelo quintal, faça isso</video:title>
      <video:description>Não deixa vidro espalhado pelo quintal, faça isso #Quardarvidronolugarcerto #vidro #descartarvidro #comodescartarvidrodaformacorreta</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396074/3396074_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T00:54:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Benefícios  da melancia para a saúde</video:title>
      <video:description>Benefícios da melancia para a saúde</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396073/3396073_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:54:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ONDE FICA O PERU KKKKKKKKKK</video:title>
      <video:description>Parodia escolinha. #brasil #humor #engraçado #piada #escolinha</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396072/3396072_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-09-02T00:54:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>zdswe322e</video:title>
      <video:description>bvcfhutr57 #09uppkkhnmm</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396071/3396071_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T00:54:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 furious</video:title>
      <video:description>Rap Americano #Livestyle #internacional #freestyle</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396070/3396070_720p.mp4</video:content_loc>
      <video:duration>271</video:duration>
      <video:publication_date>2026-09-02T00:54:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POBRE DE MIM</video:title>
      <video:description>Vídeo gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396069/3396069_720p.mp4</video:content_loc>
      <video:duration>289</video:duration>
      <video:publication_date>2026-09-02T00:53:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Don&apos;t mess with a billionaire&apos;s daughter—especially when she&apos;s smarter than her dad.</video:title>
      <video:description>Don&apos;t mess with a billionaire&apos;s daughter—especially when she&apos;s smarter than her dad. 🕵️‍♂️👶 ​Billionaire Sonny thought he had life figured out until 5-year-old Lina stormed his engagement party and called him &quot;Daddy.&quot; But Lina isn&apos;t just looking for a father; she&apos;s on a mission to expose a massive conspiracy and break her mother out of prison. With greedy stepfathers and scheming rivals closing in, Sonny realizes he brutally misunderstood the only woman he ever loved. The chase is on, the truth is out, and remorse is a powerful motivator. ​👇 Watch the ultimate story of redemption and family justice now! #drama #viral #fyp #trending #revenge</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396068/3396068_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:53:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>KPop Demon Hunters | 케이팝 데몬 헌터스</video:title>
      <video:description>KPop Demon Hunters | 케이팝 데몬 헌터스 #KPopDemonHunters #Golden #GoldenKPopDemonHunters #KPopDemonHuntersGolden #HUNTRX #KPop #KPop2025 #2025MAMA #MAMAAwards #2025MAMAAwards #KoreanMusic #KPopMusic #KPopAnimation #NetflixKPop #DemonHunters #RumiMiraZoey #KPopGirls #Seoul #SouthKorea #KoreanCulture #케이팝데몬헌터스 #골든 #케이팝 #헌트릭스 #한국음악 #K팝</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396067/3396067_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-02T00:53:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reflexões diárias</video:title>
      <video:description>Palavras da biblia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396066/3396066_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-02T00:52:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He didn&apos;t want small snacks, he just wanted the whole watermelon! 🍉🦛&quot;</video:title>
      <video:description>Watch this cute hippo ignore tiny grapes and raspberries until he finally gets what he really wanted all along: a whole watermelon! 🍉🦛&quot; #watermelon #animalfeeding #cuteanimals #funnyanimals #trending</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396065/3396065_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T00:52:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>God of War - The End Begins - Guitar and UCS Orchestra - Gerard Marino</video:title>
      <video:description>Orchestral and electric arrangement by Gerard Marino for the iconic opening track of God of War , uniting the power of the guitar with the grandeur of an epic orchestra. #GodOfWarTheEndBeginsGerardMarinoSoundtrackOrchestraGuitar</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396064/3396064_720p.mp4</video:content_loc>
      <video:duration>281</video:duration>
      <video:publication_date>2026-09-02T00:52:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💅🌎 **전 세계의 아름다운 네일 총집합!** ✨ 2</video:title>
      <video:description>💅🌎 **전 세계의 아름다운 네일 총집합!** ✨ 각국의 가장 아름답고 창의적이며 스타일리시한 네일 디자인을 만나보세요! 💖🌍 네일 아트, 화려한 장식, 완벽한 매니큐어, 트렌디한 디자인 등 다음 네일 스타일에 영감을 줄 다양한 스타일이 준비되어 있습니다. 💅🎨 ✨ 과연 어느 나라의 네일이 가장 아름다울까요? 🌎 끝까지 시청하고 여러분의 원픽을 골라보세요! ❤️ **채널 구독과 좋아요, 그리고 아름다운 네일을 사랑하는 친구들에게 공유**하는 것도 잊지 마세요! #네일 #네일아트 #네일장식 #네일디자인 #예쁜네일 #네일영감 #세계의네일 #완벽한네일 #네일네일아트네일장식네일디자인예쁜네일네일영감세계의네일완벽한네일</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396063/3396063_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-02T00:52:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Máquina de cortar grama</video:title>
      <video:description>Alguém cortando grama e ouvindo música.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396061/3396061_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T00:51:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mengapa sekarang sering dijumpai pagar betis tiduran? 👀</video:title>
      <video:description>Mengapa ada pemain yang rela tiduran untuk membuat pagar betis? Dulu kita tak pernah menjumpai pemain tiduran untuk menghalau tendangan bebas lawan. Tapi berkat penyalamatan Brozovic, trend tiduran untuk membuat pagar betis menjadi populer. Pada umumnya, penendang biasa mengarahkan bola melewati atas atau samping pagar betis. Selain 2 arah itu, mengarahkan bola melewati bawah pagar betis kini menjadi umum dilakukan. Nahh guna mengantisipasinya, pagar betis dengan tiduran ini terbukti efektif untuk menambal teman di depannya yang terlanjur melompat.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396060/3396060_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-02T00:51:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O YAMAL SUPEROU O MESSI</video:title>
      <video:description>#Lamineyamal #Yamal #Messi #Haaland #Mbappé #Futebol #Barcelona #Laliga</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396059/3396059_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-02T00:51:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Look up &quot;Looking for Mr. Daddy&quot;</video:title>
      <video:description>🔍 Look up &quot;Looking for Mr. Daddy&quot;, to enjoy full exciting episode✨! Six years ago, Olivia Hart, daughter of a federal judge, got pregnant unexpectedly on a fateful night at law school. Her furious father kicked her out of the house, and her ex-boyfriend denied everything. Olivia gave birth to twins Lily and Lucas alone, honed her pastry skills in a small town, and became a top pastry chef. Six years later, the winery group of billionaire Dominic Sterling invited her to serve as the head pastry chef of their flagship restaurant. When Dominic&apos;s assistant notices that little Lucas is the spitting image of his boss, a fateful entanglement spanning six years is reignited. A contract marriage, a possessive overbearing CEO, two cute kids desperate to find their father, a jealous stepsister, and the earth-shattering secret that her mother is still alive, all push Olivia into the center of a wealthy family storm. #aistory #fyp #drama #shortfilm #Romance #lovestory❤️ #contractmarriage #billionaire #comeback #baby</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396058/3396058_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-02T00:51:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nem eu acreditei nesse clutch #Valorant #valorantclips #clutch #1x4 #feminino</video:title>
      <video:description>#Valorant</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3396057/3396057_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-02T00:50:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2se4fcze</video:title>
      <video:description>tfvbuy67uhb #ojmllp98i</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396056/3396056_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-02T00:49:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joga muito !!!</video:title>
      <video:description>E linda 😁</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396055/3396055_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:49:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mais uma</video:title>
      <video:description>mais uma tentativa que deu errado</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396054/3396054_720p.mp4</video:content_loc>
      <video:duration>194</video:duration>
      <video:publication_date>2026-09-02T00:49:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rap 50 cent</video:title>
      <video:description>Vib Life style #Euar #hiphop #cultura #musicrapper</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396053/3396053_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-09-02T00:49:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Monster high Clawdeen Wolf 🫏.</video:title>
      <video:description>Neste vídeo mostro a boneca Clawdeen Wolf da colecção Monster Bill da Mattel. Obrigado por assistir 😊. #Bonecas #MonsterHigh #Clawdeen</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396052/3396052_720p.mp4</video:content_loc>
      <video:duration>107</video:duration>
      <video:publication_date>2026-09-02T00:49:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Detetive particular</video:title>
      <video:description>Fui o obrigado a adotar novo comportamento profissional devido a concorrência. #Detetiveparticular #assessoria #investigador</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396051/3396051_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-02T00:49:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 I SURVIVED THE HARDEST MOUNTAIN PARKOUR IN ROBLOX! 😱</video:title>
      <video:description>I SURVIVED THE HARDEST MOUNTAIN PARKOUR IN ROBLOX! 😱🏔️ Today we&apos;re taking on an insane Roblox Mountain Parkour Obby! Can I make it to the top without falling? Watch until the end to see if I can conquer this challenging parkour course! 🔥 Extreme jumps 🏔️ Dangerous mountain obstacles 😱 Epic fails and close calls 🎮 Roblox parkour gameplay If you enjoy Roblox Obby, Parkour and challenging gameplay, LIKE 👍, SUBSCRIBE 🔔 and join the adventure! 🔥 Hashtags #roblox #robloxobby #robloxparkour #robloxmountainparkour #mountainobby #robloxmountainobby #robloxgameplay #robloxgameplayenglish #robloxparkourgameplay #robloxobbygameplay #hardrobloxobby #hardestrobloxobby #impossibleobby #robloxchallenge #parkourroblox #parkourobby #robloxgames #robloxgaming #robloxfunny #robloxfails #robloxdifficultobby #mountainparkour #extremeparkour #robloxadventure #gaming #obbygameplay</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396050/3396050_720p.mp4</video:content_loc>
      <video:duration>864</video:duration>
      <video:publication_date>2026-09-02T00:48:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>makanan indonesia</video:title>
      <video:description>sinonggi makanan khas kendari sulawesi tenggara #food</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396049/3396049_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:48:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia d piscina</video:title>
      <video:description>Dia de piscina em casa... #coroasfazenda</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396048/3396048_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:48:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💅🌎 **전 세계의 아름다운 네일 총집합!** ✨</video:title>
      <video:description>💅🌎 **전 세계의 아름다운 네일 총집합!** ✨ 각국의 가장 아름답고 창의적이며 스타일리시한 네일 디자인을 만나보세요! 💖🌍 네일 아트, 화려한 장식, 완벽한 매니큐어, 트렌디한 디자인 등 다음 네일 스타일에 영감을 줄 다양한 스타일이 준비되어 있습니다. 💅🎨 ✨ 과연 어느 나라의 네일이 가장 아름다울까요? 🌎 끝까지 시청하고 여러분의 원픽을 골라보세요! ❤️ **채널 구독과 좋아요, 그리고 아름다운 네일을 사랑하는 친구들에게 공유**하는 것도 잊지 마세요! #네일 #네일아트 #네일장식 #네일디자인 #예쁜네일 #네일영감 #세계의네일 #완벽한네일 #네일네일아트네일장식네일디자인예쁜네일네일영감세계의네일완벽한네일</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396047/3396047_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T00:48:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O YAMAL DEIXOU O RODRI MALUCO</video:title>
      <video:description>#LamineYamal #Yamal #Barcelona #Rodri #Futebol #Laliga</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396046/3396046_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-02T00:48:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fogos</video:title>
      <video:description>#Fogos #foguete</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396045/3396045_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-02T00:47:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>João Ricardo vieira x Touro Starlink! João Ricardo Vieira vs. Starlink (Bull)</video:title>
      <video:description>João Ricardo vieira x Touro Starlink! João Ricardo Vieira vs. Starlink (Bull)</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396044/3396044_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T00:47:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>After the Lights – Relax &amp; Chill Deep House Playlist #2</video:title>
      <video:description>After the Lights – Relax &amp; Chill Deep House Playlist #2 is a smooth and atmospheric deep house collection designed for calm nights, relaxation, and peaceful moments. This playlist blends relaxing deep house, chill house, and melodic electronic music, featuring warm basslines, soft rhythms, and dreamy textures that help you unwind, focus, and breathe. Perfect for late-night listening, studying, working, night drives, meditation, stress relief, or background music, Night Flow creates a deep and emotional soundscape where you can disconnect and let the music guide you. If you enjoy relaxing deep house, chill electronic music, lounge vibes, downtempo house, and mellow club sounds, this playlist was made for you. #deephouse #chilldeephouse #relaxingdeephouse #deephouseplaylist #chillhouse #relaxingmusic #chillmusic #electronicmusic #deephousemix #melodicdeephouse #loungehouse #calmmusic #studymusic #backgroundmusic #nightvibes #latenightmusic #sleepmusic #focusmusic #atmospherichouse #chillelectronicmusic #deephouse2025 #worlddeephouse #waves #boundless #mixdeephouse #workmusic #chillout #goodvibes #calmworkmusic #chilloutmusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396043/3396043_720p.mp4</video:content_loc>
      <video:duration>2882</video:duration>
      <video:publication_date>2026-09-02T00:47:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUSIC!! One of the girls x Good for you</video:title>
      <video:description>#music #viral #remix</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396042/3396042_720p.mp4</video:content_loc>
      <video:duration>245</video:duration>
      <video:publication_date>2026-09-02T00:47:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Unexpected | Problem</video:title>
      <video:description>Unexpected | Problem #drama #romance</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396041/3396041_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-09-02T00:47:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LONDRINA X JUVENTUDE CHAMPIONSHIP BRAZILIAN 25° ROTATE SERIE B WATCH IN LIVE TODAY</video:title>
      <video:description>#premiereleaguesoccerfootbal</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396040/3396040_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-02T00:46:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bate papo 2 Universo dos Fãs</video:title>
      <video:description>Conversa boa #UniversodosFãséshow</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396039/3396039_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:46:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Porteiro eletrônico com câmera e monitor</video:title>
      <video:description>🔔📹 PORTEIRO ELETRÔNICO COM CÂMERA E MONITOR Saiba quem está na sua porta antes de abrir! 🏠👀 Esse porteiro eletrônico possui câmera externa, monitor interno com tela e campainha, permitindo visualizar quem está chegando de forma prática e confortável. ✨ Ideal para: ✅ Casas ✅ Apartamentos ✅ Escritórios ✅ Mais praticidade no dia a dia ✅ Visualização dos visitantes pelo monitor 🔥 De R$ 189,40 por apenas R$ 178,13! 🛒 COMPRE AQUI NA SHOPEE: 👉 https://s.shopee.com.br/W6IBFePr3⁠� 💬 Você usaria um porteiro com câmera assim na sua casa? #Achadosincríveisshopee</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396038/3396038_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:46:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUSIC!! The hills x Church</video:title>
      <video:description>#music #remix #viral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396037/3396037_720p.mp4</video:content_loc>
      <video:duration>252</video:duration>
      <video:publication_date>2026-09-02T00:46:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ONCE AGAIN - DJ LKS RIT INTERNATIONAL</video:title>
      <video:description>#popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396036/3396036_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-02T00:46:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>perfeito</video:title>
      <video:description>um erro que deu certo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396035/3396035_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T00:46:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arti mimpi bermain hujan</video:title>
      <video:description>Menari di bawah hujan dalam mimpi melambangkan datangnya kesegaran, kedamaian hati, dan kebahagiaan baru dalam hidupmu. 🌧️✨</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396034/3396034_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:46:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A mulher mais alta do Brasil!!!</video:title>
      <video:description>E grande!!! 😄</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396033/3396033_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:45:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUSIC!! Chicago Michael Jackson</video:title>
      <video:description>#michaeljackson #music #viral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396032/3396032_720p.mp4</video:content_loc>
      <video:duration>247</video:duration>
      <video:publication_date>2026-09-02T00:45:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FERRARI WITH EXTREMELY LOUD F1 EXHAUST - INSANE REACTIONS | FERRARI CON ESCAPE F1 EXTREMADAMENTE RUI</video:title>
      <video:description>FERRARI WITH EXTREMELY LOUD F1 EXHAUST - INSANE REACTIONS | FERRARI CON ESCAPE F1 EXTREMADAMENTE RUIDOSO - REACCIONES ALUCINANTES | INDIA #FERRARIWITHEXTREMELYLOUDF1EXHAUST-INSANEREACTIONSFERRARICONESCAPEF1EXTREMADAMENTERUIDOSO-REACCIONESALUCINANTESINDIA</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396031/3396031_720p.mp4</video:content_loc>
      <video:duration>274</video:duration>
      <video:publication_date>2026-09-02T00:45:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wife Catches Her Husband Having Breakfast With Another Girl In A Luxury Hotel 💔🔥</video:title>
      <video:description>Wife Catches Her Husband Having Breakfast With Another Girl In A Luxury Hotel 💔🔥 #RelationshipDrama #BrokenTrust #CoupleStory #EmotionalScene</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396030/3396030_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T00:45:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nomor berapa favorit kalian?</video:title>
      <video:description>Nomor berapa favorit kalian? © Semua gambar adalah milik pemiliknya masing-masing‼️ 🚫NO COPYRIGHT🚫 LiveStreaming ? 📍Link cek di bio #sepakbola</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396029/3396029_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-02T00:45:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eternal Night | Eurodance RITs Vol.4 | Retro 80’s &amp; 90’s Mix | Neon Dreams &amp; Timeless Beats</video:title>
      <video:description>Step into the neon glow of Eternal Night Music. This Eurodance RITs Vol.4 mix brings you the timeless energy of the 80’s and 90’s — where rhythm, passion, and nostalgia collide. Immerse yourself in a world of lilac lights, analog synths, and endless nightfall. Every track in this mix was created with AI-composed vocals and retro instruments, capturing the golden age of dance in a futuristic form. 🎶 Vibe: Retro Eurodance / 80’s 90’s Revival / Neon Club Energy 💿 Duration: 1 Hour of Timeless Beats 🎧 Best for: Night driving, club ambiance, nostalgia moments, or creative focus. Turn the lights down, put on your headphones, and let the rhythm guide you through eternity. 🔥 Subscribe for more retro-futuristic mixes every week! #moderntalkingstyle #80sdiscomusic #new80smusic #moderntalkingtypebeat #eurodiscorevival #retropop2025 #synthpop80sstyle #moderntalkingsound #80smusiccomeback #neweurodiscosong #80svibesmusic #germandisco80s #backtothe80s #retromusicyoutube #falsettopopsongs #eurodance80s #newmoderntalkingsong #moderntalkingtribute #discorevival2025 #modern80ssynthpop</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396028/3396028_720p.mp4</video:content_loc>
      <video:duration>3900</video:duration>
      <video:publication_date>2026-09-02T00:45:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BlackBeatRoots#EP01 ♫ The POWER of HIP HOP at its BEST!</video:title>
      <video:description>BlackBeatRoots: Immerse yourself in an infinite sound universe, created by artificial intelligence. Our channel offers you a vast library of original beats from Hip Hop, Trap, BoomBap, Drill, Jazz, Soul, Blues, Funk, R&amp;B, Neo Soul and Lounge Music. BlackBeatRoots on YouTube =&gt; https://www.youtube.com/@BlackBeatRoots4YT Song credits in this video: » BlackBeatRoots#1 Contact/Link: Free to use copyright-free content » BlackBeatRoots#2 Contact/Link: Free to use copyright-free content » BlackBeatRoots#3 Contact/Link: Free to use copyright-free content » BlackBeatRoots#4 Contact/Link: Free to use copyright-free content » BlackBeatRoots#5 Contact/Link: Free to use copyright-free content » BlackBeatRoots#6 Contact/Link: Free to use copyright-free content Highlights: Diversity of styles: We cover a wide range of musical genres in the hip hop field, ensuring that there is something for everyone. Beat quality: We emphasize the high quality of AI-generated musical productions. Ease of use: We reinforce that the songs are copyright-free, making it easy to use in various projects. Versatility: We present our channel as a source of inspiration for different types of content creators. BlackBeatRoots: Your endless source of original beats! Our channel offers you a vast library of Hip Hop, Trap, Drill and more instrumentals, all created by artificial intelligence. Perfect for producers, DJs and anyone looking for unique sounds for their projects. Copyright free! FREE! Explore, create and get inspired by the quality and diversity of our beats. Ideal for relaxing, creating and editing your videos. Subscribe and activate the bell so you don&apos;t miss any news! #hiphopinstrumental #trapbeats #musicproduction #freebeats #HipHop #Trap #BoomBap #Drill #Jazz #Soul #Blues #FunkSoul #RhythmAndBlues #</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396027/3396027_720p.mp4</video:content_loc>
      <video:duration>1058</video:duration>
      <video:publication_date>2026-09-02T00:45:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PodCast Universo dos Fãs bate papo 1</video:title>
      <video:description>Papo legal #Batepapo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396026/3396026_720p.mp4</video:content_loc>
      <video:duration>198</video:duration>
      <video:publication_date>2026-09-02T00:44:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MUSIC!! The hills x Die for you</video:title>
      <video:description>#music #viral #thewekend #remix</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396025/3396025_720p.mp4</video:content_loc>
      <video:duration>242</video:duration>
      <video:publication_date>2026-09-02T00:44:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>curiga</video:title>
      <video:description>momen sang jantan kucing curiga pada induk kucing kenapa ada anak kucing yg berbeda warnanya dengan dirinya yg oranye #anabul</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396024/3396024_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:44:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396023</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396023/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>wswqe43</video:title>
      <video:description>vftyjbcy6 #okll08jn</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396023/3396023_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:44:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BRAZILIAN TRAP | &apos;VAMP&apos; | ROCK MARTIN (ROCK MARTAN) | TRAP MUSIC</video:title>
      <video:description>Original song performed by Rock Martin (Rock Martan) Provided by MARCOS ALBERTO SILVA MARTINS =============================================================================== Find your preferred platform to listen to Rock Martin&apos;s songs 👇🏽👇🏽👇🏽 Just click the link below: https://linktr.ee/RockMartin =============================================================================== 📱 Follow Rock Martin on social media: Facebook: https://www.facebook.com/RockMartinOficial X (Twitter): https://x.com/RockMartinReal Instagram: https://www.instagram.com/rockmartinmusico/ =============================================================================== #TRAP #TRAPMUSIC #POPMUSIC #POP #MUSIC #ROCKMARTIN #ROCKMARTAN</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396021/3396021_720p.mp4</video:content_loc>
      <video:duration>197</video:duration>
      <video:publication_date>2026-09-02T00:44:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>✨ **세상에서 가장 멋진 네일 디자인!** 🌎💖</video:title>
      <video:description>💅✨ **세상에서 가장 멋진 네일 디자인!** 🌎💖 놀라운 네일 디자인, 완벽한 매니큐어, 창의적인 네일 아트, 그리고 전 세계를 사로잡은 최신 트렌드를 만나보세요! 💅🎨 아름답고 우아하며 세련된 네일 아이디어가 가득합니다. 분명 마음에 쏙 드실 거예요! 😍✨ 💕 **채널을 구독**하고 새로운 네일 및 네일 아트 영상을 놓치지 마세요! 👍 &apos;좋아요&apos;를 누르고 공유해 주신 뒤, 댓글로 알려주세요: **어떤 네일 디자인이 가장 마음에 드시나요?** #네일아트 #네일디자인 #네일페인팅 #예쁜네일 #매니큐어 #네일스타일 #완벽한네일 #네일아트아이디어 #네일네일아트네일디자인예쁜네일네일영감아름다운네일완벽한네일</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396020/3396020_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T00:43:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O gato despejou tinta na boca deste homem 🤣🤣🤣</video:title>
      <video:description>O gato despejou tinta na boca deste homem #Ogatodespejoutintanabocadestehomem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396019/3396019_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T00:43:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Veja como manusear</video:title>
      <video:description>#Selagembisnag</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396018/3396018_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-02T00:43:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Louvor a Deus</video:title>
      <video:description>Louvor a Deus</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396017/3396017_720p.mp4</video:content_loc>
      <video:duration>82</video:duration>
      <video:publication_date>2026-09-02T00:43:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sandro Santos locução comercial</video:title>
      <video:description>Sandro Santos locução de loja #Locução</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396016/3396016_720p.mp4</video:content_loc>
      <video:duration>129</video:duration>
      <video:publication_date>2026-09-02T00:42:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396015</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396015/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>C.O.N.C.O.R.D.I.A. — Cinturão de Bellum | Abertura Oficial</video:title>
      <video:description>Conheça C.O.N.C.O.R.D.I.A. — Cinturão de Bellum, uma produção original de anime seinen e ficção científica. Em um futuro marcado por conflitos entre civilizações, a Coalizão das Nações Cósmicas Organizadas para Relações, Defesa e Integração Astral enfrenta ameaças além das fronteiras conhecidas. A bordo do mega-cruzador INVICTA, sua tripulação inicia uma jornada pelo Cinturão de Bellum. Esta é a abertura oficial da série. Título internacional: C.O.N.C.O.R.D.I.A. — Bellum Belt Gêneros: anime, ficção científica, ação, drama militar e aventura espacial. Criação e produção: Paulo Ricardo Inscreva-se no canal para acompanhar os próximos trailers, personagens e episódios. #CONCORDIA #CinturãodeBellum #Concordiaanime #animebrasileiro #animeoriginal #animeseinen #ficçãocientífica #ficçãocientíficaespacial #spaceopera #animaçãobrasileira #sérieanimada #aberturadeanime #trailerdeanime #naveespacial #INVICTA #guerraespacial #aventuraespacial #sci-fianime #Braziliananime #originalanimation</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396015/3396015_720p.mp4</video:content_loc>
      <video:duration>131</video:duration>
      <video:publication_date>2026-09-02T00:42:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Muito lindo 2</video:title>
      <video:description>Fofo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396014/3396014_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:42:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>They Just Join😂</video:title>
      <video:description>Visualizer #Trend</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396013/3396013_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T00:42:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES - MEGALODON O SUPER PREDADOR DOS OCEANOS NOME CIENTÍFICO  ( Otodus megalodon.)</video:title>
      <video:description>REINO DOS TUBARÕES - MEGALODON O SUPER PREDADOR DOS OCEANOS NOME CIENTÍFICO ( Otodus megalodon.) Deixe seu comentário sobre o que achou sobre esse DOCUMENTÁRIO. Megalodon: O Tubarão Gigante que Dominou os Oceanos da Pré-História Imagine um predador tão gigantesco que poderia engolir um carro pequeno com apenas uma mordida. Um animal tão poderoso que dominou os oceanos por milhões de anos… muito antes do ser humano sequer existir. Um tubarão colossal, capaz de assustar qualquer criatura marinha. Uma verdadeira lenda da pré-história. Seu nome ecoa nas profundezas da história dos oceanos. Megalodon. O maior tubarão que já viveu no planeta Terra. A Origem do Nome O Megalodon é conhecido cientificamente como Otodus megalodon. O nome significa literalmente: “dente gigante”. E não é por acaso. Os primeiros fósseis descobertos desse animal foram justamente seus enormes dentes fossilizados. Durante séculos, as pessoas encontravam esses dentes gigantes e acreditavam que eles pertenciam a dragões ou serpentes marinhas. Somente mais tarde os cientistas entenderam que aqueles fósseis pertenciam a um tubarão gigantesco que viveu milhões de anos atrás. Os dentes do Megalodon são impressionantes. Eles podem ultrapassar 18 centímetros de comprimento, maiores do que a mão de um adulto. Além do tamanho, esses dentes possuem bordas serrilhadas extremamente afiadas, perfeitas para cortar carne e ossos. E o mais incrível: Um único Megalodon poderia possuir mais de 270 dentes em sua boca ao mesmo tempo, organizados em várias fileiras. Assim como outros tubarões, ele também perdia dentes constantemente ao longo da vida. Estima-se que um Megalodon poderia perder milhares de dentes durante sua existência, o que explica por que esses fósseis são encontrados em tantos lugares. Quando o Megalodon V</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396012/3396012_720p.mp4</video:content_loc>
      <video:duration>617</video:duration>
      <video:publication_date>2026-09-02T00:42:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Novela anjo mau 6</video:title>
      <video:description>Paula confrontar a empregada</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396011/3396011_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-02T00:42:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sssrssssrsskkkkkkkkkkkkkkkkkkkkk</video:title>
      <video:description>kkkkkkkkkkkkkkkkkkkkkkkk #kkkkkkkkkkkkkkkkkkkk</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396010/3396010_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:41:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saco plástico</video:title>
      <video:description>Maquina de fabricação de saco plástico veja a velocidade. #Sacoplástico</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396009/3396009_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-02T00:40:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>China 12</video:title>
      <video:description>Saiba de tudo sobre meu dia a dia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396008/3396008_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-02T00:40:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sturm der Liebe 02.09.2026</video:title>
      <video:description>Sturm der Liebe #SturmderLiebe</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396006/3396006_720p.mp4</video:content_loc>
      <video:duration>2919</video:duration>
      <video:publication_date>2026-09-02T00:40:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>#charme e beleza elegante # 5</video:title>
      <video:description>#charme e beleza elegante # #charmeebelezaelegante</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396005/3396005_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-02T00:40:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>nomor berapa yang jadi favorit kalian</video:title>
      <video:description>Nomor berapa favorit kalian? © Semua gambar adalah milik pemiliknya masing-masing‼️ 🚫NO COPYRIGHT🚫 LiveStreaming ? 📍Link cek di bio #fakta</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396004/3396004_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-02T00:40:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Se há vida, é assim 🤣🤣🤣</video:title>
      <video:description>Se há vida, é assim 🤣🤣🤣 #Sehávida #éassim🤣🤣🤣funnyvideoshorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396003/3396003_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T00:40:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_100.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_100.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396002/3396002_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:39:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Limpeza profunda de um jeito muito mais prático.</video:title>
      <video:description>🧼✨ SOFÁ SUJO? ESTOFADO MANCHADO? OLHA ESSA SOLUÇÃO! 😍 🚨 LIMPEZA PROFUNDA DE UM JEITO MUITO MAIS PRÁTICO! 🚨 A Extratora Philco é uma ótima aliada para cuidar da limpeza de sofás, colchões, bancos e outros estofados. 🛋️✨ 💦 Ajuda a remover sujeiras e resíduos 🧽 Ideal para limpeza de estofados 🏠 Prática para usar em casa ✨ Deixa a limpeza muito mais eficiente 📦 Compacta e fácil de transportar 💥 Seu sofá merece aquele cuidado especial! 🛒 Confira o preço e todos os detalhes 👉 https://s.shopee.com.br/3qMe2DXo74 💬 Você teria uma extratora dessas em casa? #Extratora #limpeza #estofados #carpetes</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396001/3396001_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:39:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3396000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3396000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_99.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_99.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3396000/3396000_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:39:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pintura de parede</video:title>
      <video:description>Fazendo pintura com textura cristal</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395999/3395999_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-02T00:39:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_98.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_98.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395998/3395998_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:38:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cidade linda</video:title>
      <video:description>#Europa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395997/3395997_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T00:38:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_97.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_97.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395996/3395996_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:38:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>grubcdw</video:title>
      <video:description>o0pkju8 #sw24dsw2</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395995/3395995_720p.mp4</video:content_loc>
      <video:duration>287</video:duration>
      <video:publication_date>2026-09-02T00:38:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_96.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_96.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395994/3395994_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:38:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_95.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_95.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395993/3395993_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:38:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_94.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_94.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395992/3395992_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:37:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I want coffee, or else I&apos;m going to die!</video:title>
      <video:description>I want coffee, or else I&apos;m going to die! #memes #viralvideo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395991/3395991_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:37:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eles sentem a sua falta</video:title>
      <video:description>Eles sentem a sua falta #Cachorro #animaldeestimação #animaldoméstico #animal</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395990/3395990_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T00:37:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gospel 10</video:title>
      <video:description>Amor de pai #Musicaevangélica #gospel #Deus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395989/3395989_720p.mp4</video:content_loc>
      <video:duration>237</video:duration>
      <video:publication_date>2026-09-02T00:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FLAMENGO X MIRASSOL AO VIVO COM IMAGENS - BRASILEIRÃO 2026 - JOGO DE HOJE</video:title>
      <video:description>📺🔥 FLAMENGO X MIRASSOL AO VIVO COM IMAGENS | BRASILEIRÃO 2026 | JOGO DE HOJE | PES 2021 Prepare-se para mais um grande confronto do Brasileirão 2026! 🔴⚫⚽ Neste vídeo você acompanha a simulação de Flamengo x Mirassol no PES 2021, com gameplay emocionante, jogadas incríveis, gols e toda a emoção de uma partida do futebol brasileiro. 🏆 Flamengo x Mirassol: quem vai levar a melhor neste duelo? Acompanhe a partida até o final, confira o resultado da simulação e deixe nos comentários o seu palpite! 🎮 No canal Amigos do PES 2021 você encontra simulações realistas dos principais jogos do futebol brasileiro e mundial, incluindo Brasileirão, Libertadores, Copa do Brasil, clássicos e muito mais. ⚠️ IMPORTANTE: este vídeo é uma simulação virtual realizada no PES 2021, criada exclusivamente para entretenimento. Não é uma transmissão oficial e não utiliza imagens reais da partida. 👍 DEIXE SEU LIKE, INSCREVA-SE NO CANAL E ATIVE O 🔔 para acompanhar os próximos jogos! 🔥 5 HASHTAGS #Flamengo #Mirassol #Brasileirão2026 #PES2021 #GameplayRealista #FUTINFINITYDANAÇÃO Flamengo x Mirassol, Flamengo x Mirassol ao vivo, Flamengo ao vivo, Mirassol ao vivo, Flamengo x Mirassol 2026, Flamengo x Mirassol hoje, Brasileirão 2026, Brasileirão Série A, Campeonato Brasileiro 2026, jogo do Flamengo hoje, jogo do Mirassol hoje, Flamengo PES 2021, Mirassol PES 2021, PES 2021, PES 2021 gameplay, gameplay realista, eFootball PES 2021, simulação realista, futebol virtual, assistir Flamengo x Mirassol, futebol ao vivo, placar em tempo real, transmissão simulada, jogo de hoje, Amigos do PES 2021 #FlamengoxMirassol #FlamengoxMirassolaovivo #Flamengoaovivo #Mirassolaovivo #FlamengoxMirassol2026 #FlamengoxMirassolhoje #Brasileirão2026 #BrasileirãoSérieA #CampeonatoBrasileiro2026 #jogodoFlamengohoje #jogodoMirassol</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395988/3395988_720p.mp4</video:content_loc>
      <video:duration>751</video:duration>
      <video:publication_date>2026-09-02T00:35:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WHERE HOPE BEGINS | ROCK MARTIN (ROCK MARTAN) | MUSIC VIDEO</video:title>
      <video:description>Original song performed by Rock Martin (Rock Martan) Provided by MARCOS ALBERTO SILVA MARTINS =============================================================================== Find your preferred platform to listen to Rock Martin&apos;s songs 👇🏽👇🏽👇🏽 Just click the link below: https://linktr.ee/RockMartin =============================================================================== 📱 Follow Rock Martin on social media: Facebook: https://www.facebook.com/RockMartinOficial X (Twitter): https://x.com/RockMartinReal Instagram: https://www.instagram.com/rockmartinmusico/ =============================================================================== #POPMUSIC #ROCKMARTAN #ROCKMARTIN #MUSIC #POP #INDIE</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395987/3395987_720p.mp4</video:content_loc>
      <video:duration>310</video:duration>
      <video:publication_date>2026-09-02T00:35:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Barbie.</video:title>
      <video:description>Barbie Peekaboo. Da minha colecção, mais uma das minhas fofinhas.Espero que gostem, obrigado por assistir. #Barbie #dolls</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395986/3395986_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T00:34:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Informações aos nomeados</video:title>
      <video:description>Direito a indenização proporcional na esfera municipal, estadual e federal! #Direito #detetive #participação #nomeação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395985/3395985_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-02T00:34:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_93.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_93.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395984/3395984_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:34:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395983</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395983/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_92.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_92.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395983/3395983_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:33:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_91.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_91.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395982/3395982_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:33:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Solo esa palabra falta en tu vida</video:title>
      <video:description>#Life40mas #Mujeres40mas #Decretos #Manifestación #creeenti</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395981/3395981_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T00:33:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BALEIA AZUL O GIGANTE REAL MAIS COLOSSAL DOS OCEANOS ELA É MAIOR QUE OS DINOSSAUROS</video:title>
      <video:description>DOCUMENTÁRIO: BALEIA AZUL O GIGANTE REAL MAIS COLOSSAL DOS OCEANOS ELA É MAIOR QUE OS DINOSSAUROS #BaleiaAzul #VidaMarinha #Documentário #Oceanos #Natureza #AnimaisGigantes #DeepSea #Wildlife #PlanetaTerra #Mar Prepare-se para conhecer a criatura mais impressionante que já existiu no planeta… Neste documentário completo, você vai mergulhar nas profundezas do oceano para descobrir a incrível história da baleia-azul — o maior animal que já viveu na Terra, superando até mesmo os dinossauros. Com imagens impactantes e uma narrativa envolvente, revelamos todos os segredos desse verdadeiro gigante dos mares: 🌊 Como ela vive 🍽️ O que ela come 📏 Seu tamanho impressionante 🧬 Suas características únicas ⚠️ Os perigos que ameaçam sua sobrevivência Você vai entender por que a baleia-azul não é apenas um animal gigantesco… mas uma peça fundamental para o equilíbrio do nosso planeta. Mas em um mundo em constante mudança… será que esse gigante ainda conseguirá sobreviver? ✔️ Descubra fatos surpreendentes que poucos conhecem ✔️ Entenda o papel da baleia-azul no oceano ✔️ Explore um dos maiores mistérios da vida marinha ✔️ Viva uma experiência cinematográfica imersiva Se você ama o oceano e quer descobrir criaturas incríveis como essa… 👉 Inscreva-se no canal 👉 Deixe seu like 👍 👉 Ative o sino 🔔 E prepare-se… porque os próximos documentários vão revelar criaturas ainda mais impressionantes. #baleiaazul #bluewhale #balaenopteramusculus #maioranimaldomundo #maioranimaldaterra #documentáriobaleiaazul #vidamarinha #animaisgigantes #oceanoprofundo #criaturasdooceano #documentárionatureza #animaismarinhos #baleiaazuldocumentáriocompleto #curiosidadesbaleiaazul #oceanos #vidamarinhaextrema #animaisgigantesdooceano #naturezaselvagem #mundoanimal #deepsea #wildlifedocumentary</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395980/3395980_720p.mp4</video:content_loc>
      <video:duration>519</video:duration>
      <video:publication_date>2026-09-02T00:33:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ip Man - Nasce uma Lenda - Kung Fu -</video:title>
      <video:description>Ip Man - Nasce uma Lenda - Kung Fu - #ipman #kungfu #donnieyen #martialarts #ipmanmovie #chinesefilm #wingchun #kungfulegend #actionmovie #kungfufight #kungfucinema #martialartsfilm #fightingmovies #ipmanseries #kungfuhistory #shaolin #kungfumaster #karatê #kungfufilme #kungfudublado #kungf #kungfuy #karat #filmo #dublad</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395979/3395979_720p.mp4</video:content_loc>
      <video:duration>5982</video:duration>
      <video:publication_date>2026-09-02T00:33:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Spider Island 2026 | Full Movie | HD</video:title>
      <video:description>Spider Island 2026 Horror/Comedy Some of the world&apos;s hottest influencers head to a secluded tropical island to party at a luxurious new hotel. But they soon find themselves fighting for their lives against a horde of deadly spiders trying to take over the exotic resort. Initial release August 28, 2026 Director Christopher Smith Producers Ben Jacques, Allan Niblo, James Richardson, Michael Knowles, Jeremy Nathan Executive producer Jane Moore Production companies Vertigo Films, Now Films, Fiction Films Screenplay David Quantick #SpiderIsland2026 #FullMovie #HD</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395978/3395978_720p.mp4</video:content_loc>
      <video:duration>5738</video:duration>
      <video:publication_date>2026-09-02T00:32:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_90.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_90.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395977/3395977_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:32:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_89.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_89.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395976/3395976_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:32:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Atlético Mineiro e Cruzeiron</video:title>
      <video:description>Jogo Decisivo da Copa do Brasil #copadobrasilfutebolcruzeiroAtléticomineiro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395975/3395975_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:31:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como as ruas ficam mais alegres e nos alegram.</video:title>
      <video:description>A arte urbana que se pode admirar em muitos países, além de as ruas ficarem mais bonitas, também têm o poder de alegrar quem as admira Obrigado por assistir e seja bem vindo ao meu canal. #Paiting #grafitti #desenhos #comoas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395974/3395974_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T00:31:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_88.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_88.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395973/3395973_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:31:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sertanejo classica</video:title>
      <video:description>Sucesso Nacional #Sertanejo #coutry</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395972/3395972_720p.mp4</video:content_loc>
      <video:duration>245</video:duration>
      <video:publication_date>2026-09-02T00:31:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_87.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_87.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395971/3395971_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:31:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu escolho confiar em Jesus!</video:title>
      <video:description>O &quot;Efeito Centurião de Cafarnaum&quot;: O Valor de Reconhecer a Autoridade Sem Exigir Espetáculo Um oficial romano (um gentio, fora do meio religioso) procurou Jesus pedindo a cura de seu servo paralisado. Quando Jesus se ofereceu para ir até a sua casa, o centurião respondeu: &quot;Senhor, não sou digno de que entres debaixo do meu teto; mas dize somente uma palavra, e o meu servo sarará&quot;. Jesus admirou-se e declarou que não tinha encontrado fé tão grande em lugar nenhum. #femotivacional</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395970/3395970_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-09-02T00:31:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cardápios 2</video:title>
      <video:description>cardápios #cardápios</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395969/3395969_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T00:30:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_86.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_86.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395968/3395968_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:30:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395967</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395967/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doguinho da alegria</video:title>
      <video:description>Filhote brincalhão #Doguinho</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395967/3395967_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T00:30:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐱 Quando o gato decide brincar com a dona 😂</video:title>
      <video:description>Ela só queria um momento tranquilo… mas o gato tinha outros planos! 😂🐾 Quem manda em quem nessa casa? 😹❤️ #Gato #engraçado #gatobrincando #fofo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395966/3395966_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T00:30:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_85.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_85.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395965/3395965_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:30:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O verde da serra com chuva</video:title>
      <video:description>Oi gente esse e um vídeo onde mostro a chuva e o verde da Natureza</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395964/3395964_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T00:30:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Videos mais engraçado da internet</video:title>
      <video:description>Videos mais engraçado da internet 🇧🇷🇱🇷🇦🇨🇦🇩🇦🇪🇦🇫🇦🇬🇦🇮🇦🇱🇦🇲🇦🇴🇦🇶🇦🇷🇦🇸🇦🇹🇦🇺🇦🇼🇦🇽🇦🇿🇧🇦🇧🇧🇧🇩🇧🇪🇧🇫🇧🇬🇧🇭🇧🇮🇧🇯🇧🇱🇧🇲🇧🇳🇧🇴🇧🇶🇧🇸🇧🇹🇧🇻🇧🇼🇧🇾🇧🇿🇨🇦🇨🇨🇨🇩🇨🇫🇨🇬🇨🇭🇨🇮🇨🇰🇨🇱🇨🇲🇨🇳🇨🇴🇨🇵🇨🇷🇨🇺🇨🇻🇨🇼🇨🇽🇨🇾🇨🇿🇩🇪🇩🇬🇩🇯🇩🇰🇩🇲🇩🇴🇩🇿🇪🇦🇪🇨🇪🇪🇪🇬🇪🇭🇪🇷🇪🇸🇪🇹🇪🇺🇫🇮🇫🇯🇫🇰🇫🇲🇫🇴🇫🇷🇬🇦🇬🇧🇬🇩🇬🇪🇬🇫🇬🇬🇬🇭🇬🇮🇬🇱🇬🇲🇬🇳🇬🇵🇬🇶🇬🇷🇬🇸🇬🇹🇬🇺🇬🇼🇬🇾🇭🇰🇭🇲🇭🇳🇭🇷🇭🇹🇭🇺🇮🇨🇮🇩🇮🇪🇮🇱🇮🇲🇮🇳🇮🇴🇮🇶🇮🇷🇮🇸🇮🇹🇯🇪🇯🇲🇯🇴🇯🇵🇰🇪🇰🇬🇰🇭🇰🇮🇰🇲🇰🇳🇰🇵🇰🇷🇰🇼🇰🇾🇰🇿🇱🇦🇱🇧🇱🇨🇱🇮🇱🇰🇱🇸🇱🇹🇱🇺🇱🇻🇱🇾🇲🇦🇲🇨🇲🇩🇲🇪🇲🇫🇲🇬🇲🇭🇲🇰🇲🇱🇲🇲🇲🇳🇲🇴🇲🇵🇲🇶🇲🇷🇲🇸🇲🇹🇲🇺🇲🇻🇲🇼🇲🇽🇲🇾🇲🇿🇳🇦🇳🇨🇳🇪🇳🇫🇳🇬🇳🇮🇳🇱🇳🇴🇳🇵🇳🇷🇳🇺🇳🇿🇴🇲🇵🇦🇵🇪🇵🇫🇵🇬🇵🇭🇵🇰🇵🇱🇵🇲🇵🇳🇵🇷🇵🇸🇵🇹🇵🇼🇵🇾🇶🇦🇷🇪🇷🇴🇷🇸🇷🇺🇷🇼🇸🇦🇸🇧🇸🇨🇸🇩🇸🇪🇸🇬🇸🇭🇸🇮🇸🇯🇸🇰🇸🇱🇸🇲🇸🇳🇸🇴🇸🇷🇸🇸🇸🇹🇸🇻🇸🇽🇸🇾🇸🇿🇹🇦🇹🇨🇹🇩🇹🇫🇹🇬🇹🇭🇹🇯🇹🇰🇹🇰🇹🇱🇹🇲🇹🇳🇹🇴🇹🇷🇹🇹🇹🇻🇹🇼🇹🇿🇺🇦🇺🇬🇺🇲🇺🇳🇺🇸🇺🇾🇺🇿🇻🇦🇻🇨🇻🇨🇻🇪🇻🇬🇻🇮🇻🇳🇻🇺🇼🇫🇼🇸🇽🇰🇾🇪🇾🇹🇿🇦🇿🇲🇿🇼🏴󠁧󠁢󠁥󠁮󠁧󠁿🏴󠁧󠁢󠁳󠁣󠁴󠁿🏴󠁧󠁢󠁷󠁬󠁳󠁿 #todos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395963/3395963_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T00:29:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ARROZ cardápios</video:title>
      <video:description>QUE DELICIA #cardápios</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395962/3395962_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-02T00:29:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O bruxo em ação...</video:title>
      <video:description>⚽ #Gaúcho #Ronaldinho</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395961/3395961_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T00:29:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O FANTASMA 232 AMEAÇA DO PASSADO</video:title>
      <video:description>O Fantasma é uma tira de jornal do gênero aventura criada pelo roteirista Lee Falk (também criador do Mandrake) e o desenhista Ray Moore, contando as aventuras de um combatente do crime, mascarado e usando uma roupa característica. O personagem atua em um fictício país africano chamado Bangalla. A série começou a ser publicada em jornais diariamente em 17 de fevereiro de 1936, e aos domingos, como edição colorida, em maio de 1939, continuando até 2006. #Fantasma #quadrinhos #comics #gibi #fumetti</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395960/3395960_720p.mp4</video:content_loc>
      <video:duration>2415</video:duration>
      <video:publication_date>2026-09-02T00:29:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tortinha de limão</video:title>
      <video:description>Fácil rápido e barato #Fácil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395959/3395959_720p.mp4</video:content_loc>
      <video:duration>84</video:duration>
      <video:publication_date>2026-09-02T00:28:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_84.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_84.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395958/3395958_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:28:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>cardápios</video:title>
      <video:description>cardápios #cardápios</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395957/3395957_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T00:28:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O pedreiro!</video:title>
      <video:description>Caramelo da uma de pedreiro #Resenha #diversão #ia #alegria #humor #desnho #videosengraçados #cachorro #dog</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395956/3395956_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:28:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminhão 3</video:title>
      <video:description>#Caminhão #bolsas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395955/3395955_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-02T00:28:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ARAB MUSIC - بالقرب من النافذة | ROCK MARTIN | Lyrics Video</video:title>
      <video:description>Original song performed by Rock Martin (Rock Martan) Provided by MARCOS ALBERTO SILVA MARTINS =============================================================================== Find your preferred platform to listen to Rock Martin&apos;s songs 👇🏽👇🏽👇🏽 Just click the link below: https://linktr.ee/RockMartin =============================================================================== 📱 Follow Rock Martin on social media: Facebook: / rockmartinoficial X (Twitter): https://x.com/RockMartinReal Instagram: / rockmartinmusico =============================================================================== #popmusic #romantic #rockmartan #rockmartin #arabmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395954/3395954_720p.mp4</video:content_loc>
      <video:duration>249</video:duration>
      <video:publication_date>2026-09-02T00:27:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O sushi é uma comida popular no Japão.</video:title>
      <video:description>O sushi é uma comida popular no Japão. A maioria dos japoneses o aprecia muito e é um dos pratos mais comuns em seus cardápios #cardápios</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395953/3395953_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T00:27:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Music to relax and enjoy</video:title>
      <video:description>Just relax and enjoy this music.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395952/3395952_720p.mp4</video:content_loc>
      <video:duration>251</video:duration>
      <video:publication_date>2026-09-02T00:27:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395951</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395951/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_83.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_83.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395951/3395951_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:27:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>〖1-Hour〗Most Beautiful Japanese Song 2023 — For Studying &amp; Relaxing</video:title>
      <video:description>#asia #china #usa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395950/3395950_720p.mp4</video:content_loc>
      <video:duration>3731</video:duration>
      <video:publication_date>2026-09-02T00:27:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>child craving fruit</video:title>
      <video:description>naughty dad</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395949/3395949_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-02T00:27:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Chill Vocal Tropical Deep House 2026 ☀️ Summer Vibes Mix | Relaxing Ibiza Music 4K</video:title>
      <video:description>🌴 Welcome to the Best Chill Vocal Tropical Deep House 2026 ☀️ Relax and escape into a beautiful Summer Vibes Mix filled with smooth vocal melodies, tropical sounds, deep basslines and relaxing house rhythms. This mix combines the warm feeling of a tropical beach with the sophisticated atmosphere of Ibiza Deep House. Perfect for sunset moments, beach days, poolside relaxation, summer drives, vacations, rooftop evenings, studying, working, chilling and romantic summer nights. 🎶 CHILL VOCAL TROPICAL DEEP HOUSE 2026 ☀️ Summer Vibes 🌴 Tropical Deep House 🎤 Chill Vocal House 🌊 Relaxing Beach Music 🏝️ Ibiza Vibes 🌅 Sunset Deep House 🎧 Deep House &amp; Chillout 📺 4K UHD Visuals Put on your headphones, relax and let the tropical atmosphere take you away. Feel the summer. Feel the ocean. Feel the music. 🌴☀️🌊 #ChillVocalTropicalDeepHouse2026 #TropicalDeepHouse2026 #BestChillVocalHouse2026 #SummerVibesMix2026 #SummerDeepHouse2026 #TropicalHouse2026 #DeepHouse2026 #ChillHouse2026 #VocalDeepHouse2026 #ChillVocalMix #TropicalVocalHouse #IbizaDeepHouse2026 #IbizaSummerMix #SummerMusic2026 #TropicalSummerMusic #RelaxingDeepHouse #RelaxingTropicalHouse #BeachMusic2026 #SunsetDeepHouse #SunsetHouseMix #TropicalChillMix #ChilloutMusic2026 #DeepHouseMix2026 #BestDeepHouseMix #SummerChillMusic #PoolsideMusic #BeachVibesMusic #IbizaVibes #TropicalBeachVibes #RomanticDeepHouse #RelaxingHouseMusic #DeepElectronicMusic #SummerPartyMusic #4KUHDMusic #TropicalDeepHouseMix</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395948/3395948_720p.mp4</video:content_loc>
      <video:duration>227</video:duration>
      <video:publication_date>2026-09-02T00:25:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O ECONÔMISTA</video:title>
      <video:description>Tentando economizar no mercado #Resenha #diversão #ia #alegria #humor #desnho #videosengraçados #cachorro #dog</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395947/3395947_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:25:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395946</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395946/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Sheriffs of Savage Wells 2026 | Full Movie | HD</video:title>
      <video:description>The Sheriffs of Savage Wells 2026, Western/Romance Movie Info Synopsis Savage Wells needs a sheriff. Paisley Bell aims to prove herself while renowned lawman Cade O&apos;Brien also seeks the job. The rival candidates clash and banter as unexpected feelings develop. When criminals threaten the town, they must unite. Director John Lyde Producer John Lyde Screenwriter Sarah M. Eden Genre Western, Romance Original Language English Runtime 1h 30m #TheSheriffsofSavageWells2026 #FullMovie #HD #Western #Romance</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395946/3395946_720p.mp4</video:content_loc>
      <video:duration>6346</video:duration>
      <video:publication_date>2026-09-02T00:25:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Surfando com as palavras</video:title>
      <video:description>Poesia relata dentro das ilusões #Culture #poesia #freestyle</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395945/3395945_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-02T00:24:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_82.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_82.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395944/3395944_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:24:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_81.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_81.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395943/3395943_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:23:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395942</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395942/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 Golden | #2025MAMA | KPop Demon Hunters | 케이팝 데몬 헌터스</video:title>
      <video:description>Golden #2025MAMA - KPop Demon Hunters | K-팝 악마 사냥꾼 #KPopDemonHunters #Golden #GoldenKPopDemonHunters #KPopDemonHuntersGolden #HUNTRX #KPop #KPop2025 #2025MAMA #MAMAAwards #2025MAMAAwards #KoreanMusic #KPopMusic #KPopAnimation #NetflixKPop #DemonHunters #RumiMiraZoey #KPopGirls #Seoul #SouthKorea #KoreanCulture #케이팝데몬헌터스 #골든 #케이팝 #헌트릭스 #한국음악 #K팝</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395942/3395942_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-02T00:23:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395941</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395941/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NEYMAR REBATEU A TORCIDA DO CORINTHIANS</video:title>
      <video:description>#Neymar #Neymarjr #Santos #Futebol #Brasileirão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395941/3395941_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-02T00:23:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395940</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395940/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deus sobre a ponte</video:title>
      <video:description>Eli epoderoso para libeta</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395940/3395940_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:23:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 16</video:title>
      <video:description>Rir #1PremiumMarketsCA #UK #AU #NZ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395939/3395939_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-02T00:23:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395938</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395938/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pensa Direito</video:title>
      <video:description>Pensa direito, ver se não me ignora Depois não vem dizer que se arrependeu Meu coração que por ti ainda chora, chora quando eu me cansar, esquece você me perdeu Pensa direito, olha pra nós dois Não deixa o orgulho decidir por você Porque meu amor quando for embora nunca mais voltarei, cê vai se arrepender #Brasil #amor #música #romantica #seresta #arrocha #piseiro</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395938/3395938_720p.mp4</video:content_loc>
      <video:duration>216</video:duration>
      <video:publication_date>2026-09-02T00:23:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mom and daughter</video:title>
      <video:description>#Momanddaughter</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395937/3395937_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-02T00:22:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>From error to embrace, the wise peasant...</video:title>
      <video:description>the wise peasant, From error to embrace #from #wise #peasant #error #embrace</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395936/3395936_720p.mp4</video:content_loc>
      <video:duration>343</video:duration>
      <video:publication_date>2026-09-02T00:22:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RAIN - DJ LKS RIT INTERNATIONAL - LYRIC VIDEO #musicas #musicasinternacionais</video:title>
      <video:description>RAIN - DJ LKS RIT INTERNATIONAL - LYRIC VIDEO #musicas #musicasinternacionais #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395935/3395935_720p.mp4</video:content_loc>
      <video:duration>201</video:duration>
      <video:publication_date>2026-09-02T00:22:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O maracujá  traz isso  para a saúde e  você não sabia</video:title>
      <video:description>Os benefícios do maracujá para a saúde #Saúdealimentossaudavel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395934/3395934_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T00:22:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 114</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395933/3395933_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:22:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uma lição da vida</video:title>
      <video:description>História ilustrada que relata um acontecimento bastante envolvente muito bonita #históriarecortebravuracontoexemplos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395932/3395932_720p.mp4</video:content_loc>
      <video:duration>244</video:duration>
      <video:publication_date>2026-09-02T00:22:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_80.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_80.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395931/3395931_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:22:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 MYSTERIES HIDDEN FOR THOUSAND OF YEARS</video:title>
      <video:description>3 Mysteries Hidden for Thousands of Years — In this documentary, we explore three fascinating discoveries that revealed secrets from the past: the lost continent of Zealandia, almost entirely submerged beneath the Pacific Ocean; the mummy of Pharaoh Seqenenre-Taa-II, which revealed evidence of a violent past; and an ancient Roman shipwreck nearly 2,000 years old, discovered on the Mediterranean seabed. Three remarkable stories showing how science and archaeology continue to uncover forgotten chapters of human 3 Mistérios Escondidos por Milhares de Anos — Neste documentário, exploramos três descobertas fascinantes que revelaram segredos do passado: o continente perdido de Zealandia, quase totalmente escondido sob o Oceano Pacífico; a múmia do faraó Seqenenre-Taa-II, que revelou evidências de um passado violento; e um antigo navio romano de cerca de 2.000 anos, encontrado no fundo do Mediterrâneo. Três histórias que mostram como a ciência e a arqueologia continuam revelando capítulos esquecidos da nossa história. #misterio #documentário #educação #ciência #arqueologia #fatosdesconhecidos #egito #história #entretenimento</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395930/3395930_720p.mp4</video:content_loc>
      <video:duration>354</video:duration>
      <video:publication_date>2026-09-02T00:22:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cabelo</video:title>
      <video:description>Cabelo ruivo lindos #Cabeloruivolindos #ruivas #cremedecabelo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395929/3395929_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:21:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sempre Foi Você - Rock Romântico Emocional (Clipe Oficial)</video:title>
      <video:description>🎸 Ouça &quot;Sempre Foi Você&quot; em todas as plataformas digitais. Às vezes a gente roda o mundo inteiro para perceber que a resposta sempre esteve na nossa frente. &quot;Sempre Foi Você&quot; é um rock romântico para aqueles que acreditam que o amor verdadeiro não se apaga com o tempo, ele apenas espera o momento certo de voltar. Se essa música tocou seu coração, se inscreva no canal Leo em Acordes e ative o sininho. Aqui o rock e o sentimento andam juntos. Ficha Técnica: Letra e Composição: Leo em Acordes Produção: [Sua Produtora/Estúdio] Gênero: Rock Romântico / Emocional Conecte-se comigo: Instagram: @leo_em_acordes Canal de Rap/Hip Hop: Alma Blindada Canal de Rock (Inglês): Sonic Storm #RockRomanticoLeoEmAcordesSempreFoiVoceRockNacionalMusicaEmocionalRock2026</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395928/3395928_720p.mp4</video:content_loc>
      <video:duration>216</video:duration>
      <video:publication_date>2026-09-02T00:21:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIA DO BANHO!</video:title>
      <video:description>Caramelo foge para não tomar banho #Resenha #diversão #ia #alegria #humor #desnho #videosengraçados #cachorro #dog</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395927/3395927_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T00:21:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395926</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395926/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_79.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_79.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395926/3395926_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:21:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Risadas na certa 😃😃</video:title>
      <video:description>Risadas na certa😁😁😁 #todos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395925/3395925_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-02T00:21:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A música que vai te lembrar de quem você não esqueceu ( Rock Romântico Emocional)</video:title>
      <video:description>🎸 Tem sentimentos que o tempo não cura… só ensina a conviver. “Ainda Estou Aqui” é pra quem já tentou esquecer… mas percebeu que o coração não obedece. Se essa música te tocou, você não está sozinho. 💔 ouça, sinta… e compartilhe com alguém que precisa ouvir isso. #rockromanticomusicaemocionalsaudadeaindaestouaquileoeacordes</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395924/3395924_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-02T00:20:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395923</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395923/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NARUTO SURPASSED ALL THE HOKAGE AND BECAME THE MOST POWERFUL HOKAGE🤯💥__#shorts#trending#reels#virals</video:title>
      <video:description>NARUTO SURPASSED ALL THE HOKAGE AND BECAME THE MOST POWERFUL HOKAGE🤯💥__#shorts#trending#reels#virals.mp4 naruto the goat greatest of all time hokage man naruti is the ultimate ninja #anime</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395923/3395923_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-02T00:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Do not waste food/ 음식을 낭비하지 마세요Ne gaspillez pas la</video:title>
      <video:description>Do not waste food/ 음식을 낭비하지 마세요Ne gaspillez pas la #Donotwastefood음식을낭비하지마세요Negaspillezpasla</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395922/3395922_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:20:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GIGANTES DO OCEANO! A GUERRA SILENCIOSA DAS CRIATURAS MAIS BRUTAIS  DAS PROFUNDEZAS</video:title>
      <video:description>REINO DOS TUBARÕES: GIGANTE DOS OCEANOS A GUERRA SILENCIOSA DAS PROFUNDEZAS DOCUMENTÁRIO #oceano #vidamarinha #animais #natureza #documentario #mundoselvagem #tubarao #orca #baleia #deepocean #animalplanet #naturewild #oceanoprofundo O oceano parece calmo… mas essa é a maior ilusão da natureza. Debaixo da superfície, existe uma guerra constante pela sobrevivência. Predadores silenciosos, gigantes colossais e criaturas incrivelmente inteligentes disputam espaço em um dos ambientes mais extremos do planeta. Neste documentário, você vai mergulhar em um mundo onde: * A força não é tudo * A inteligência pode decidir o destino * E a união pode ser a única chance de sobreviver De caçadores solitários a estratégias em grupo impressionantes, cada criatura revela um lado brutal e fascinante da vida marinha. Mas a verdadeira pergunta é: **quem realmente domina o oceano?** Assista até o final… porque a resposta pode mudar completamente a forma como você enxerga a natureza. 🔥 **PARTICIPE DO VÍDEO:** Quero saber sua opinião 👇 👉 Qual criatura você acha mais impressionante? 👉 Você acredita que a sobrevivência depende mais de força ou inteligência? 👉 Já viveu alguma situação onde teve que se adaptar rápido para sobreviver? Comenta aí — eu leio tudo. 🌊 **INSCREVA-SE NO CANAL:** Se você gosta de conteúdos sobre natureza selvagem, mistérios do oceano e histórias reais que desafiam a lógica… esse canal é pra você. Se inscreve e ativa o sininho 🔔 pra não perder os próximos vídeos — aqui, cada conteúdo é uma nova descoberta. ⚠️ **IMPORTANTE:** Este vídeo tem fins educativos e informativos, baseado em comportamentos reais da vida marinha. #oceano #oceanoprofundo #vidamarinha #animaismarinhos #predadoresdooceano #tubarãobranco #orca #baleiaazul #baleiajubarte #sobrevivêncianooceano #documentári</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395921/3395921_720p.mp4</video:content_loc>
      <video:duration>1178</video:duration>
      <video:publication_date>2026-09-02T00:20:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_78.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_78.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395920/3395920_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:20:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rock Romântico 2026 - Afogado em Sentimentos (Álbum Completo) - Leo em Acordes</video:title>
      <video:description>🎸Prepare-se para uma jornada pelas profundezas do coração. 🎸💔 &quot;Afogado em Sentimentos&quot; é o meu novo álbum de Rock Romântico, feito para quem já amou, perdeu e ainda busca respostas nas melodias. São 8 faixas autorais que mergulham na nostalgia, na paixão e na superação. Se você gosta de um rock com alma e letras que tocam na ferida, inscreva-se no canal e acompanhe minha jornada musical. **🎧 Ouça por Faixas (Timeline):** 00:00 - 01. Só eu e você 03:45 - 02. Adeus ao que não volta 07:20 - 03. Me perdoe se te iludi 11:00 - 04. As noites nunca mais foram iguais 14:30 - 05. Caminhos errados 18:15 - 06. Como me livro dessa loucura 22:00 - 07. Do jeito que você gosta 25:40 - 08. Eu vivo minha vida por você **Siga Leo em Acordes:** 📺 YouTube Oficial: http://www.youtube.com/@leoemacordes https://youtube.com/@SonicStorm22?si=toExCL5U3xZC12L6 https://youtube.com/@blindada2205?si=Ucs9JdtPr26rVksh 🎧 Ouça nas plataformas digitais: Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ #RockRomanticoLeoEmAcordesAfogadoEmSentimentosRockNacionalMusicaParaOuvirBaladaRock</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395919/3395919_720p.mp4</video:content_loc>
      <video:duration>1684</video:duration>
      <video:publication_date>2026-09-02T00:20:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gambit e vampira x-men 97</video:title>
      <video:description>#Xmen97</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395918/3395918_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T00:20:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TONELADAS DE PAIXÃO</video:title>
      <video:description>Althaír e Alexandre #madão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395917/3395917_720p.mp4</video:content_loc>
      <video:duration>197</video:duration>
      <video:publication_date>2026-09-02T00:19:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O MÉDICO QUE BEBEU UMA BACTÉRIA PARA PROVAR QUE ESTAVA CERTO</video:title>
      <video:description>O MÉDICO QUE BEBEU UMA BACTÉRIA PARA PROVAR QUE ESTAVA CERTO!** Você está assistindo ao Ciência Inusitada, e hoje vamos contar a história absurda de Barry Marshall, o médico australiano que fez algo que nenhum cientista em sã consciência faria: Ele bebeu uma cultura da bactéria Helicobacter pylori. 😱 Por quê? Porque a comunidade científica inteira dizia que ele estava louco. E ele estava disposto a adoecer... para provar que estava certo! Essa é a história real de como um homem colocou sua própria saúde em jogo para revolucionar a medicina e descobrir a verdadeira causa das úlceras estomacais. 🏆 💡 Resultado: Ele ganhou o Prêmio Nobel de Medicina em 2005! #CiênciaInusitada #BarryMarshall #HelicobacterPylori #Ciência #HistóriaReal</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395916/3395916_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T00:19:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_77.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_77.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395915/3395915_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 15</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395914/3395914_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T00:19:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395913</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395913/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Louvando a Deus 2</video:title>
      <video:description>É um vidio de um hino da CCB</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395913/3395913_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-02T00:19:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Markin Poeta</video:title>
      <video:description>A vida é uma poesia #Culturapoetica #poesias #poemasart</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395912/3395912_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-02T00:19:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 14</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395911/3395911_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-02T00:19:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_76.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_76.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395910/3395910_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:19:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 13</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395909/3395909_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-02T00:18:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>other Best abs reveal vs this one</video:title>
      <video:description>Best abs reveal #Trollface #funny #gym #shorts #viral #trending #fyp #viralvideo #entertainment #amazing #interesting #mustwatch</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395908/3395908_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-02T00:18:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_75.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_75.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395907/3395907_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:18:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SENDO COBRADO NA RUA!</video:title>
      <video:description>Corre caramelo #Resenha #diversão #ia #alegria #humor #desnho #videosengraçados #cachorro #dog</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395906/3395906_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-02T00:18:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meliponicultura</video:title>
      <video:description>Criação de abelha sem ferrão #Apicultura</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395905/3395905_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T00:18:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>10 K-DRAMA WITH PROTECTIVE FEMALE LEAD</video:title>
      <video:description>What do you think of this video? Is your favorite protective female lead in this list? or do you have other names? Leave your comment below! Let us know what drama you&apos;d like us to do next. #koreandrama #koreandramas #newkoreandrama #koreandrama2025 #bestkoreandrama #koreandramarecap #newkoreandramas #topkoreandramas #koreandramashorts #koreandramaseries #bestkoreandramas #koreandramareviews #mydemonkoreandrama #fantasykoreandrama #koreadramas #koreandramainenglish #truebeautykoreandrama #5bestactionkoreandrama #romantickoreandramas #koreandramarecommendations #southkoreadrama #koreandramasjoindrama #koreandramainhindidubbed #koreadramas2025 #southkoreadrama-2023</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395904/3395904_720p.mp4</video:content_loc>
      <video:duration>288</video:duration>
      <video:publication_date>2026-09-02T00:18:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 12</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395903/3395903_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-02T00:18:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Poesia</video:title>
      <video:description>Poeta @markin_poeta #Poesias</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395902/3395902_720p.mp4</video:content_loc>
      <video:duration>132</video:duration>
      <video:publication_date>2026-09-02T00:18:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_74.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_74.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395901/3395901_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:18:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>50 Cent - In Da Club (Official Music Video) 6</video:title>
      <video:description>#music #50cent #in #da #club #hiphop</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395900/3395900_720p.mp4</video:content_loc>
      <video:duration>248</video:duration>
      <video:publication_date>2026-09-02T00:18:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 11</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395899/3395899_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:18:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395898</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395898/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O ENDRICK FEZ A PIOR ESCOLHA</video:title>
      <video:description>#Realmadrid #Futebol #Laliga #mbappe #brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395898/3395898_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-02T00:17:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_73.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_73.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395897/3395897_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:17:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chuva 6</video:title>
      <video:description>Lugar maravilhoso</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395896/3395896_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-02T00:17:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You are not weak.</video:title>
      <video:description>VOCÊ NÃO É FRACO. Talvez apenas tenha sido condicionado a desistir rápido demais. Pare de procurar desculpas. Controle sua mente. Treine sua disciplina. Domine suas ações. O mundo não precisa saber dos seus próximos passos. Observe. Calcule. Aja. WYAN VEX Controle • Disciplina • Domínio 🐺♟️ #WyanVexControleDiscplinaDominioForcaMental</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395895/3395895_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T00:17:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_72.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_72.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395894/3395894_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:17:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ORATÓRIA?</video:title>
      <video:description>CORTESFLIX - elprofessordaoratoria #CORTESFLIX-elprofessordaoratoria</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395893/3395893_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T00:17:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 10</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395892/3395892_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-02T00:17:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>奥林匹斯众神的起源：改变世界的远古传说 ⚡🏛️</video:title>
      <video:description>在古希腊的传说中，世界经历了一个充满力量、战争与传奇的时代。 从远古的混沌，到巨大的战争，再到传说中的奥林匹斯世界，这些故事影响了人类数千年。 本视频以电影级画面重新演绎古希腊神话中的经典传说。 这是一场关于力量、命运与传奇的史诗之旅。 如果你喜欢历史、神话和世界古老文明的故事，欢迎关注。 你最想了解哪一个古希腊传说？ #希腊神话古希腊历史故事神话传说世界文明奥林匹斯传奇故事</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395891/3395891_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-02T00:17:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_71.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_71.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395890/3395890_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:17:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AINDA PRECISO DE VOCÊ (3 Versões Épicas) | Rock Romântico, Acústico &amp; Dueto – Leo em Acordes</video:title>
      <video:description>🎸&quot;Uma música, três emoções diferentes. Bem-vindos ao lançamento especial de &apos;Ainda Preciso de Você&apos; aqui no Leo em Acordes. Neste vídeo, juntei três interpretações poderosas de um rock romântico emocionante. Você vai ouvir a força da versão oficial, a intimidade da versão acústica e o drama do dueto homem-mulher. Qual delas vai tocar seu coração?&quot; Tracklist / Chapters: 00:00 1. Ainda Preciso de Você (Rock Romântico Emocional) 03:50 2. Ainda Preciso de Você (Acústico / Violão &amp; Voz) 07:15 3. Ainda Preciso de Você (Dueto / Homem &amp; Mulher) Links e Call to Action: &quot;⚡ Inscreva-se no Leo em Acordes: https://youtube.com/@leoemacordes?si=WWjIHjyTTiD1jTOx 💬 Qual das 3 versões você mais gostou? Me conta nos comentários! 👉&quot; Hashtags: #LeoEmAcordesAindaPrecisoDeVocêRockRomânticoDuetoViolãoEVozLançamentoMusical</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395889/3395889_720p.mp4</video:content_loc>
      <video:duration>543</video:duration>
      <video:publication_date>2026-09-02T00:17:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Choro chorado por você</video:title>
      <video:description>Oi! 😊 É uma alegria enorme acompanhar o seu trabalho mais uma vez e parabenizá-lo(a) por essa linda nova conquista! 👏❤️ É sempre um prazer assistir aos seus vídeos e ver o cuidado e a dedicação que você coloca em cada novo projeto. Admiro muito a sua criatividade e, acima de tudo, a forma como você coloca o coração em tudo o que faz. Seu comprometimento e sua paixão transparecem naturalmente nos resultados, dando a cada peça aquele toque especial que é só seu. Fico muito feliz em estar aqui, acompanhando e torcendo por você a cada nova etapa alcançada. Continue criando, mantendo a dedicação e transmitindo essa energia linda em tudo o que faz. Você merece todo o reconhecimento pelo trabalho que vem realizando. Um grande abraço, — com muito carinho, respeito e admiração. Parabéns por mais um projeto maravilhoso! ❤️👏 #choro #chorinho #choroinstrumental #músicainstrumentalbrasileira #chorobrasileiro #ChoroChoradopraVocê #cavaquinho #violãodechoro #regionaldechoro #MPB #chorodeverdade #músicabrasileiraraiz #sambaechoro #forróechoro #músicainstrumental #cavaquinhoeviolão #chororomântico #músicanostálgica #músicaautoralbrasileira #Niltoncompositor #letraemúsicaNilton #chorodocoração #rodadechoro #músicaderaiz #choroclássicobrasileiro #chorocontemporâneo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395888/3395888_720p.mp4</video:content_loc>
      <video:duration>336</video:duration>
      <video:publication_date>2026-09-02T00:17:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 9</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395887/3395887_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T00:17:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minha sobrinha Linda titio ama de mais ❤️</video:title>
      <video:description>A princesa do titio 😍😍😍</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395886/3395886_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:17:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_70.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_70.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395885/3395885_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:17:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_69.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_69.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395884/3395884_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:16:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Verdadeiro amor</video:title>
      <video:description>Viva a vida intensamente</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395883/3395883_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T00:16:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 8</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395882/3395882_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T00:16:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O melhor do Rock Romântico: Álbum Corações Indomáveis (Completo)</video:title>
      <video:description>🎸 Seja bem-vindo ao lançamento oficial do álbum &quot;Corações Indomáveis&quot;. Prepare o fone de ouvido para uma jornada intensa por sentimentos, superação e muito rock emocional. 🎸💔 Cada faixa deste álbum foi composta para quem já amou, perdeu e seguiu em frente com o coração indomável. Se a música tocar sua alma, não esqueça de se inscrever e ativar o sininho! 📌 Faixas do Álbum: 00:00 01 - Posso Viver Mil Vidas 03:30 02 - Coração em Pedaços 07:00 03 - Ainda Preciso de Você 10:30 04 - Porque Ainda Estou Aqui 14:00 05 - Amor Imortal 17:30 06 - Obrigado por Me Quebrar 21:00 07 - É Amor ou Ilusão 24:30 08 - Entre o Amor e a Saudade 🎧 Ouça também nas plataformas digitais: Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ 📱 Siga meus outros canais: Sonic Storm: https://youtube.com/@SonicStorm22 Alma Blindada: https://youtube.com/@blindada2205 ✅ Inscreva-se no canal Leo em Acordes: http://www.youtube.com/@leoemacordes #RockEmocionalLeoEmAcordesCoracoesIndomaveisRockNacionalAlbumCompletoMusicaIndependente</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395881/3395881_720p.mp4</video:content_loc>
      <video:duration>1785</video:duration>
      <video:publication_date>2026-09-02T00:16:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_68.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_68.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395880/3395880_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:16:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LIVRO O SEGREDO</video:title>
      <video:description>CORTESFLIX - elprofessordaoratoria #CORTESFLIX-elprofessordaoratoria</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395879/3395879_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-02T00:16:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_67.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_67.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395878/3395878_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:16:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 7</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395877/3395877_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:16:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_66.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_66.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395876/3395876_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:15:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BRAZILIAN ROCK | &apos;ALINE&apos; | NEURAMA feat ROCK MARTIN</video:title>
      <video:description>Brazilian rock featuring the band Neurama from Belém do Pará. Vocals by Rock Martin (Rock Martan). Provided by MARCOS ALBERTO SILVA MARTINS =============================================================================== Find your preferred platform to listen to Rock Martin&apos;s songs 👇🏽👇🏽👇🏽 Just click the link below: https://linktr.ee/RockMartin =============================================================================== 📱 Follow Rock Martin on social media: Facebook: / rockmartinoficial X (Twitter): https://x.com/RockMartinReal Instagram: / rockmartinmusico =============================================================================== #MUSIC #rock #rockmartin #rockmartan</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395875/3395875_720p.mp4</video:content_loc>
      <video:duration>245</video:duration>
      <video:publication_date>2026-09-02T00:15:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LULA OU BOLSONARO?</video:title>
      <video:description>CORTESFLIX - elprofessordaoratoria #CORTESFLIX-elprofessordaoratoria</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395874/3395874_720p.mp4</video:content_loc>
      <video:duration>53</video:duration>
      <video:publication_date>2026-09-02T00:15:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 6</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395873/3395873_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-02T00:15:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_65.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_65.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395872/3395872_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:15:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_64.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_64.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395871/3395871_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:15:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_63.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_63.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395870/3395870_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:14:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 5</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395869/3395869_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:14:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GRAND THEFT AUTO VI: AN EXTENDED LOOK | GRAND THEFT AUTO VI: UN VISTAZO EN PROFUNDIDAD | GTA 6</video:title>
      <video:description>#GTA #GTA6 #GRAND #THEFT #AUTO #GRANDTHEFTAUTO</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395868/3395868_720p.mp4</video:content_loc>
      <video:duration>1608</video:duration>
      <video:publication_date>2026-09-02T00:14:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395867</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395867/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>INDO SE ESCREVER NO BOLSA FAMÍLIA!</video:title>
      <video:description>Caramelo vai no cras #Resenha #diversão #ia #alegria #humor #desnho #videosengraçados #cachorro #dog</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395867/3395867_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-02T00:14:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395866</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395866/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_62.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_62.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395866/3395866_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:14:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395865</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395865/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_61.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_61.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395865/3395865_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-02T00:14:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395864</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395864/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera4</video:title>
      <video:description>Rir #Brasil #india #china #eua #russia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395864/3395864_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-02T00:13:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395863</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395863/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POLÊMICA EM BARRETOS: Cowboys estrangeiros se RECUSARAM a MONTAR na final da Festa do Peão de Barret</video:title>
      <video:description>POLÊMICA EM BARRETOS: Cowboys estrangeiros se RECUSARAM a MONTAR na final da Festa do Peão de Barretos de 1998. CONTROVERSY IN BARRETOS: Foreign cowboys REFUSED to RIDE in the 1998 Barretos Cowboy Festival final.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395863/3395863_720p.mp4</video:content_loc>
      <video:duration>546</video:duration>
      <video:publication_date>2026-09-02T00:13:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395861</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395861/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anime 314</video:title>
      <video:description>Video caça fantasma 👻</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395861/3395861_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T00:13:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395860</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395860/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Afogado na Multidão | Rock Nacional Intenso e Emocional</video:title>
      <video:description>🎸 Às vezes a gente está cercado de pessoas, mas se sente completamente sozinho. “Afogado na Multidão” é um rock intenso, com alma e verdade, falando sobre gritar por dentro enquanto o mundo segue indiferente. Influenciada pelo peso emocional e pela atitude do rock nacional, essa música é um desabafo pra quem já se sentiu invisível no meio do barulho. Dá o play, sente a letra e se conecta. 🎸🔥 🔔 Inscreva-se e acompanhe cada lançamento, apoiando essa jornada musical!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395860/3395860_720p.mp4</video:content_loc>
      <video:duration>225</video:duration>
      <video:publication_date>2026-09-02T00:13:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395859</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395859/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FIQUE RICO ASSIM?</video:title>
      <video:description>CORTESFLIX - elprofessordaoratoria #CORTESFLIX-elprofessordaoratoria</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395859/3395859_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-02T00:13:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395858</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395858/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ruth Star</video:title>
      <video:description>Olha o medo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395858/3395858_720p.mp4</video:content_loc>
      <video:duration>137</video:duration>
      <video:publication_date>2026-09-02T00:13:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395857</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395857/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quando a Noite Chega – Mais Que Palavras | Rock Romântico Acústico</video:title>
      <video:description>&quot;Quando a Noite Chega&quot; é uma canção de rock romântico acústico que fala sobre o silêncio da madrugada, os conflitos internos e a luta para continuar mesmo quando tudo parece pesado demais. A música traduz sentimentos que muitas vezes não conseguem ser ditos em voz alta, transformando dor, solidão e esperança em melodia. Mais que palavras, é um desabafo em forma de música — para quem sente demais, para quem enfrenta a noite em silêncio, para quem segue mesmo sem saber até quando. 🎸 Rock romântico acústico 🌙 Emoção, intensidade e verdade 🔔 Inscreva-se e acompanhe cada lançamento, apoiando essa jornada musical!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395857/3395857_720p.mp4</video:content_loc>
      <video:duration>239</video:duration>
      <video:publication_date>2026-09-02T00:13:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395856</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395856/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera3</video:title>
      <video:description>Rir #Brasil #india #china</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395856/3395856_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-02T00:12:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395855</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395855/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O ALISSON FICOU FURIOSO</video:title>
      <video:description>#Alisson #Liverpool #Laliga #Futebol #Brasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395855/3395855_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-02T00:12:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395854</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395854/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O ano começou-Mc Kevin 2027</video:title>
      <video:description>Conta de como o ano começou pra tantas conquistas á conquistar tava virando vício. #Funk</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395854/3395854_720p.mp4</video:content_loc>
      <video:duration>226</video:duration>
      <video:publication_date>2026-09-02T00:12:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395853</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395853/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Que Eu Farei Sem Você | Uma Música Pra Quem Já Perdeu Alguém Que Amava</video:title>
      <video:description>🎸O Que Eu Farei Sem Você é uma música de rock acústico romântico, feita para quem já amou de verdade e precisou aprender a conviver com a ausência. Essa canção fala sobre saudade, silêncio, lembranças e aquela pergunta que nunca sai da cabeça quando alguém especial vai embora. Cada verso carrega sentimento, cada acorde tenta dizer o que o coração não consegue explicar. Se essa música tocou você de alguma forma, deixe seu like, compartilhe com quem precisa ouvir e se inscreva no canal para não perder as próximas canções. 🎸💔 Algumas músicas não são só ouvidas… são sentidas.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395853/3395853_720p.mp4</video:content_loc>
      <video:duration>228</video:duration>
      <video:publication_date>2026-09-02T00:12:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395852</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395852/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gta 6</video:title>
      <video:description>GTA 6 vazamento do aviação longo o mapa gigantesco #gta #gamer</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395852/3395852_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-02T00:12:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395851</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395851/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>INDO AO MERCADO COM 10 REAIS!</video:title>
      <video:description>Caramelo tenta fazer compras com 10 reais. #Resenha #diversão #ia #alegria #humor #desnho #videosengraçados #cachorro #dog</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395851/3395851_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395850</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395850/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Unlocking the Laws of Basic Economics</video:title>
      <video:description>The text summarizes the fundamental principles of the book *Basic Economics* by Thomas Sowell. #financas #canaldefinancas #dicasdefinancas #financaspessoais #livrosdefinancas #organizarfinancas #organizarasfinancas #financasparamulheres #aulafinancaspessoais #comoorganizarfinancas #organizarfinancascasal #financasparainiciantes #aulafacilsobrefinancas #financaspessoaisbrasil #financaseinvestimentos #financaspessoaisdozero #comoorganizarasfinancas #financascomportamentais #dicasdefinancaspessoais #fasesdasfinancaspessoais #aulacompletasobrefinancas #comoorganizarsuasfinancas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395850/3395850_720p.mp4</video:content_loc>
      <video:duration>672</video:duration>
      <video:publication_date>2026-09-02T00:12:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395849</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395849/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rhythm Is a Dancer 2025 Full Movie HD</video:title>
      <video:description>Rhythm Is a Dancer 2025 Full Movie HD A dancer facing career decline returns home to meet her biological father. Raised by her lesbian mother through insemination, she navigates family complexities while bonding with elderly coworkers who help her find herself. Director Lauren Caster Writer Lauren Caster Stars Ser AnzoateguiAmy AquinoJasmine Ashanti See production info at IMDbPro #RhythmIsaDancer2025 #FullMovie #HD</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395849/3395849_720p.mp4</video:content_loc>
      <video:duration>5548</video:duration>
      <video:publication_date>2026-09-02T00:12:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395848</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395848/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zuera 3</video:title>
      <video:description>Rir #Brasil #india #china</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395848/3395848_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:12:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395847</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395847/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tem algo errado na minha cidade</video:title>
      <video:description>E de repente o povo surta kkkkk. #Spidermam #batman #tudomundoempânico</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395847/3395847_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-02T00:12:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395846</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395846/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Others Building Lego vs The Last One</video:title>
      <video:description>Others Building Lego vs The Last One #TheLastOne #trollface #spiderman #lego #minicraft #funnyvídeo #funny #viralvídeo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395846/3395846_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T00:11:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395845</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395845/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Orquídeas 2</video:title>
      <video:description>No sítio</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395845/3395845_720p.mp4</video:content_loc>
      <video:duration>420</video:duration>
      <video:publication_date>2026-09-02T00:11:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395844</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395844/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Loucura Que Me Leva Até Você” – Um Rock Romântico Pra Sentir na Alma 🎸❤️</video:title>
      <video:description>🎸“Loucura que me leva até você” é um rock romântico intenso, daqueles que batem forte no coração. Com uma vibe que lembra Reação em Cadeia e Malta, a música fala sobre amor, saudade e aquela loucura boa de não conseguir deixar alguém pra trás. Se você já amou de verdade, essa canção vai te encontrar. 🎸❤️ Dá o play, sente a letra e deixa essa emoção te levar.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395844/3395844_720p.mp4</video:content_loc>
      <video:duration>231</video:duration>
      <video:publication_date>2026-09-02T00:11:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395843</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395843/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chuva 5</video:title>
      <video:description>#Chuva #chimarrão</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395843/3395843_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-02T00:11:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395842</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395842/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Uma cobertura de vídeo visual de um evento público</video:title>
      <video:description>Da radiola hiper mega Itamarati #HipermegaItamarati</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395842/3395842_720p.mp4</video:content_loc>
      <video:duration>134</video:duration>
      <video:publication_date>2026-09-02T00:11:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395841</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395841/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pescaria 🎣</video:title>
      <video:description>Dourado, rei do Rio</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395841/3395841_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T00:11:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395840</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395840/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Casal comedia 😭😭</video:title>
      <video:description>Risadas na horas 😁😁😁</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395840/3395840_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-02T00:11:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395839</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395839/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LEO EM ACORDES - Tudo de Mim (Rock Romântico / Clipe Oficial)</video:title>
      <video:description>🎸🎧 Ouça &quot;Tudo de Mim&quot; na sua plataforma digital favorita! Inscreva-se no canal LEO EM ACORDES e ative o sininho (🔔) para fortalecer o rock nacional e não perder nenhum lançamento. &quot;Tudo de Mim&quot; é uma canção visceral sobre o peso de carregar fantasmas do passado. Aquelas feridas profundas que o tempo se recusa a apagar, e o paradoxo de ter dado tudo de si por alguém que hoje assombra até os nossos melhores sonhos. Um rock romântico/emocional denso, com guitarras marcantes e muita verdade em cada verso. Composição e Produção: Leonardo Correa Canal Oficial: Leo em Acordes ▶️ LETRA: Cansei de ficar aqui Reprimido por meus medos infantis Se tiver que ir, desejo que você se vá Pois eu ainda te sinto aqui E isso não me traz paz Feridas que não curam A dor é tão real Tem coisas que o tempo não pode apagar Quando chorou Eu estava lá pra te consolar Quando você gritou Enfrentei seus medos pra te salvar Todo esse tempo estive aqui pra te apoiar Mas você ainda tem tudo de mim Você sempre me cativou Com a sua luz sempre a brilhar O que restou de você não me deixa continuar Seu rosto assombra os meus melhores sonhos Sua voz já expulsou a sanidade de mim Feridas que não curam A dor é tão real Tem coisas que o tempo não pode apagar Quando chorou Eu estava lá pra te consolar Quando você gritou Enfrentei seus medos pra te salvar Todo esse tempo estive aqui pra te apoiar Mas você ainda tem tudo de mim Tentei me convencer De que você já se foi Mesmo que ainda esteja em mim Esse tempo todo eu sempre estive só Quando chorou Eu estava lá pra te consolar Quando você gritou Enfrentei seus medos pra te salvar Todo esse tempo estive aqui pra te apoiar Mas você ainda tem tudo de mim 📱 Conecte-se com Leo em Acordes: • Inscreva-se no canal: 📺 YouTube Oficial: http://www.youtube.com/@leoemacordes htt</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395839/3395839_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-02T00:11:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395838</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395838/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>قط جميل 2</video:title>
      <video:description>🐱جميل قط #🐱قط جميل #🐱قطجميل</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395838/3395838_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T00:11:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395837</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395837/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A ATITUDE COVARDE DA TORCIDA DO CORINTHIANS</video:title>
      <video:description>#Futebol #Neymar #Neymarjr #Santos #Brasileirão</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395837/3395837_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-02T00:10:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395836</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395836/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brincando  na cama da vovó😀</video:title>
      <video:description>Gabizinha pulando na cama da vovó 😀 #crianca #pulapula</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395836/3395836_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-02T00:10:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395835</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395835/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deixo Tudo Pra Trás / I Leave It All Behind (Rock Emocional) - Versões PT &amp; EN</video:title>
      <video:description>🎸O renascimento começa quando aprendemos a soltar o peso do que passou. Apresento a vocês &quot;Deixo Tudo Pra Trás&quot;, uma composição que transita entre a dor da despedida e a força necessária para recomeçar. Este vídeo traz a música em duas versões: a original em português e a adaptação intensa em inglês. 🎸 Neste vídeo: 3:00 - Deixo Tudo Pra Trás (Versão em Português) 3:04 - I Leave It All Behind (English Version) 🔔 Inscreva-se no canal: https://youtube.com/@leoemacordes?si=ke2-5HQNUEfLzKR- Apoie o rock emocional e acompanhe as próximas composições autorais. #RockEmocionalRockNacionalAutoraisLeoEmAcordesDeixoTudoPraTrásEmotionalRockNewMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395835/3395835_720p.mp4</video:content_loc>
      <video:duration>365</video:duration>
      <video:publication_date>2026-09-02T00:10:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395834</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395834/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Casal comedia 🫣</video:title>
      <video:description>Risadas na horas😭😭😭</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395834/3395834_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T00:09:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395833</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395833/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>satu pemain yang di anggap lebih hebat dari neymar</video:title>
      <video:description>#neymar</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395833/3395833_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-02T00:09:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395832</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395832/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nada Se Compara | Official Music Video | Versão Rock</video:title>
      <video:description>🎸 Depois de tanto tempo, essa música voltou em uma nova versão. &quot;Nada Se Compara&quot; agora ganha uma nova identidade em uma versão rock mais moderna e com um clipe que tenta mostrar exatamente o sentimento da letra. Essa música fala sobre aquele momento em que tudo muda… quando alguém aparece e o resto do mundo parece perder o sentido. Obrigado a todo mundo que acompanha meus projetos e escuta minhas músicas ❤️ 🎵 Música: Nada Se Compara 🎬 Clipe Oficial 🎸 Versão Rock Se gostou: 👍 Deixa o like 💬 Comenta sua parte favorita 🔔 Se inscreve para acompanhar os próximos lançamentos 📌 COMENTÁRIO FIXADO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395832/3395832_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-02T00:09:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395831</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395831/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>アジア人美女が寿司にテンションMAX！Asian girls are so excited with Sushi!</video:title>
      <video:description>アジア人美女が寿司にテンションMAX！Asian girls are so excited with Sushi! #寿司に感動 #外国人美女 #リアクション #ngワード寿司 #激辛チャレンジ #寿司 #お寿司 #寿司海外 #回転寿司 #寿司反応 #元気寿司 #ロシア人 #高級寿司 #イカ寿司 #くら寿司 #寿司外国人 #外国人寿司 #日本の寿司 #寿司韓国人 #ちらし寿司 #寿司シェフ #海外寿司反応 #日本が好き #回転寿司東京 #ガジェ通 #池袋お寿司 #寿司100貫 #寺門ジモン #外国人が感動 #日本の高級寿司 #外国人お寿司反応 #寿司食べレポ #オーストラリア人 #ガジェット通信 #カルチャーショック #日本が好きな理由 #外国人回転寿司反応 #ばんばかいが #せりつばかいが #日本が好きな外国人 #マグロの解体ショー #外国人寿司食べてみた</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395831/3395831_720p.mp4</video:content_loc>
      <video:duration>420</video:duration>
      <video:publication_date>2026-09-02T00:09:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395830</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395830/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😱 BOTA A PATA NA CABEÇA!</video:title>
      <video:description>Caramelo foi parado pela polícia #Resenha #diversão #ia #alegria #humor #desnho #videosengraçados #cachorro #dog</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395830/3395830_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-02T00:09:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395828</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395828/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>UM TESTE DE FÉ</video:title>
      <video:description>A história do sacrifício de Isaque, encontrada em Gênesis 22, é uma das narrativas mais significativas e simbólicas da Bíblia. Deus chama Abraão, seu servo fiel, para realizar uma tarefa inimaginável: oferecer seu filho Isaque como sacrifício no monte Moriá. Isaque não era apenas o filho amado de Abraão; ele representava o cumprimento da promessa divina de que sua descendência seria numerosa. Abraão, com fé inabalável, obedece sem questionar. Ele viaja por três dias com Isaque e prepara um altar no local indicado. Durante o percurso, Isaque questiona: &quot;Onde está o cordeiro para o sacrifício?&quot; Abraão responde com fé: &quot;Deus proverá para si o cordeiro.&quot; No momento crucial, quando Abraão está prestes a sacrificar Isaque, um anjo do Senhor o interrompe e revela que foi apenas um teste de sua fé e obediência. Deus então providencia um carneiro para ser sacrificado no lugar de Isaque. Essa história demonstra a profundidade da confiança de Abraão em Deus e destaca a provisão divina em tempos de provação. Além disso, ela é vista como um prenúncio do sacrifício de Cristo, simbolizando a redenção e a misericórdia divina. A narrativa inspira reflexão sobre fé, entrega e a certeza de que Deus é fiel em suas promessas. #fé #Deus #Jesus #cristão #cristã #Cristo #mensagem #mensagembíblica #oração #oraçãodamanhã #crente #evangélico #história #históriabíblica #confiança #pasciencia #renovo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395828/3395828_720p.mp4</video:content_loc>
      <video:duration>238</video:duration>
      <video:publication_date>2026-09-02T00:09:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395827</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395827/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Double the Energy, Double the Fun /에너지 두 배, 재미도 두 배</video:title>
      <video:description>Double the Energy, Double the Fun /에너지 두 배, 재미도 두 배 #Dança #viralizar #fy #viral #coreana #dance #jogos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395827/3395827_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-02T00:08:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395826</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395826/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Homenagem -Mc Kevin</video:title>
      <video:description>Artista de funk ...luto , nos deixou em 2021 #Brasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395826/3395826_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-09-02T00:08:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395825</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395825/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hinos de p acalmar</video:title>
      <video:description>A dia. Difícil e bom ouvir. Uma musica p acalmar #Viver</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395825/3395825_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-02T00:08:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395824</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395824/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>B🫂</video:title>
      <video:description>🅱️ #fyp #Brasilsaopaulo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395824/3395824_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-02T00:08:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395823</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395823/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AINDA EXISTE ESPERANÇA | Rock Romântico Emocional (Clipe Oficial)</video:title>
      <video:description>🎸Às vezes a vida pesa. Os sonhos parecem distantes. As dúvidas aparecem. E continuar parece cada vez mais difícil. &quot;AINDA EXISTE ESPERANÇA&quot; é uma música para quem já pensou em desistir, mas encontrou forças para seguir em frente. Se essa mensagem tocou seu coração, deixe seu like, compartilhe e inscreva-se no canal. 🎸 Música: Ainda Existe Esperança 🎤 Canal: Leo em Acordes Deixe nos comentários: Qual trecho dessa música mais falou com você? #RockEmocionalRockRomanticoLeoEmAcordesMusicaAutoralEsperancaSuperacaoRockNacional</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395823/3395823_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-02T00:08:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395822</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395822/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>From error to embrace, the wise peasant</video:title>
      <video:description>From error to embrace, the wise peasant #error #from #embrace #wise #peasant</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395822/3395822_720p.mp4</video:content_loc>
      <video:duration>343</video:duration>
      <video:publication_date>2026-09-02T00:08:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395821</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395821/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GTA CRASH TESTING REAL CAR | PRUEBAS DE CHOQUE CON COCHES REALES EN GTA</video:title>
      <video:description>#gta #crash #test #car</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395821/3395821_720p.mp4</video:content_loc>
      <video:duration>611</video:duration>
      <video:publication_date>2026-09-02T00:08:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395820</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395820/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ônibus,coreria</video:title>
      <video:description>#Correria #ônibus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395820/3395820_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T00:08:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395819</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395819/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trevo 🍀 do atuba</video:title>
      <video:description>Curitiba</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395819/3395819_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-02T00:08:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395818</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395818/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Baby mermaid so cute 🥰</video:title>
      <video:description>Baby mermaid so cute 🥰 #babymermaidcutefypshort</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395818/3395818_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-02T00:07:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395817</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395817/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soccer Quiz</video:title>
      <video:description>#futebol #soccer #quiz #teste #esporte</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395817/3395817_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-02T00:07:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395816</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395816/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AINDA EXISTE ESPERANÇA (Versão Acústica) | Leo em Acordes</video:title>
      <video:description>🎸 Existem momentos em que a vida fica silenciosa... E nesse silêncio, surgem as dúvidas, os medos e as incertezas. Mas também é nesse silêncio que muitas vezes encontramos a força para continuar. &quot;AINDA EXISTE ESPERANÇA&quot; ganha uma versão acústica mais íntima, simples e verdadeira, para tocar diretamente o coração de quem está precisando ouvir essa mensagem. Se essa música falou com você, deixe seu comentário e compartilhe com alguém especial. 🎸 Música: Ainda Existe Esperança (Versão Acústica) 🎤 Canal: Leo em Acordes #AcusticoLeoEmAcordesMusicaAutoralEsperancaViolaoAcousticRockAcusticoMusicaEmocional</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395816/3395816_720p.mp4</video:content_loc>
      <video:duration>178</video:duration>
      <video:publication_date>2026-09-02T00:07:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395815</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395815/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>**O silêncio vai dizer o resto | Lançamento Oficial**</video:title>
      <video:description>🎸Nem tudo termina com palavras. Algumas histórias acabam no silêncio. **O silêncio vai dizer o resto** é uma música sobre o que ficou preso na garganta, sobre o amor que não teve resposta e sobre tudo aquilo que ainda dói quando ninguém diz nada. Dá o play, sente a música e, se tocar você, deixa um comentário. Às vezes, o silêncio também é uma resposta. Rock romântico | Música autoral Obrigado por ouvir 📺 YouTube Oficial: http://www.youtube.com/@leoemacordes https://youtube.com/@SonicStorm22?si=toExCL5U3xZC12L6 https://youtube.com/@blindada2205?si=Ucs9JdtPr26rVksh 🎧 Ouça nas plataformas digitais: Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ #OSilencioVaiDizerORestoRockRomanticoRockNacionalMusicaAutoralLancamento</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395815/3395815_720p.mp4</video:content_loc>
      <video:duration>215</video:duration>
      <video:publication_date>2026-09-02T00:06:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395813</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395813/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>☀️ Summer Mix 2027 🌴 Best Tropical Deep House, Chill &amp; Ibiza Vibes 4K UHD 🎶</video:title>
      <video:description>Escape into the ultimate Tropical Deep House, Chill &amp; Ibiza Vibes experience in stunning 4K UHD. Enjoy warm summer energy, crystal-clear ocean views, beautiful sunsets and deep electronic grooves designed to create the perfect summer atmosphere. Perfect for beach days, sunset sessions, pool parties, Ibiza nights, rooftop lounges, road trips, vacations, relaxation, studying, working and late-night summer vibes. 🎶 SUMMER MIX 2027 🌴 Tropical Deep House 🌊 Chill House ☀️ Summer Vibes 🏝️ Ibiza Vibes 🌅 Sunset House 💎 Luxury Beach Club Atmosphere 🎧 Deep Electronic Sounds 📺 4K UHD Visual Experience Turn up the volume, relax and let the tropical rhythm take you somewhere unforgettable. SUMMER IS A STATE OF MIND. ☀️🌴🌊 #SummerMix2027 #SummerMusic2027 #SummerMix #TropicalDeepHouse #TropicalHouse2027 #DeepHouse2027 #BestDeepHouse2027 #IbizaVibes2027 #IbizaSummerMix2027 #IbizaDeepHouse #ChillDeepHouse #ChillHouse2027 #SummerDeepHouse #TropicalChill #TropicalHouseMix #DeepHouseMix2027 #SummerVibes #BeachMusic #BeachPartyMusic #SunsetDeepHouse #SunsetHouseMix #PoolPartyMusic #LuxuryDeepHouse #DeepElectronicMusic #HouseMusic2027 #BestSummerMusic #IbizaMusic #4KUHDMusic #SummerChillMix #TropicalMusicMix #DeepHouseRelax #ChilloutMusic #SummerPartyMix #IbizaNightlife #TropicalBeachMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395813/3395813_720p.mp4</video:content_loc>
      <video:duration>199</video:duration>
      <video:publication_date>2026-09-02T00:06:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395812</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395812/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RAZÃO PARA VIVER | Rock Romântico Emocional Oficial 🎸❤️</video:title>
      <video:description>🎸 &quot;Razão Para Viver&quot; é uma canção sobre encontrar luz quando tudo parecia perdido. Às vezes a vida nos leva por caminhos difíceis, cheios de cicatrizes, despedidas e momentos de solidão. Mas existem pessoas que chegam para mudar tudo, trazendo de volta a esperança, os sonhos e a vontade de seguir em frente. Essa música fala sobre aquele amor que se torna abrigo, força e inspiração. Aquela pessoa que transforma dias difíceis em motivos para continuar lutando. Se essa música tocou seu coração, deixe seu like, compartilhe com alguém especial e se inscreva no canal para acompanhar os próximos lançamentos. 🎸 Bem-vindo ao Leo em Acordes. ❤️ Música: Razão Para Viver 🎤 Estilo: Rock Romântico Emocional 🎼 Tema: Amor, Esperança, Recomeço e Superação #RazaoParaViverRockRomanticoMusicaRomanticaRockEmocionalLeoEmAcordesLoveSongRockBalladMusicaDeAmorRockNacionalEmocional</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395812/3395812_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-02T00:06:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395811</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395811/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TRATANDO MINHA ESPOSA BEM!</video:title>
      <video:description>Caramelo cuidando da esposa #Resenha #diversão #ia #alegria #humor #desnho #videosengraçados #cachorro #dog</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395811/3395811_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-02T00:06:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395810</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395810/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Math questions 2</video:title>
      <video:description>#math #matematica #desafio #numeros #escola</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395810/3395810_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-02T00:06:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395809</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395809/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Aquele pão caseiro</video:title>
      <video:description>Será que ficou bom</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395809/3395809_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-02T00:05:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395808</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395808/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Psychology of Money: Behavior Over Intelligence</video:title>
      <video:description>This text presents a detailed summary of the book Financial Psychology. #financas #canaldefinancas #dicasdefinancas #financaspessoais #livrosdefinancas #organizarfinancas #organizarasfinancas #financasparamulheres #aulafinancaspessoais #comoorganizarfinancas #organizarfinancascasal #financasparainiciantes #aulafacilsobrefinancas #financaspessoaisbrasil #financaseinvestimentos #financaspessoaisdozero #comoorganizarasfinancas #financascomportamentais #dicasdefinancaspessoais #fasesdasfinancaspessoais #aulacompletasobrefinancas #comoorganizarsuasfinancas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395808/3395808_720p.mp4</video:content_loc>
      <video:duration>627</video:duration>
      <video:publication_date>2026-09-02T00:05:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395807</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395807/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>**Esse Quarto Vazio Ainda Tá Cheio de Você | Rock Romântico Emocional**</video:title>
      <video:description>🎸Um quarto vazio… mas cheio de lembranças. **“Quarto Vazio”** é sobre amar sozinho, perder sem entender e aprender a conviver com a saudade. Se essa música falou com você, deixa seu like, comenta sua história e se inscreve no canal pra fortalecer o rock romântico emocional. Obrigado por ouvir.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395807/3395807_720p.mp4</video:content_loc>
      <video:duration>221</video:duration>
      <video:publication_date>2026-09-02T00:05:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395806</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395806/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Molly tira o brinquedo de Ruby    Ou vice-versa...</video:title>
      <video:description>Molly tira o brinquedo de Ruby Ou vice-versa...</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395806/3395806_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-02T00:05:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395805</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395805/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vento</video:title>
      <video:description>#Vento #frio #poeira</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395805/3395805_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T00:05:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395804</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395804/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minha pequena 😍😍😍</video:title>
      <video:description>Minha pequena mais e linda viu 😻</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395804/3395804_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-02T00:04:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395803</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395803/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>فيديو 48</video:title>
      <video:description>فيديو #فيديو</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395803/3395803_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T00:04:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395802</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395802/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tudo Por Você - Rock Romântico Emocional -  arena rock dos anos 80 (Clipe Oficial Anime)</video:title>
      <video:description>🎸 Às vezes, as palavras não são suficientes para expressar o que sentimos por quem amamos. &quot;Tudo Por Você&quot; é mais do que uma música; é uma promessa em forma de acordes. Preparei essa balada no melhor estilo do rock melódico e romântico para quem sabe o valor de uma entrega verdadeira. Se essa música em português tocou seu coração, se inscreva no canal Leo em Acordes e ative o sininho para não perder nenhuma novidade! --- 🎵 Ouça minhas músicas nas plataformas digitais: https://www.soundon.global 📱 Siga o canal Leo em acordes: https://www.youtube.com/@leoemacordes #RockRomanticoBaladaRockMusicaEmocionalLeoEmAcordesTudoPorVoceRockNacionalAnimeMusicVideo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395802/3395802_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-02T00:04:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395801</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395801/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carro Novo do Pai: Surpresa Emocionante Revelada!</video:title>
      <video:description>Então vamos pegar a ração vamos entrar com o veículo aí já mostra o carro novo do pai aí É isso aí Já tratou desde hoje Já comeram Já hoje já Hoje foi de manhã. #BiteloMotivacaoAcademiaMusculacaoFoco</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395801/3395801_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-02T00:04:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395800</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395800/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TICK TOC - DJ LKS RIT INTERNACIONAL</video:title>
      <video:description>TICK TOC - DJ LKS RIT INTERNACIONAL #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusi</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395800/3395800_720p.mp4</video:content_loc>
      <video:duration>183</video:duration>
      <video:publication_date>2026-09-02T00:04:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395799</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395799/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Indo ver o chou</video:title>
      <video:description>Estão com pressa para assistir o chou #Amigos #animes #humor</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395799/3395799_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:04:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395798</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395798/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Confissões em Volume Máximo -Leo em acordes (Álbum Completo / 2 Músicas Inéditas - Rock Romântico )</video:title>
      <video:description>🎸 Está oficialmente lançado! Ouça agora &quot;Confissões em Volume Máximo&quot;, o álbum completo do canal Leo em acordes! Reuni neste projeto 9 faixas que carregam a pura essência do Rock Romântico e Emocional, incluindo 2 MÚSICAS TOTALMENTE INÉDITAS que vocês nunca ouviram aqui no canal! Preparem os fones de ouvido para uma jornada intensa de sentimentos, guitarras marcantes e muita energia. Deixe seu like, comente qual é a sua faixa favorita e compartilhe o álbum com quem respira Rock de verdade! ⏱️ TRACKLIST / MINUTAGEM DO ÁLBUM: 00:00 01. Só Você (Inédita) 03:30 02. Tudo por Você 07:00 03. Porque Ainda Estou Aqui 10:30 04. Razão para Viver 14:00 05. O Silêncio Vai Dizer o Resto 17:30 06. Ainda Existe Esperança 21:00 07. Vou Correr Pra Você (Inédita) 24:30 08. Te Encontro nos Meus Sonhos 28:00 09. Sem Você Aqui (Nota: Você pode ajustar os minutos exatos assim que subir o arquivo final de áudio!) 🎧 OUÇA TAMBÉM NAS PLATAFORMAS DIGITAIS: 🔊 Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ 📺 CONHEÇA NOSSOS CANAIS PARCEIROS: 🎸 Leo em acordes: http://www.youtube.com/@leoemacordes ⚡ Sonic Storm: https://youtube.com/@SonicStorm22?si=toExCL5U3xZC12L6 🦅 Alma Blindada: https://youtube.com/@blindada2205?si=Ucs9JdtPr26rVksh 🎯 Ficha Técnica: Composição, Voz e Produção: Leo em acordes Gênero: Rock Romântico / Rock Emocional #LeoEmAcordesConfissoesEmVolumeMaximoAlbumCompletoRockRomanticoRock80sRockNacionalNewAlbumSonicStormAlmaBlindada</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395798/3395798_720p.mp4</video:content_loc>
      <video:duration>1713</video:duration>
      <video:publication_date>2026-09-02T00:04:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395797</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395797/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES: A GUERRA BRUTAL NO OCEANO PROFUNDO ONDE SÓ OS MAIS FORTES  SOBREVIVEM.</video:title>
      <video:description>REINO DOS TUBARÕES: Guerra Brutal no OCEANO PROFUNDO Onde Só os Mais FORTES Sobrevivem DOCUMENTÁRIO #oceano #vidamarinha #animais #natureza #documentario #mundoselvagem #tubarao #orca #baleia #deepocean #animalplanet #naturewild #oceanoProfundo O oceano parece calmo… mas essa é a maior ilusão da natureza. Debaixo da superfície, existe uma guerra constante pela sobrevivência. Predadores silenciosos, gigantes colossais e criaturas incrivelmente inteligentes disputam espaço em um dos ambientes mais extremos do planeta. Neste documentário, você vai mergulhar em um mundo onde: * A força não é tudo * A inteligência pode decidir o destino * E a união pode ser a única chance de sobreviver De caçadores solitários a estratégias em grupo impressionantes, cada criatura revela um lado brutal e fascinante da vida marinha. Mas a verdadeira pergunta é: **quem realmente domina o oceano?** Assista até o final… porque a resposta pode mudar completamente a forma como você enxerga a natureza. 🔥 **PARTICIPE DO VÍDEO:** Quero saber sua opinião 👇 👉 Qual criatura você acha mais impressionante? 👉 Você acredita que a sobrevivência depende mais de força ou inteligência? 👉 Já viveu alguma situação onde teve que se adaptar rápido para sobreviver? Comenta aí — eu leio tudo. 🌊 **INSCREVA-SE NO CANAL:** Se você gosta de conteúdos sobre natureza selvagem, mistérios do oceano e histórias reais que desafiam a lógica… esse canal é pra você. Se inscreve e ativa o sininho 🔔 pra não perder os próximos vídeos — aqui, cada conteúdo é uma nova descoberta. ⚠️ **IMPORTANTE:** Este vídeo tem fins educativos e informativos, baseado em comportamentos reais da vida marinha. #oceano #oceanoprofundo #vidamarinha #animaismarinhos #predadoresdooceano #tubarãobranco #orca #baleiaazul #baleiajubarte #golfinhoscaça #sobreviv</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395797/3395797_720p.mp4</video:content_loc>
      <video:duration>1213</video:duration>
      <video:publication_date>2026-09-02T00:03:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395796</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395796/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mistério 2</video:title>
      <video:description>Mágico</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395796/3395796_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-02T00:03:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395795</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395795/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chords plays</video:title>
      <video:description>Beaultiful chords progression #chords #guitar #electric #solo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395795/3395795_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-02T00:03:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395794</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395794/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>beautiful blonde has fun on the tobogan has fun on the tobogan</video:title>
      <video:description>beautiful blonde has fun on the tobogan #beautifulblondehasfunonthetobogan</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395794/3395794_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T00:03:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395793</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395793/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>One Piece - Wano Season Opening</video:title>
      <video:description>#mundo #luffy #anime #chapeudepalha</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395793/3395793_720p.mp4</video:content_loc>
      <video:duration>148</video:duration>
      <video:publication_date>2026-09-02T00:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395792</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395792/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ranking funniest ball moment</video:title>
      <video:description>Ranking funniest ball moment #ranking #shorts #usa #funny #trollface #cook</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395792/3395792_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-02T00:03:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395791</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395791/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminhão 2</video:title>
      <video:description>#Caminhão #balsa #rio</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395791/3395791_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T00:02:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395790</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395790/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LYRICAL: Love Mera Hit Hit | Billu | Shahrukh Khan, Deepika Padukone | Neeraj Shridhar, Tulsi Kumar</video:title>
      <video:description>Presenting the lyrical video of the song &quot;Love Mera Hit Hit&quot; from the Bollywood movie Billu. The movie stars Irrfan Khan and Lara Dutta in the lead roles and features Shah Rukh Khan, Om Puri, Rajpal Yadav and Asrani in supporting roles and Kareena Kapoor Khan, Deepika Padukone and Priyanka Chopra makes guest appearances in item numbers. Just keep giving us your love and keep listening to T-Series. #lyricallovehitbillushahrukh</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395790/3395790_720p.mp4</video:content_loc>
      <video:duration>307</video:duration>
      <video:publication_date>2026-09-02T00:02:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395789</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395789/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>...Se Entrega.</video:title>
      <video:description>Quem precisa provar, já perdeu o controle. O forte não anuncia seus próximos passos. Observa. Calcula. Espera. Age. O lobo não avisa quando vai aparecer. Ele simplesmente aparece. Silêncio também é poder. 🐺♟️ WYAN VEX Controle • Disciplina • Domínio #WaynVexControleDisciplinaDominioFocoMentalidade</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395789/3395789_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-02T00:02:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395788</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395788/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GUIA-ME, SENHOR 🙏😭 | Louvor Profundo Para Quem Precisa de Uma Direção</video:title>
      <video:description>“Guia-me, Senhor” é um louvor profundo para quem precisa de uma resposta, uma direção e forças para continuar caminhando. Mesmo quando você não consegue enxergar o caminho, Deus permanece ao seu lado. Ele pode fechar portas para protegê-lo, abrir novos caminhos e conduzir sua vida segundo a vontade d’Ele. Ouça esta canção em oração e entregue seus planos nas mãos do Senhor. Deus conhece suas lágrimas e não deixará você caminhar sozinho. 🙏 Declare nos comentários: “Senhor, guia os meus passos!” 👍 Deixe seu gostei 🔔 Inscreva-se no canal 📲 Compartilhe com alguém que precisa de uma direção de Deus</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395788/3395788_720p.mp4</video:content_loc>
      <video:duration>480</video:duration>
      <video:publication_date>2026-09-02T00:02:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395787</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395787/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ERUPÇÃO - ERUPTION</video:title>
      <video:description>Conta uma história de regresso de exploradores espaciais ao planeta terra.... *&quot;Tell a story about space explorers returning to planet Earth.....&quot;* *Letra - ERUPÇÃO* Me entrego!!!! Deixo ir!!!! Como vai esta viagem para você?..... Estamos a caminho de casa... Este bólido tem as coordenadas para chegar... Mas, não vamos dormir... Assim vamos balançar até lá..... Deixar o sangue e as ideias fluírem... Onde está a gravidade?? De cabeça para baixo... Tenho outra perspectiva de você... Sinta a temperatura subir!! Estamos derretendo entrando na órbita!! Apenas deixe a erupção sair... Já não faz diferençaaaaa... Depois de anos na velocidade da luz... Ninguém sequer saberá quem somos nós!! Só estamos voltando para a eternidade!! Diga somente nosso nome..... Mande a breve mensagem.... Antes do último reator explodir!!!! Deixamos nossa missão lá atrás... Foi cumprida!!!! Alguém precisará voltar.... E saber!!!!! .... Se os Cães conseguiram?? *LYRICS - ERUPTION* I surrender!!!! I let go!!!! How is this trip for you?..... We are on our way home... This bullet has the coordinates to get there... But we&apos;re not going to sleep... So we&apos;re gonna swing all the way there..... Let the blood and the ideas flow... Where is the gravity?? Upside down... I have a different perspective of you... Feel the temperature rise!! We are melting entering orbit!! Just let the eruption out... It doesn&apos;t make a difference anymoreeeee... After years at light speed... No one will even know who we are!! We are just returning to eternity!! Just say our name..... Send the brief message.... Before the last reactor explodes!!!! We left our mission behind... It was accomplished!!!! Someone will need to come back.... And know!!!!! .... If the Dogs made it?? #viagem #galáxia #dança #dormir #balançar #ideias #gravidad</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395787/3395787_720p.mp4</video:content_loc>
      <video:duration>360</video:duration>
      <video:publication_date>2026-09-02T00:02:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395786</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395786/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I&apos;VE BEEN CRYING FOR A WHILE NOW - DJ LKS RIT INTERNACIONAL</video:title>
      <video:description>I&apos;VE BEEN CRYING FOR A WHILE NOW - DJ LKS RIT INTERNACIONAL #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395786/3395786_720p.mp4</video:content_loc>
      <video:duration>199</video:duration>
      <video:publication_date>2026-09-02T00:02:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395785</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395785/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful blonde babe</video:title>
      <video:description>Beautiful blonde babe latina brazilian #blondelatina</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395785/3395785_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-02T00:02:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395784</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395784/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 113</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395784/3395784_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-02T00:02:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395783</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395783/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Só Você (Clipe Oficial) | Rock romântico Emocional</video:title>
      <video:description>🎸Descubra o novo single &quot;Só Você&quot;, uma composição do projeto Echo Riot que traz a essência do Rock Emocional para falar de saudade, encontros e esperança sob o céu cinzento. Se você gosta de uma melodia que toca a alma e uma história que se conecta com a sua, este clipe é para você. Ouça &quot;Só Você&quot; nas plataformas digitais: Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ Siga o Leo em Acordes: 📺 Inscreva-se: http://www.youtube.com/@leoemacordes Letra/ &quot;so você (pop rock ) \[Verso 1] Eu ando perdido em silêncio Tentando entender quem sou Te olho de longe e me escondo Com medo de mostrar o amor \[Pré-Refrão] E se eu disser que penso em você Mesmo sem ter o direito de ter? \[Refrão] Porque eu só queria que você me enxergasse Mesmo que fosse só por um olhar Não quero que o mundo saiba o que eu sinto É só você que precisa escutar E se o tempo for cruel com a gente Prometo não deixar de esperar Porque tudo em mim grita seu nome Mesmo sem poder te tocar \[Verso 2] Os dias parecem vazios Quando não vejo você sorrir Eu finjo que tudo está calmo Mas por dentro é só por ti \[Pré-Refrão] E se eu sumir no meio da dor Será que você vai notar o amor? \[Refrão] Porque eu só queria que você me enxergasse Mesmo que fosse só por um olhar Não quero que o mundo saiba o que eu sinto É só você que precisa escutar E se o tempo for cruel com a gente Prometo não deixar de esperar Porque tudo em mim grita seu nome Mesmo sem poder te tocar \[Ponte] Se um dia a vida nos afastar Guarde em si meu jeito de amar Nada vai apagar \[Refrão Final] Porque eu só queria que você me enxergasse Só você… só você…, Pop Rock, Romantic, Male Voice #EchoRiotSoVoceRockEmocionalLancamentoMusicalLeoEmAcordesRockNacional</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395783/3395783_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-09-02T00:01:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395782</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395782/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Still got this notes</video:title>
      <video:description>You can get these notes? #guitar #solo #play #music #blues #rock #distortion</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395782/3395782_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-02T00:01:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395781</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395781/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia de vacinação!</video:title>
      <video:description>A esposa do caramelo chama ele pra sair, não sabendo ele que ela esta chama para o veterinário. #Humor #desenho #alegria #cachorro #ia #diversão #Viral #virais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395781/3395781_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-02T00:01:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395779</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395779/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SÓ VOCÊ (Versão em Inglês) - Only You | Leo em Acordes 🎸</video:title>
      <video:description>Muita gente me pediu para explorar a sonoridade desse som em inglês! 🌍🎸 &quot;ONLY YOU&quot; é a versão internacional de &quot;SÓ VOCÊ&quot;. Decidi trazer essa versão para vocês aqui no canal porque a emoção desse Rock, inspirada na força de bandas como Linkin Park, ganha uma nova vida e uma intensidade diferente nessa língua. Você já conhece a versão original em português? Assista aqui: https://youtu.be/PaGYhQYqWMo O que vocês acharam dessa adaptação? A essência do sentimento continua a mesma? Deixem aí nos comentários! 🎧 Ouça também no Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ ⚡ Siga também o Sonic Storm para mais sons em inglês: https://youtube.com/@SonicStorm22 🦅 Siga o Alma Blindada: https://youtube.com/@blindada2205 #LeoEmAcordesOnlyYouSóVocêRockVersaoVersaoInglesLinkinParkStyleMusicaAutoral</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395779/3395779_720p.mp4</video:content_loc>
      <video:duration>176</video:duration>
      <video:publication_date>2026-09-02T00:01:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395778</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395778/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cerveja</video:title>
      <video:description>#Cerveja #vontade</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395778/3395778_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-02T00:00:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395777</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395777/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Adventure journey.</video:title>
      <video:description>This shows how the journey of Daniel and prince(his guard lion) were going through the forest of the unknown. #Adventure #Africanstorytelling #movies #journey</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395777/3395777_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-02T00:00:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395776</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395776/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SE SUA MENTE NÃO PARA A NOITE, FAÇA ESSA ORAÇÃO DE 1 MINUTO</video:title>
      <video:description>#reellsviral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395776/3395776_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-02T00:00:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395775</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395775/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vou Correr Pra Você - Leo em acordes (Rock Romântico Anos 80)</video:title>
      <video:description>🎸 Bem-vindos ao clipe oficial de &quot;Vou Correr Pra Você&quot;, o novo lançamento do canal Leo em acordes! Uma balada de Rock Romântico com a essência e a energia marcante dos anos 80. A letra conta a história intensa de um coração dividido, do peso da noite e da urgência de correr para o colo de quem a gente realmente ama. Deixe-se levar pelos riffs de guitarra, pela voz marcante e pela emoção pura dessa produção. Se você se identificou com essa história, deixe seu like, comente o que achou e compartilhe com aquela pessoa especial! 🎧 OUÇA NAS PLATAFORMAS DIGITAIS: 🔊 Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ 📺 INSCREVA-SE NO CANAL: 👉 YouTube: http://www.youtube.com/@leoemacordes ✍️ LETRA DA MÚSICA: [Verse 1] Ela diz que o seu amor nunca vai morrer Mas tudo muda se ela descobrir sobre eu e você Ela diz que me ama, que o seu mundo sou eu Mas ela não sabe que meu coração já se perdeu [Pre-Chorus] É um vício difícil de largar Tem coisas que um coração não vai aguentar O ciúme vai deixar ela louca, eu sei Mas você é o melhor amor que eu já encontrei [Chorus: High Energy, Powerful Vocals] E no meio da noite, quando o frio chegar Eu vou correr pra você, eu vou te buscar! Se o desejo bater, a noite inteira eu vou Correr pra você, viver esse amor! [Verse 2] Ela tem um bom coração, nunca me deixou só Mas você me incendeia, dá um nó no meu nó O amor dela é real, mas o seu tem mais cor É fácil demais nos teus braços fazer amor Minha mente aceitou, não dá mais pra negar Desse seu amor eu não posso escapar [Chorus: High Energy] E no meio da noite, quando o frio chegar Eu vou correr pra você, eu vou te buscar! Se o desejo bater, a noite inteira eu vou Correr pra você, viver esse amor! [Guitar Solo: Melodic and Powerful, 80s Style] [Chorus: Full Energy, Climactic] E no me</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395775/3395775_720p.mp4</video:content_loc>
      <video:duration>162</video:duration>
      <video:publication_date>2026-09-02T00:00:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395774</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395774/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pedra Pirite espelho de Falha.</video:title>
      <video:description>Pedra Pirite espelho de Falha Portugal. Bem vindos ao meu canal. Obrigado por assistir 😊. #Pedras #pedra #cristais #cristal #mineral #rocha #piritePe</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395774/3395774_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T23:59:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395773</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395773/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HERO OR VILAN - DJ LKS RIT INTERNACIONAL</video:title>
      <video:description>#popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395773/3395773_720p.mp4</video:content_loc>
      <video:duration>218</video:duration>
      <video:publication_date>2026-09-01T23:59:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395772</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395772/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carro 6</video:title>
      <video:description>#Carro #fogo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395772/3395772_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T23:59:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395771</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395771/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A sweet solo for mine child</video:title>
      <video:description>Its amazing #guitar #solo #sweet #slash #rock #grunge #wow</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395771/3395771_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T23:59:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395770</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395770/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>RESSUREIÇÃO DE CRISTO</video:title>
      <video:description>#ressureição #biblianarrada #fe #deus</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395770/3395770_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T23:59:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395769</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395769/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WILD AMAZON | A Forest That Never Sleeps_PART 7/7</video:title>
      <video:description>The Amazon Rainforest holds secrets that science has barely begun to unravel. In this 4K documentary, you will venture into the planet&apos;s largest tropical rainforest—where the jaguar rules the shadows, the green anaconda glides silently through dark waters, and the poison dart frog carries enough venom to paralyze a creature. #BRAZIL #AmazonRainforest #planetslargesttropicalrainforest</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395769/3395769_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T23:59:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395768</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395768/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WILD AMAZON | A Forest That Never Sleeps_PART 6/7</video:title>
      <video:description>The Amazon Rainforest holds secrets that science has barely begun to unravel. In this 4K documentary, you will venture into the planet&apos;s largest tropical rainforest—where the jaguar rules the shadows, the green anaconda glides silently through dark waters, and the poison dart frog carries enough venom to paralyze a creature. #BRAZIL #AmazonRainforest #planetslargesttropicalrainforest</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395768/3395768_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T23:59:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395767</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395767/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>akuma gameplay part1 street fighter 3rd strike</video:title>
      <video:description>primeira parte do meu treinamento de akuma, me deem dicas e mais #cammyretrogamerfightmartialartsmmafightinggamecommunitygamesnksfvakumaretrogamesrkickboxingfighterretrocapcomvssnkkenguilekofvideogamekingoffighterssegaufcpicofthedayxboxstreetfightsarcadegamesmtzbikelife</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395767/3395767_720p.mp4</video:content_loc>
      <video:duration>226</video:duration>
      <video:publication_date>2026-09-01T23:59:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395766</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395766/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WILD AMAZON | A Forest That Never Sleeps_PART 5/7</video:title>
      <video:description>The Amazon Rainforest holds secrets that science has barely begun to unravel. In this 4K documentary, you will venture into the planet&apos;s largest tropical rainforest—where the jaguar rules the shadows, the green anaconda glides silently through dark waters, and the poison dart frog carries enough venom to paralyze a creature. #BRAZIL #AmazonRainforest #planetslargesttropicalrainforest</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395766/3395766_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-01T23:59:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395765</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395765/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WILD AMAZON | A Forest That Never Sleeps_PART 4/7</video:title>
      <video:description>The Amazon Rainforest holds secrets that science has barely begun to unravel. In this 4K documentary, you will venture into the planet&apos;s largest tropical rainforest—where the jaguar rules the shadows, the green anaconda glides silently through dark waters, and the poison dart frog carries enough venom to paralyze a creature. #BRAZIL #AmazonRainforest #planetslargesttropicalrainforest</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395765/3395765_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T23:59:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395764</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395764/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WILD AMAZON | A Forest That Never Sleeps_PART 3/7</video:title>
      <video:description>The Amazon Rainforest holds secrets that science has barely begun to unravel. In this 4K documentary, you will venture into the planet&apos;s largest tropical rainforest—where the jaguar rules the shadows, the green anaconda glides silently through dark waters, and the poison dart frog carries enough venom to paralyze a creature. #BRAZIL #AmazonRainforest #planetslargesttropicalrainforest</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395764/3395764_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T23:59:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395763</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395763/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Istanbullu Gelin _ Bride of Istanbul - Episode 13 English Subtitle</video:title>
      <video:description>Istanbullu Gelin _ Bride of Istanbul - Episode 13 English Subtitle #BrideofIstanbul</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395763/3395763_720p.mp4</video:content_loc>
      <video:duration>2732</video:duration>
      <video:publication_date>2026-09-01T23:59:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395762</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395762/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WILD AMAZON | A Forest That Never Sleeps_PART 2/7</video:title>
      <video:description>The Amazon Rainforest holds secrets that science has barely begun to unravel. In this 4K documentary, you will venture into the planet&apos;s largest tropical rainforest—where the jaguar rules the shadows, the green anaconda glides silently through dark waters, and the poison dart frog carries enough venom to paralyze a creature. #BRAZIL #AmazonRainforest #planetslargesttropicalrainforest</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395762/3395762_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T23:59:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395761</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395761/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WILD AMAZON | A Forest That Never Sleeps_ PART 1/7</video:title>
      <video:description>The Amazon Rainforest holds secrets that science has barely begun to unravel. In this 4K documentary, you will venture into the planet&apos;s largest tropical rainforest—where the jaguar rules the shadows, the green anaconda glides silently through dark waters, and the poison dart frog carries enough venom to paralyze a creature. #BRAZIL #AmazonRainforest #planetslargesttropicalrainforest</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395761/3395761_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T23:59:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395760</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395760/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_60.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_60.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395760/3395760_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:59:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395759</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395759/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Culpa É de Nós Dois - Leo em Acordes (Rock Romântico Emocional)</video:title>
      <video:description>🎸 &quot;A culpa não é de um só, é de nós dois.&quot; 🎸 Muitas vezes, o amor se perde no silêncio e nas feridas do orgulho. Esta é uma canção sobre o reconhecimento de que, mesmo quando uma história chega ao fim, o impacto que ela deixou nunca se apaga. 🎵 A Culpa É de Nós Dois Gênero: Rock Romântico Emocional Artista: Leo em Acordes Gostou dessa música? Deixe seu like e inscreva-se para mais lançamentos que tocam a alma! 🎧 Ouça nas plataformas digitais: Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ 📺 Conheça meus outros projetos: Leo em Acordes: http://www.youtube.com/@leoemacordes Sonic Storm: https://youtube.com/@SonicStorm22 Alma Blindada: https://youtube.com/@blindada2205 #RockRomanticoLeoEmAcordesRockEmocionalMusicaAutoralACulpaEDeNosDois</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395759/3395759_720p.mp4</video:content_loc>
      <video:duration>183</video:duration>
      <video:publication_date>2026-09-01T23:59:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395758</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395758/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_59.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_59.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395758/3395758_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:58:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395757</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395757/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Blues Pra Quem? (Cezar Rodriguez)</video:title>
      <video:description>Há pouco voltei do inferno sangrando perdi a batalha As cicatrizes que herdei serão minhas novas armas Não que eu tenha mudado só ajustei alguns pontos fracos Hoje mais forte que ontem sou a onda que vira o barco Veja o submundo lhe adora sei que você é uma raposa e eu filhote de ovelha esperando minha hora Seja o que a patota lhe implora Disfarce o sangue nos olhos seja herói ao bater em minha Eu pago pra ver o que vira depois Você contando seus casos esperando que o mundo mude Me da a certeza que sempre haverá algo que me faça ser rude Hoje mais forte que ontem falo com muito mais certeza Que com o pouco que sei posso mudar tudo que não me enlouqueça Mudando alguns certos parâmetros ignorando certas fortalezas Posso voltar ao inferno rescrever tudo que me aborreça Veja a malandragem me ignora Sei que espreitando os cordeiros a sempre um lobo com a linga de fora Creia a memória é uma incógnita Diga o que acha que sabe eu lhe direi o que penso por hora Eu pago pra ver o que vira depois Veja entre nós há uma rocha Você me acha um covarde e eu te acho tão besta com o cu de fora Cresça que o mundo lhe adota Fara de você um exemplo com dotes impecáveis que o júri aprova Mas eu sempre vou lhe reconhecer #Blues #Rock</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395757/3395757_720p.mp4</video:content_loc>
      <video:duration>283</video:duration>
      <video:publication_date>2026-09-01T23:58:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395756</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395756/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_58.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_58.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395756/3395756_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:58:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395755</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395755/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Casamento 4</video:title>
      <video:description>#Casamento #carro #Fusca</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395755/3395755_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T23:58:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395754</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395754/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 Minuto Animal_ INACREDITÁVEL ... #animals #aves</video:title>
      <video:description>1 Minuto Animal_ INACREDITÁVEL ... #animals #aves #animais</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395754/3395754_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T23:58:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395753</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395753/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_57.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_57.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395753/3395753_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:58:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395752</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395752/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ECOS DE VOCÊ - Leo em Acordes (Versão Original em Português | Emotional Rock)</video:title>
      <video:description>🎸A música fala sobre o que fica quando alguém se vai. Escrevi &quot;Ecos de Você&quot; para traduzir esse vazio que, às vezes, a gente só consegue explicar com acordes. 🎸 Esta é a versão original em português, feita com toda a alma aqui para o canal Leo em Acordes. Se você se identificou com essa letra, deixa seu comentário aqui embaixo. Isso fortalece muito o nosso trabalho autoral. 🎧 Ouça também nas plataformas: 📺 YouTube Oficial: http://www.youtube.com/@leoemacordes https://youtube.com/@SonicStorm22?si=toExCL5U3xZC12L6 https://youtube.com/@blindada2205?si=Ucs9JdtPr26rVksh 🎧 Ouça nas plataformas digitais: Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ 🦅 Acompanhe o projeto Sonic Storm: https://youtube.com/@SonicStorm22 🦅 Inscreva-se no Leo em Acordes: https://youtube.com/@leolem-acordes #LeoEmAcordesEcosDeVoceRockNacionalRockEmocionalMusicaAutoralLancamento2026</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395752/3395752_720p.mp4</video:content_loc>
      <video:duration>183</video:duration>
      <video:publication_date>2026-09-01T23:58:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395751</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395751/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>HELPE ME - DJ LKS RIT INTERNACIONAL</video:title>
      <video:description>HELPE ME - DJ LKS RIT INTERNACIONAL #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395751/3395751_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-09-01T23:58:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395750</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395750/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_56.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_56.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395750/3395750_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:58:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395749</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395749/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ponto de ônibus e Rua.</video:title>
      <video:description>🔥 Corte exclusivo do canal oficial de Pablo Marçal Todos os direitos reservados ao canal original: 👉 https://www.youtube.com/@pablomarcall Este é um vídeo de cortes feito com o objetivo de destacar os melhores momentos e mensagens de impacto. Não somos o canal oficial. Todo o conteúdo pertence ao Pablo Marçal e sua equipe. ✅ Inscreva-se no canal original para não perder nenhuma live e conteúdo completo: https://www.youtube.com/@pablomarcall Se você gostou do corte, deixa o like, comenta e compartilha!</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395749/3395749_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T23:57:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395748</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395748/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Beautiful Breaking Glass Bottles crushing asmr | ¡QUÉ BONITO ES ROMPER BOTELLAS DE CRISTAL!  SONID</video:title>
      <video:description>#asmr #bottles #breaking #romper #botellas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395748/3395748_720p.mp4</video:content_loc>
      <video:duration>262</video:duration>
      <video:publication_date>2026-09-01T23:57:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395747</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395747/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Istanbullu Gelin _ Bride of Istanbul - Episode 12 English Subtitle</video:title>
      <video:description>Istanbullu Gelin _ Bride of Istanbul - Episode 12 English Subtitle #BrideofIstanbul</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395747/3395747_720p.mp4</video:content_loc>
      <video:duration>2745</video:duration>
      <video:publication_date>2026-09-01T23:57:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395746</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395746/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_55.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_55.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395746/3395746_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:57:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395745</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395745/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O café da manhã está pronto</video:title>
      <video:description>Se liga na piadas do xaxa #Comediam</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395745/3395745_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T23:57:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395743</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395743/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_54.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_54.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395743/3395743_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:57:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395742</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395742/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_53.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_53.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395742/3395742_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:57:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395741</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395741/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você foi minha luz, mesmo sem paredes para ficar | VOCÊ FOI MINHA PAZ</video:title>
      <video:description>🎸 &quot;Às vezes, a gente só percebe que teve o mundo nas mãos quando ele escapa pelos dedos. &apos;Você Foi Minha Paz&apos; é uma composição autoral sobre o reconhecimento tardio, sobre o orgulho que separa caminhos e sobre aquele amor que, mesmo depois de quebrado, continua vivo dentro da gente. Esta é uma canção para quem já teve um abrigo, uma voz que acalmou o caos e uma luz que brilhou mesmo nos dias mais escuros. 📌 Inscreva-se no Leo em acordes: http://www.youtube.com/@leoemacordes 🎧 Ouça no Spotify: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ Acompanhe também meus outros projetos: 🦅 Alma Blindada: https://youtube.com/@blindada2205 ⚡ Sonic Storm: https://youtube.com/@SonicStorm22 Deixa nos comentários: qual parte dessa letra tocou a sua alma hoje? Vamos conversar. #LeoEmAcordesRockRomanticoMusicaAutoralVoceFoiMinhaPazPowerBallad</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395741/3395741_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-01T23:57:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395740</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395740/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Perfeição da Criação de Deus: Cachoeiras e Paisagens Feitas pelas Mãos do Criador🙏</video:title>
      <video:description>Neste vídeo contemplamos a grandiosidade e a perfeição da criação de Deus. Testemunha a beleza e a perfeição que só Deus poderia criar. Uma verdadeira celebração da natureza como reflexo da glória divina..🙏 #CriacaoDeDeus #NaturezaSagrada #PerfeicaoDivina</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395740/3395740_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T23:57:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395739</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395739/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ela tomou coragem e foi a luta</video:title>
      <video:description>Ela tomou coragem e foi a luta #dorama #kdrama #séries #filmes #Netflix</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395739/3395739_720p.mp4</video:content_loc>
      <video:duration>152</video:duration>
      <video:publication_date>2026-09-01T23:57:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395738</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395738/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_52.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_52.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395738/3395738_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:56:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395737</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395737/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>𝗔 𝘀𝗶𝗻𝗴𝘂𝗹𝗮𝗿𝗶𝗱𝗮𝗱𝗲 𝘃𝗮𝗶 𝘁𝗲 𝗽𝗲𝗴𝗮𝗿?</video:title>
      <video:description>𝘖 𝘨𝘰𝘷𝘦𝘳𝘯𝘰 𝘦𝘴𝘵á 𝘢𝘵𝘳á𝘴 𝘥𝘰 𝘴𝘦𝘶 𝘥𝘪𝘯𝘩𝘦𝘪𝘳𝘰, 𝘴𝘦𝘫𝘢 𝘷𝘰𝘤ê 𝘱𝘰𝘣𝘳𝘦 𝘰𝘶 𝘮𝘪𝘭𝘪𝘰𝘯á𝘳𝘪𝘰? Para todo problema, existe uma 𝘀𝗼𝗹𝘂çã𝗼 𝘦𝘭𝘦𝘨𝘢𝘯𝘵𝘦 e que pode ser a diferença entre a ruína e uma 𝘃𝗶𝗱𝗮 𝗽𝗹𝗲𝗻𝗮. Comece tirando o país do s͟e͟u d͟i͟n͟h͟e͟i͟r͟o, mais fácil que tirar seu dinheiro do país. Com a 𝗗𝗲𝗙𝗹𝗼𝘄, você tem solução de recebimentos que transforma Real para stablecoins ou bitcoin de forma direta, 𝘀𝗲𝗴𝘂𝗿𝗮 e sem complicação. Ao se registrar gratuitamente use o 𝗰𝘂𝗽𝗼𝗺 𝗠𝗘𝗨𝗗𝗘𝗦𝗖𝗢𝗡𝗧𝗢 para ganhar descontos exclusivos em qualquer serviço na plataforma e fazer seu dinheiro valer cada vez mais. P𝘳𝘰𝘤𝘶𝘳𝘦 𝘯𝘰 𝘎𝘰𝘰𝘨𝘭𝘦: DeFlow Exchange E depois use o cupom &quot;MEUDESCONTO&quot;. Explicações de como funciona, na própria plataforma. Dúvidas, fale conosco. 𝘌 𝘴𝘦 𝘲𝘶𝘪𝘴𝘦𝘳 𝘤𝘰𝘮𝘱𝘳𝘢𝘳 𝘣𝘪𝘵𝘤𝘰𝘪𝘯 𝘰𝘶 𝘥ó𝘭𝘢𝘳 𝘤𝘰𝘮 𝘴𝘦𝘨𝘶𝘳𝘢𝘯ç𝘢, 𝘢𝘣𝘳𝘢 𝘶𝘮𝘢 𝘤𝘰𝘯𝘵𝘢 𝘯𝘢 𝘉𝘐𝘗𝘈 𝘤𝘰𝘮 𝘰 𝘤ó𝘥𝘪𝘨𝘰 𝘒𝘡𝘛𝘍𝘙𝘑 𝘱𝘢𝘳𝘢 𝘨𝘢𝘯𝘩𝘢𝘳 𝘢𝘵é 𝘙$ 3 𝘮𝘪𝘭 𝘦𝘮 𝘉𝘪𝘵𝘤𝘰𝘪𝘯. 𝗕𝘂𝗹𝗹 21 𝗖𝗼𝗺𝗽𝗮𝗻𝘆 #singularida #tecnologia #futuro #ia #dinheiro</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395737/3395737_720p.mp4</video:content_loc>
      <video:duration>130</video:duration>
      <video:publication_date>2026-09-01T23:56:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395736</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395736/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 Minuto Animal — Como Isso é Possível_ #curiosidades #animal</video:title>
      <video:description>1 Minuto Animal — Como Isso é Possível_ #curiosidades #animal #curiosidade</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395736/3395736_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T23:56:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395735</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395735/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BEAT THE TIN,BEAT THE BUTT - DJ LKS RIT INTERNACIONAL</video:title>
      <video:description>BEAT THE TIN,BEAT THE BUTT - DJ LKS RIT INTERNACIONAL #popmusic #bestpopsongs #internationalsongs #hitsongs #pophits #bestmusic #popplaylist #popularsongs #tophits #trendingsongs #musicplaylist #acousticmusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395735/3395735_720p.mp4</video:content_loc>
      <video:duration>235</video:duration>
      <video:publication_date>2026-09-01T23:56:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395734</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395734/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_51.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_51.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395734/3395734_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:56:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395733</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395733/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 15</video:title>
      <video:description>#Cachorro #pulo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395733/3395733_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T23:56:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395732</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395732/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pessoas e Rejeição</video:title>
      <video:description>🔥 Corte exclusivo do canal oficial de Pablo Marçal Todos os direitos reservados ao canal original: 👉 https://www.youtube.com/@pablomarcall Este é um vídeo de cortes feito com o objetivo de destacar os melhores momentos e mensagens de impacto. Não somos o canal oficial. Todo o conteúdo pertence ao Pablo Marçal e sua equipe. ✅ Inscreva-se no canal original para não perder nenhuma live e conteúdo completo: https://www.youtube.com/@pablomarcall Se você gostou do corte, deixa o like, comenta e compartilha!</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395732/3395732_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T23:56:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395731</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395731/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_50.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_50.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395731/3395731_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:56:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395730</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395730/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>*Entre o Caos e Você (Parte 2) | Rock Acústico Que Vem da Alma*</video:title>
      <video:description>🎸“Entre o Caos e Você (Parte 2)” é uma continuação feita de sentimentos reais, silêncio, conflitos internos e esperança. Essa música nasceu em um momento onde tudo parecia confuso, mas uma presença, uma lembrança ou um sentimento ainda fazia sentido em meio ao caos. Se você já se sentiu dividido entre o que machuca e o que conforta, essa música é pra você. Rock acústico Emoção real Do caos à esperança Agora quero saber de você: Qual título combina mais com essa música? Comenta: 1, 2 ou 3 ?? Se curtir, deixa o like e se inscreve no canal pra fortalecer o som independente.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395730/3395730_720p.mp4</video:content_loc>
      <video:duration>187</video:duration>
      <video:publication_date>2026-09-01T23:56:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395729</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395729/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_49.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_49.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395729/3395729_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:56:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395728</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395728/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute China Girl 4</video:title>
      <video:description>Tiktoker Girl</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395728/3395728_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T23:55:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395727</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395727/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_48.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_48.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395727/3395727_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:55:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395726</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395726/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>بيتز</video:title>
      <video:description>بيتز #بيتز</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395726/3395726_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:55:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395725</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395725/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>aswsaa</video:title>
      <video:description>aswewaaa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395725/3395725_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:55:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395724</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395724/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pemantauan</video:title>
      <video:description>pada waktu itu kami sedang memantau perkebunan sawit mengunakan alat kamerah canggih #petualangan</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395724/3395724_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T23:55:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395723</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395723/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_47.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_47.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395723/3395723_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:55:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395722</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395722/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 Minuto Animal - Isso É Surreal 😱 # #natureza #curiosidades</video:title>
      <video:description>1 Minuto Animal - Isso É Surreal 😱 # #natureza #curiosidades #curiosidades</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395722/3395722_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T23:55:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395721</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395721/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Super Hit Song Mehndi</video:title>
      <video:description>Old is Gold Song</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395721/3395721_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-01T23:55:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395720</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395720/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_46.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_46.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395720/3395720_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:55:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395719</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395719/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_45.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_45.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395719/3395719_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:54:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395718</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395718/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Estrada 3</video:title>
      <video:description>#Estrada #asfalto #caminhão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395718/3395718_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-01T23:54:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395717</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395717/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Istanbullu Gelin _ Bride of Istanbul - Episode 11 English Subtitle</video:title>
      <video:description>Istanbullu Gelin _ Bride of Istanbul - Episode 11 English Subtitle #BrideofIstanbul</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395717/3395717_720p.mp4</video:content_loc>
      <video:duration>2754</video:duration>
      <video:publication_date>2026-09-01T23:54:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395716</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395716/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_44.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_44.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395716/3395716_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:54:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395715</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395715/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Médico e Satisfação</video:title>
      <video:description>🔥 Corte exclusivo do canal oficial de Pablo Marçal Todos os direitos reservados ao canal original: 👉 https://www.youtube.com/@pablomarcall Este é um vídeo de cortes feito com o objetivo de destacar os melhores momentos e mensagens de impacto. Não somos o canal oficial. Todo o conteúdo pertence ao Pablo Marçal e sua equipe. ✅ Inscreva-se no canal original para não perder nenhuma live e conteúdo completo: https://www.youtube.com/@pablomarcall Se você gostou do corte, deixa o like, comenta e compartilha!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395715/3395715_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T23:54:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395714</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395714/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_43.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_43.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395714/3395714_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:54:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395713</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395713/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ELA DESCOBRIU QUE O PAI ESTÁ VIVO… MAS DANIEL ESCONDE UM SEGREDO 😱</video:title>
      <video:description>Lívia finalmente descobre que seu pai está vivo, mas Daniel esconde algo muito maior do que ela imaginava. Sofia sabe da verdade e tenta convencer Daniel a contar tudo. Quando Lívia exige saber onde seu pai está, Daniel revela uma coisa assustadora: a pessoa responsável por tudo está muito mais perto do que ela imagina. Assista até o final e descubra o novo segredo. Uma novela curta cheia de suspense, segredos, traições e reviravoltas. Hashtags: #SegredoEmCena #Novela #NovelaCurta #MicroDrama #Drama #Suspense #Mistério #Segredo #Reviravolta #Traição #Historia #VideoViral #Febspot #novelacurta #noveladesuspense #noveladramática #microdrama #micronovela #históriadesuspense #históriadetraição #traição #segredo #segredofamiliar #mistério #reviravolta #drama #dramafamiliar #namoradoescondendosegredo #mulherdescobresegredo #LíviaeDaniel #Sofia #históriaemocionante #finalsurpreendente #suspenseemocional #novelaempartes #sériecurta #históriaviral #inteligênciaartificial #novelaIA #vídeoIA #históriascurtas #dramaromântico #segredodonamorado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395713/3395713_720p.mp4</video:content_loc>
      <video:duration>184</video:duration>
      <video:publication_date>2026-09-01T23:54:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395712</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395712/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_42.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_42.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395712/3395712_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:53:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395711</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395711/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_41.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_41.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395711/3395711_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:53:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395710</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395710/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O_Enigma_de_Daniel</video:title>
      <video:description>O_Enigma_de_Daniel #O_Enigma_de_Daniel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395710/3395710_720p.mp4</video:content_loc>
      <video:duration>539</video:duration>
      <video:publication_date>2026-09-01T23:53:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395709</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395709/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Live Streaming Primeiro Passo</video:title>
      <video:description>🔥 Corte exclusivo do canal oficial de Pablo Marçal Todos os direitos reservados ao canal original: 👉 https://www.youtube.com/@pablomarcall Este é um vídeo de cortes feito com o objetivo de destacar os melhores momentos e mensagens de impacto. Não somos o canal oficial. Todo o conteúdo pertence ao Pablo Marçal e sua equipe. ✅ Inscreva-se no canal original para não perder nenhuma live e conteúdo completo: https://www.youtube.com/@pablomarcall Se você gostou do corte, deixa o like, comenta e compartilha!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395709/3395709_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T23:53:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395708</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395708/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Predio</video:title>
      <video:description>#Predio #escada</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395708/3395708_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T23:52:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395707</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395707/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anime in English | All Episodes | Anime Full Screen English Dub | 2024 New Anime Series</video:title>
      <video:description>#anime #china #usa #frança</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395707/3395707_720p.mp4</video:content_loc>
      <video:duration>17166</video:duration>
      <video:publication_date>2026-09-01T23:52:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395705</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395705/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Impedimento e Prosperidade</video:title>
      <video:description>🔥 Corte exclusivo do canal oficial de Pablo Marçal Todos os direitos reservados ao canal original: 👉 https://www.youtube.com/@pablomarcall Este é um vídeo de cortes feito com o objetivo de destacar os melhores momentos e mensagens de impacto. Não somos o canal oficial. Todo o conteúdo pertence ao Pablo Marçal e sua equipe. ✅ Inscreva-se no canal original para não perder nenhuma live e conteúdo completo: https://www.youtube.com/@pablomarcall Se você gostou do corte, deixa o like, comenta e compartilha!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395705/3395705_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T23:52:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395704</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395704/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PEGOU UM PEIXE MUITO TOP</video:title>
      <video:description>MULHER PEGOU UM PEIXE MUITO TOP #UNITEDSTATES</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395704/3395704_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T23:51:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395703</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395703/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chuva 4</video:title>
      <video:description>#Chuva #água #carro</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395703/3395703_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T23:51:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395702</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395702/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>suka adek atau suka kakak</video:title>
      <video:description>suka adek atau suka kakak</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395702/3395702_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:51:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395701</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395701/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES: O SEGREDO SOMBRIO  DO OCEANO QUE ASSUSTA CIENTISTAS  SAIBA A VERDADE!</video:title>
      <video:description>REINO DOS TUBARÕES: O Segredo SOMBRIO do OCEANO Que Assusta CIENTISTA Você Não Está Preparado Para o Que Vive no Oceano #oceano #vidamarinha #animais #natureza #documentario #mundoselvagem #tubarao #orca #baleia #deepocean #animalplanet #naturewild #océanoprofundo # 📄 **DESCRIÇÃO OTIMIZADA (ALTA PERFORMANCE)** O oceano parece calmo… mas essa é a maior ilusão da natureza. Debaixo da superfície, existe uma guerra constante pela sobrevivência. Predadores silenciosos, gigantes colossais e criaturas incrivelmente inteligentes disputam espaço em um dos ambientes mais extremos do planeta. Neste documentário, você vai mergulhar em um mundo onde: * A força não é tudo * A inteligência pode decidir o destino * E a união pode ser a única chance de sobreviver De caçadores solitários a estratégias em grupo impressionantes, cada criatura revela um lado brutal e fascinante da vida marinha. Mas a verdadeira pergunta é: **quem realmente domina o oceano?** Assista até o final… porque a resposta pode mudar completamente a forma como você enxerga a natureza. 🔥 **PARTICIPE DO VÍDEO:** Quero saber sua opinião 👇 👉 Qual criatura você acha mais impressionante? 👉 Você acredita que a sobrevivência depende mais de força ou inteligência? 👉 Já viveu alguma situação onde teve que se adaptar rápido para sobreviver? Comenta aí — eu leio tudo. 🌊 **INSCREVA-SE NO CANAL:** Se você gosta de conteúdos sobre natureza selvagem, mistérios do oceano e histórias reais que desafiam a lógica… esse canal é pra você. Se inscreve e ativa o sininho 🔔 pra não perder os próximos vídeos — aqui, cada conteúdo é uma nova descoberta. ⚠️ **IMPORTANTE:** Este vídeo tem fins educativos e informativos, baseado em comportamentos reais da vida marinha. #oceano #oceanoprofundo #vidamarinha #animaismarinhos #predadoresdooceano #tuba</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395701/3395701_720p.mp4</video:content_loc>
      <video:duration>1178</video:duration>
      <video:publication_date>2026-09-01T23:51:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395700</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395700/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>**Memórias Que Machucam | Rock Emocional (Clipe Oficial)**</video:title>
      <video:description>🎸Algumas memórias machucam. Outras tentam puxar a gente pra trás. **“Memórias Que Machucam”** é sobre tudo aquilo que doeu, mas não conseguiu nos derrubar. Não é sobre esquecer o passado. É sobre seguir em frente, mesmo com medo. Rock emocional, real, sem filtro. Se essa música falou com você, deixa um comentário. Sua história importa. Inscreva-se no canal para ouvir as próximas músicas.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395700/3395700_720p.mp4</video:content_loc>
      <video:duration>226</video:duration>
      <video:publication_date>2026-09-01T23:50:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395699</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395699/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ranking funniest beach moment</video:title>
      <video:description>Ranking funniest beach moment #ranking</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395699/3395699_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T23:50:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395698</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395698/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BREAKING GLASS BOTTLES A CRUSHING CRUNCHY &amp; SOFT THINGS | ROMPIENDO BOTELLAS DE CRISTAL APLASTANDO C</video:title>
      <video:description>#BREAKING #GLASS #BOTTLES #CRUSH #CRUNCHY #ROMPIENDO #BOTELLAS #CRISTAL</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395698/3395698_720p.mp4</video:content_loc>
      <video:duration>783</video:duration>
      <video:publication_date>2026-09-01T23:50:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395697</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395697/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BABY - DJ LKS RIT INTERNACIONAL</video:title>
      <video:description>BABY - DJ LKS RIT INTERNACIONAL #MUSICAS #MUSICASINTERNACIONAIS #SONGS #SOUNDS</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395697/3395697_720p.mp4</video:content_loc>
      <video:duration>186</video:duration>
      <video:publication_date>2026-09-01T23:50:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395696</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395696/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chuva 3</video:title>
      <video:description>#Chuva #agua</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395696/3395696_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T23:50:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395695</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395695/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disparos e Energia</video:title>
      <video:description>🔥 Corte exclusivo do canal oficial de Pablo Marçal Todos os direitos reservados ao canal original: 👉 https://www.youtube.com/@pablomarcall Este é um vídeo de cortes feito com o objetivo de destacar os melhores momentos e mensagens de impacto. Não somos o canal oficial. Todo o conteúdo pertence ao Pablo Marçal e sua equipe. ✅ Inscreva-se no canal original para não perder nenhuma live e conteúdo completo: https://www.youtube.com/@pablomarcall Se você gostou do corte, deixa o like, comenta e compartilha!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395695/3395695_720p.mp4</video:content_loc>
      <video:duration>38</video:duration>
      <video:publication_date>2026-09-01T23:50:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395694</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395694/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_40.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_40.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395694/3395694_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:50:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395693</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395693/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jangan di pilih 1</video:title>
      <video:description>Jangan di pilih 1</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395693/3395693_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T23:50:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395692</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395692/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Em busca santo graau</video:title>
      <video:description>Em busca absoluto poder,me acompanhe nessa jornada épica. #EUA #viral #viralvideo #vitória</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395692/3395692_720p.mp4</video:content_loc>
      <video:duration>277</video:duration>
      <video:publication_date>2026-09-01T23:49:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395691</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395691/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_39.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_39.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395691/3395691_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:49:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395690</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395690/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>mau jadi kesukaan mu</video:title>
      <video:description>mau jadi kesukaan mu</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395690/3395690_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:49:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395689</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395689/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_38.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_38.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395689/3395689_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:49:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395688</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395688/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Does Doctor Strange already know how to defeat Doctor Doom?</video:title>
      <video:description>In this video, I discovered some interesting facts about Marvel. #Marvel #vingadores #revengers #doutorestranho #doutordestino</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395688/3395688_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-01T23:49:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395687</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395687/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_37.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_37.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395687/3395687_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:49:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395686</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395686/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_36.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_36.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395686/3395686_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:49:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395685</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395685/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TRUMP DECLARA: ESTREITO DE ORMUZ É “NOVO TERRITÓRIO DOS EUA”</video:title>
      <video:description>O mundo está mudando mais rápido do que os noticiários conseguem acompanhar. Aqui você entende o que está acontecendo de verdade, sem filtro, sem enrolação — geopolítica, conflitos e poder global explicados de forma direta e clara. 🔔 Se inscreva e ative o sininho — porque quem entende o mundo antes, decide melhor. CANAL QUE RECOMENDO ( SOBRE CARROS ): https://www.youtube.com/@MinhaNave Seja um apoiador do nosso trabalho: PIX - jrsax1@hotmail.com Contato para parcerias: jrsax1@hotmail.com #Geopolítica #ConflitoInternacional #OrienteMédio #NotíciasMundo #EstadosUnidos #China #Rússia #PolíticaInternacional #PoderGlobal #Trump #DonaldTrump #Irã #TrumpIrã #guerraIrãEstadosUnidos #EstreitodeOrmuz #Ormuz #EstreitodeHormuz #crisenoOrienteMédio #conflitoEUAIrã #mísseisiranianos #EmiradosÁrabesUnidos #ataquesdoIrã #bloqueionaval #bloqueionavalamericano #guerranoGolfo #GolfoPérsico #petróleo #crisedopetróleo #políticainternaciona</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395685/3395685_720p.mp4</video:content_loc>
      <video:duration>702</video:duration>
      <video:publication_date>2026-09-01T23:49:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395684</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395684/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_35.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_35.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395684/3395684_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:48:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395683</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395683/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Capacidade de Decisão</video:title>
      <video:description>🔥 Corte exclusivo do canal oficial de Pablo Marçal Todos os direitos reservados ao canal original: 👉 https://www.youtube.com/@pablomarcall Este é um vídeo de cortes feito com o objetivo de destacar os melhores momentos e mensagens de impacto. Não somos o canal oficial. Todo o conteúdo pertence ao Pablo Marçal e sua equipe. ✅ Inscreva-se no canal original para não perder nenhuma live e conteúdo completo: https://www.youtube.com/@pablomarcall Se você gostou do corte, deixa o like, comenta e compartilha!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395683/3395683_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T23:48:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395682</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395682/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_34.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_34.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395682/3395682_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:48:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395681</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395681/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Senhor hoje eu chego diante de tir</video:title>
      <video:description>Busca refúgio onde podemos encontrar nos braços do senhor e algo maravilhoso conseguimos encontrar paz amor e tranquilidade #pazamorDeusJesuspalavradidiavida</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395681/3395681_720p.mp4</video:content_loc>
      <video:duration>58</video:duration>
      <video:publication_date>2026-09-01T23:48:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395680</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395680/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_33.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_33.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395680/3395680_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:48:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395679</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395679/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Do erro ao abraço</video:title>
      <video:description>do erro ao abraço, o camponês sábio. #campones #abraço #erro #sabio</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395679/3395679_720p.mp4</video:content_loc>
      <video:duration>343</video:duration>
      <video:publication_date>2026-09-01T23:48:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395678</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395678/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Istanbullu Gelin _ Bride of Istanbul - Episode 10 English Subtitle</video:title>
      <video:description>Istanbullu Gelin _ Bride of Istanbul - Episode 10 English Subtitle #BrideofIstanbul</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395678/3395678_720p.mp4</video:content_loc>
      <video:duration>2824</video:duration>
      <video:publication_date>2026-09-01T23:47:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395677</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395677/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_32.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_32.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395677/3395677_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:47:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395676</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395676/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 Minuto Animal - Você Sabia Dessa... 😲 #animais #curiosidades</video:title>
      <video:description>1 Minuto Animal - Você Sabia Dessa... 😲 #animais #curiosidades #curiosidades</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395676/3395676_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T23:47:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395675</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395675/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gdrgki</video:title>
      <video:description>i7y44exy8o #4t78obvssr</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395675/3395675_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T23:47:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395674</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395674/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_31.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_31.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395674/3395674_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:47:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395673</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395673/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>[Filme Ficção Científica] Ufologia</video:title>
      <video:description>[Filme Ficção Científica] Ufologia #FilmeFicçãoCientíficaUfologia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395673/3395673_720p.mp4</video:content_loc>
      <video:duration>7163</video:duration>
      <video:publication_date>2026-09-01T23:47:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395672</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395672/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cristal de Ametista relógio.</video:title>
      <video:description>Este é um relógio de cristal de Ametista. A Ametista é um cristal que é encontrado em alguns países, principalmente Brasil, Estados Unidos e México. É um pedra que vai de um lilás suave ao roxo intenso e escuro. Obrigado por assistir. #Cristais #pedras #minerais #rochas #Ametista</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395672/3395672_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-01T23:46:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395671</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395671/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Weeping Angels attack! | Doctor Who</video:title>
      <video:description>Larry and Sally make their way to the basement of the house and discover the Angels and the TARDIS. #DoctorWho #Movies #filmes</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395671/3395671_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T23:46:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395670</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395670/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>manado</video:title>
      <video:description>manado</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395670/3395670_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:46:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395669</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395669/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mar azul</video:title>
      <video:description>Mar azul...azul da cor do mar #Viagens</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395669/3395669_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T23:45:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395668</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395668/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Sheer Chic Lace Thong Try-On Showcase! ✨ Tap &apos;Follow&apos; for more looks. 2</video:title>
      <video:description>Trying on the ultimate sexy, sheer, and chic lace thong today! Absolutely obsessed with how elegant and gorgeous #lingerietryonhaullacesetsheerthongchiclondonfashioninspousagorgeousbeautyforyou</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395668/3395668_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T23:45:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395667</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395667/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anime FullScreen English Dub | All Episodes | 2024 New Anime Series | Anime in English</video:title>
      <video:description>#Movie #anime #china #usa #frança</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395667/3395667_720p.mp4</video:content_loc>
      <video:duration>16859</video:duration>
      <video:publication_date>2026-09-01T23:45:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395666</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395666/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Árvore 3</video:title>
      <video:description>#Árvore #gambá #joelho</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395666/3395666_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:45:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395665</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395665/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Istanbullu Gelin _ Bride of Istanbul - Episode 8 English Subtitle</video:title>
      <video:description>Istanbullu Gelin _ Bride of Istanbul - Episode 8 English Subtitle #BrideofIstanbul</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395665/3395665_720p.mp4</video:content_loc>
      <video:duration>2818</video:duration>
      <video:publication_date>2026-09-01T23:45:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395664</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395664/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Same Frequency | Emotional Romantic Rock | Official Music Video</video:title>
      <video:description>SAME FREQUENCY Some connections don&apos;t need an explanation. You meet someone and suddenly the noise becomes quieter. You don&apos;t have to pretend. You don&apos;t have to hide. You don&apos;t have to find the perfect words. You just understand each other. “Same Frequency” is an emotional romantic rock song about finding someone who sees beyond your defenses and chooses to stay — not because they need to save you, but because you choose to face life together. Two hearts. One rhythm. One connection. The same frequency. 🎸 Sonic Storm — Official Music Video ━━━━━━━━━━━━━━━━━━━━━━ 🎧 LISTEN ON SPOTIFY: https://open.spotify.com/artist/1UtTcRU7La9iRHEbPwcydJ ━━━━━━━━━━━━━━━━━━━━━━ 🎸 SONIC STORM https://youtube.com/@sonicstorm22?si=toExCL5U3xZC12L6 🎵 LEO EM ACORDES http://www.youtube.com/@leoemacordes 🔥 ALMA BLINDADA https://youtube.com/@blindada2205?si=Ucs9JdtPr26rVksh ━━━━━━━━━━━━━━━━━━━━━━ If this song reminds you of someone, send it to them. ❤️ Like</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395664/3395664_720p.mp4</video:content_loc>
      <video:duration>332</video:duration>
      <video:publication_date>2026-09-01T23:44:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395663</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395663/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ACE DE RAZE É GOSTOSO DEMAIS</video:title>
      <video:description>#valorant</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395663/3395663_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T23:44:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395662</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395662/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>IMAGINE 2</video:title>
      <video:description>Uma palavra pode fazer as pessoas pararem e prestar atenção. Se você trabalha com internet, marketing ou criação de conteúdo, precisa conhecer essa palavra. 🧠 IMAGINE. Uma palavra simples, mas poderosa. Você usaria nos seus vídeos? 👇 #WyanVexImagineControleDisciplinaDominio</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395662/3395662_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T23:43:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395661</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395661/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tombo</video:title>
      <video:description>#Bicicleta #tombo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395661/3395661_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T23:43:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395660</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395660/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu tô rifando meu coração</video:title>
      <video:description>THE MOST BEAUTIFUL LOVE SONG OF 2026 | Romantic Song Description: ❤️ A beautiful romantic song for anyone who has ever been in love. 🎧 Put on your headphones, turn up the volume and enjoy this emotional love song. Share this song with someone special. ❤️ 🎶 New music and emotional songs coming soon! Hashtags: #EuaParis</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395660/3395660_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-01T23:43:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395659</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395659/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Wedding Event Dance 9</video:title>
      <video:description>Family Dance Performance</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395659/3395659_720p.mp4</video:content_loc>
      <video:duration>71</video:duration>
      <video:publication_date>2026-09-01T23:43:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395658</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395658/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Istanbullu Gelin _ Bride of Istanbul - Episode 7 English Subtitle</video:title>
      <video:description>Istanbullu Gelin _ Bride of Istanbul - Episode 7 English Subtitle #BrideofIstanbul</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395658/3395658_720p.mp4</video:content_loc>
      <video:duration>2779</video:duration>
      <video:publication_date>2026-09-01T23:42:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395657</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395657/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Secret Origin of Coca-Cola You Didn&apos;t Know</video:title>
      <video:description>Você sabia como começou a história da Coca-Cola? 👀 De uma receita criada no século XIX a uma marca reconhecida em praticamente todo o planeta. Uma história de inovação, marketing, mistério e crescimento impressionante. 🚀 #Coca-cola #História #Curiosidades #JohnPemberton #DaCocaCola</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395657/3395657_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-01T23:42:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395656</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395656/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>We Found A Scary 😱 Entity On A Security Camera In Minecraft</video:title>
      <video:description>We found a scary entity, which can only be seen on a security camera, stay tuned to find out what happened next if we can defeat it or not. #Minecraft #cashandnico #Minecraftroleplay</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395656/3395656_720p.mp4</video:content_loc>
      <video:duration>847</video:duration>
      <video:publication_date>2026-09-01T23:42:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395655</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395655/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>blondie gataai</video:title>
      <video:description>blondie #blodiefitness</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395655/3395655_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:41:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395654</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395654/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dança 66</video:title>
      <video:description>#Dança #casal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395654/3395654_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T23:41:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395653</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395653/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Limpa Farol Max farol</video:title>
      <video:description>#Limpafarol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395653/3395653_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T23:41:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395652</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395652/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O pecado</video:title>
      <video:description>o que e o pecado para você #pecado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395652/3395652_720p.mp4</video:content_loc>
      <video:duration>146</video:duration>
      <video:publication_date>2026-09-01T23:41:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395651</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395651/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES:TUBARÃO TIGRE O PREDADOR MAIS CRUEL DO OCEANO</video:title>
      <video:description>### 🦈 Tubarão-Tigre O **tubarão-tigre** é um dos predadores mais impressionantes dos oceanos. Reconhecido pelas listras escuras no corpo, pode ultrapassar **5 metros de comprimento** e possui uma alimentação extremamente variada. É encontrado principalmente em águas tropicais e subtropicais e ganhou fama por sua força, curiosidade e capacidade de explorar diferentes ambientes marinhos. #Tubarão-branco #Tubarão-martelo #Tubarão-baleia #Tubarão-tigre #Tubarão-frade #Tubarão-duende #Tubarão-de-pontas-negras #Tubarão-cobra #Tubarão-anão #Tubarão-serra #Tubarão-lanterna #Megalodon #Tubarão-lixa #Tubarão-martelo-recortado #Tubarão-cabeça-chata #Tubarão-anjo #Tubarão-mangona #Tubarão-raposa #Tubarão-zebra #Tubarão-martelo-grande #Tubarão-martelo-comum #Tubarão-gato #Tubarão-da-Groenlândia #Tubarão-cabeça-de-touro #Tubarões-cavala #Tubarão-martelo-suave #Tubarão-raposa-de-olhos-grandes #Tubarão-galha-preta</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395651/3395651_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-01T23:41:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395650</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395650/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Palavra de Deus 7</video:title>
      <video:description>Transmitindo a palavra de Deus #palavradeDeus #palavra #Deusefiel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395650/3395650_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-01T23:41:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395649</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395649/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Soul Funk Fever – SoundMancerMusic | American Soul Funk</video:title>
      <video:description>Soul Funk Fever – SoundMancerMusic Feel the heat, catch the groove and let the soul take over. “Soul Funk Fever” is an energetic American soul funk track driven by a pulsing bassline, powerful horns and an irresistible dance beat. Deep grooves, energetic brass and funky rhythms create a vibrant party atmosphere made for moving all night long. With expressive male funk vocals and catchy chorus harmonies, the track blends the energy of classic funk with the warmth and spirit of soul. Turn up the volume, follow the bass and catch the Soul Funk Fever. 🎵 Track: Soul Funk Fever 🎵 Artist: SoundMancerMusic 🎵 Genre: Soul Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, soul, dance and international music from SoundMancerMusic. #SoulFunkFever #SoundMancerMusic #SoulFunk #SoulFunkMusic #Funk #FunkMusic #AmericanFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #PulsingBassline #FunkHorns #EnergeticHorns #HornSection #BrassFunk #SoulMusic #FunkSoul #DanceMusic #PartyFunk #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395649/3395649_720p.mp4</video:content_loc>
      <video:duration>235</video:duration>
      <video:publication_date>2026-09-01T23:40:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395648</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395648/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai 6</video:title>
      <video:description>latina #latina</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395648/3395648_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T23:40:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395647</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395647/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Polar 2</video:title>
      <video:description>#Polar #cerveja</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395647/3395647_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:40:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395646</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395646/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O rádio entregou eles</video:title>
      <video:description>#Filmes</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395646/3395646_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-09-01T23:40:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395644</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395644/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Istanbullu Gelin _ Bride of Istanbul - Episode 2</video:title>
      <video:description>Istanbullu Gelin _ Bride of Istanbul - Episode 2 English Subtitl #Brideofistanbul</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395644/3395644_720p.mp4</video:content_loc>
      <video:duration>2687</video:duration>
      <video:publication_date>2026-09-01T23:40:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395643</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395643/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1Minuto Animal - monstros ou fofos... 🐶 #animais #curiosidades</video:title>
      <video:description>1Minuto Animal - monstros ou fofos... 🐶 #animais #curiosidades #curiosidades</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395643/3395643_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-01T23:40:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395642</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395642/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rhythm Fever – SoundMancerMusic | High Energy American Funk</video:title>
      <video:description>Rhythm Fever – SoundMancerMusic Catch the fever, feel the bass and let the rhythm take over the dance floor. “Rhythm Fever” is an explosive high-energy American funk track powered by thunderous basslines, vibrant horns, energetic drums and an irresistible groove. As the lights explode and the crowd comes alive, powerful rhythms and wild horn sections create a nonstop celebration of music, dancing and passion. With energetic male vocals and strong chorus harmonies, “Rhythm Fever” delivers pure funk energy from beginning to end. Turn up the volume, follow the groove and let the rhythm drive the night. 🎵 Track: Rhythm Fever 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #RhythmFever #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #HighEnergyFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #ExplosiveBass #FunkHorns #HornSection #BrassFunk #FunkDrums #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395642/3395642_720p.mp4</video:content_loc>
      <video:duration>206</video:duration>
      <video:publication_date>2026-09-01T23:40:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395641</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395641/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Macio</video:title>
      <video:description>#Macio #airbag</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395641/3395641_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T23:39:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395640</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395640/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>IT IS NOT THE END - DJ LKS RIT INTERNACIONAL</video:title>
      <video:description>IT IS NOT THE END - DJ LKS RIT INTERNACIONAL #MUSICAS #MUSICASINTERNACIONAIS #SOUNDS #TRAPMUSIC</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395640/3395640_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-09-01T23:39:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395639</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395639/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Horn Blast Party – SoundMancerMusic | High Energy American Funk</video:title>
      <video:description>Horn Blast Party – SoundMancerMusic Turn up the horns, feel the bass and let the funk take over the party. “Horn Blast Party” is a high-energy American funk track powered by explosive basslines, vibrant horn sections, energetic drums and an irresistible dance groove. From the first horn blast to the final beat, the track delivers a celebration of rhythm, movement and pure funk energy. A roaring bassline, powerful brass and energetic male vocals create the atmosphere of a packed dance floor where the party never slows down. With strong chorus harmonies and a groove made for dancing, “Horn Blast Party” brings classic funk energy to life. 🎵 Track: Horn Blast Party 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #HornBlastParty #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #HighEnergyFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #ExplosiveBass #FunkHorns #HornSection #BrassFunk #FunkDrums #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395639/3395639_720p.mp4</video:content_loc>
      <video:duration>154</video:duration>
      <video:publication_date>2026-09-01T23:38:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395638</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395638/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NÃO ABANDONE SEU PET</video:title>
      <video:description>Procure ajuda, a Clic Rádio Porto Alegre coloca em sua programação muitas campanhas de conscientização social, optamos por não comercializar o espaço para trabalhar em campanhas públicas, o retorno que você pode deixar é dar um joinha. obrigado #pet #cachorro #abandono</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395638/3395638_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-01T23:38:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395637</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395637/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LULA NUNCA VI ESSA MOÇA NA MINHA VIDA!!!</video:title>
      <video:description>🚨 “LULA: NUNCA VI ESSA MOÇA NA MINHA VIDA” Uma declaração que chamou atenção e levantou ainda mais questionamentos sobre o caso. Afinal, quem é a mulher mencionada e por que o nome dela apareceu nessa história? 👀 Confira o que foi dito, entenda o contexto e tire suas próprias conclusões. 💬 Você acredita nessa versão? #Lula #Brasil #Política #PolíticaBrasileira #Notícias #Justiça #Governo #Atualidades</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395637/3395637_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T23:38:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395636</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395636/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Barulho</video:title>
      <video:description>#Barulho #rosão #fogo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395636/3395636_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T23:38:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395635</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395635/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Impressionante oque ele fez</video:title>
      <video:description>Olha do</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395635/3395635_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:38:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395634</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395634/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O que a água faz?😂😂 #prank #short</video:title>
      <video:description>#Comédia #prank #short</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395634/3395634_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:38:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395633</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395633/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Groove Explosion – SoundMancerMusic | American Funk</video:title>
      <video:description>Groove Explosion – SoundMancerMusic Feel the bass, hear the horns and get ready for a groove explosion. “Groove Explosion” is an energetic American funk track driven by a powerful bassline, vibrant horns and an irresistible dance beat. Flashing lights, funky rhythms and a packed dance floor create a celebration of music, movement and pure groove. With energetic male vocals and catchy chorus harmonies, the track brings classic funk energy into a powerful party atmosphere. From the first bass hit to the final horn blast, “Groove Explosion” is made to keep the dance floor moving all night long. 🎵 Track: Groove Explosion 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #GrooveExplosion #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #BasslineFunk #GroovyBassline #FunkHorns #HornSection #FunkDrums #DanceMusic #PartyFunk #FunkParty #GrooveMusic #HighEnergyFunk #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395633/3395633_720p.mp4</video:content_loc>
      <video:duration>411</video:duration>
      <video:publication_date>2026-09-01T23:37:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395632</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395632/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LINDA NATUREZA!!</video:title>
      <video:description>OTIMO DIA A TODOS!! #NATUREZAVIDAAMORPAZ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395632/3395632_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T23:37:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395631</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395631/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>littlebigsnake épico</video:title>
      <video:description>increva-se no canal e deixe seu gostei #snakeio #sliterio #litlebigsnake #jogosmobile #snakkegame</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395631/3395631_720p.mp4</video:content_loc>
      <video:duration>229</video:duration>
      <video:publication_date>2026-09-01T23:37:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395630</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395630/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR: BREAKING BIG GLASS BOTTLES | 8 MINUTOS DE ASMR: ROMPIENDO BOTELLAS DE CRISTAL</video:title>
      <video:description>#ASMR #GLASS #BIG #BOTTLES #POMPIENDO #BOTELLAS #CRISTAL</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395630/3395630_720p.mp4</video:content_loc>
      <video:duration>487</video:duration>
      <video:publication_date>2026-09-01T23:37:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395629</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395629/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Danças 💃 🕺</video:title>
      <video:description>#Dançando</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395629/3395629_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T23:37:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395628</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395628/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sikap yamal di depan putri spanyol</video:title>
      <video:description>#LAMINEYAMAL</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395628/3395628_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-01T23:37:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395627</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395627/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gara-Gara Kulit Terasa Terbakar, Remaja 16 Tahun Ini Pilih Berendam di Kolam Selama 5 Tahun 🌊😳</video:title>
      <video:description>Kondisi unik sekaligus memilukan dialami oleh Iqbal Syeikh (16), remaja asal Beldanga, Murshidabad, India. Selama hampir 5 tahun terakhir, sebagian besar waktunya ia habiskan dengan merendam diri di dalam air kolam. Iqbal mengaku setiap kali ia keluar dari air, kulitnya terasa panas dan terbakar. Ia bahkan pernah bertahan berendam selama 7 hari berturut-turut tanpa naik ke darat. 🩺 Penjelasan Medis vs Anggapan Warga: Sebagian warga sekitar mengaitkan kondisi ini dengan hal mistis. Namun, pihak medis menduga Iqbal mengalami Eritromelalgia —kondisi langka pada saraf dan pembuluh darah yang memicu rasa nyeri hebat, kemerahan, dan sensasi terbakar pada kulit. Tulis pandangan dan doa kalian untuk Iqbal di kolom komentar! 👇</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395627/3395627_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T23:37:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395626</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395626/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funky Sunset – SoundMancerMusic | High Energy American Funk</video:title>
      <video:description>Funky Sunset – SoundMancerMusic When the sun goes down, the funk turns up. “Funky Sunset” is a high-energy American funk track powered by explosive bass, vibrant horns, energetic rhythms and an irresistible groove made for the dance floor. As the lights begin to flash and the party comes alive, powerful basslines and soaring horns create a celebration of music, dancing and passion. With energetic male vocals and strong chorus harmonies, “Funky Sunset” delivers pure funk energy from beginning to end. Turn up the volume, feel the groove and dance into the night. 🎵 Track: Funky Sunset 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #FunkySunset #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #HighEnergyFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #ExplosiveBass #FunkHorns #HornSection #FunkDrums #SunsetFunk #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395626/3395626_720p.mp4</video:content_loc>
      <video:duration>232</video:duration>
      <video:publication_date>2026-09-01T23:36:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395625</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395625/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lombriga</video:title>
      <video:description>#Lombriga #cachaça #cerveja #picanha</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395625/3395625_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:36:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395623</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395623/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dia difícil no Paranoá - Só valeu o entretenimento! 🎣🐠🐟🎏</video:title>
      <video:description>É galera, o trem tá feio aqui no Lago Paranoá pra pescar nessa época de frio! Só os caiaqueiros estão pegando e fazendo inveja! Eu disse no primeiro vídeo que iria mudar de local, só que, no clube onde programei pescar, a área era muito pequena, enquanto no Deck sul é muito mais abrangente! Então, no próximo vídeo, vou procurar outros pontos! E, fica a pergunta, sem previsão, quando vou colocar o meu caiaque na água...? 🤔 Link do primeiro vídeo: https://youtu.be/TuGNrlNDsys?sub_confirmation=1 Link do segundo vídeo: https://youtu.be/4TYXGYfd8r8?sub_confirmation=1 Vara: Speedfish 1651 da Albatroz 1,65m 2-6Lb Molinete: Saint Truly TR 500 135g Max Drag=2,5kg Linha: Monofilamento com Leader Fluorcarbono Câmera: Akaso Brave 7 4K 60fps com Estabilização de Imagem EIS 2.0 #pescarianolagoparanoá #pescaria #pesca #lagoparanoá #tralhas #molinete #vara #tucunaré #tilápia #iscaartificial #ultralight #anzol #garatéia #monofilamento #multifilamento #fluorcarbono</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395623/3395623_720p.mp4</video:content_loc>
      <video:duration>900</video:duration>
      <video:publication_date>2026-09-01T23:36:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395622</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395622/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como fazer uma mesa de policorte</video:title>
      <video:description>Seja bem vindo a oficina são José aqui você vai ficar com dica de serralheria</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395622/3395622_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-01T23:36:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395621</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395621/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiny Miniature Kitchen Cooking | Relaxing ASMR</video:title>
      <video:description>A tiny miniature kitchen scene with a small copper pan warming over a candle flame. Soft, cozy and relaxing visuals for a peaceful ASMR moment. No talking, just a calm tiny-world cooking atmosphere from Tiny Wonderland. #miniaturecooking #tinykitchen #minifood #relaxingASMR #notalkingASMR #tinyworld #miniatureworld #cozykitchen #satisfyingvideo #tinywonderland</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395621/3395621_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:36:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395620</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395620/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Different Princess EP10 / 不同的公主</video:title>
      <video:description>故事講述了女作家華清歌誤入自己小說的世界，變成了一個卑鄙的配角。她以為掌控劇本就能扭轉乾坤，卻沒想到遭遇了一連串的曲折，最後與季初展開了一段充滿愛恨糾葛的劇情。</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395620/3395620_720p.mp4</video:content_loc>
      <video:duration>1847</video:duration>
      <video:publication_date>2026-09-01T23:36:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395619</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395619/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funky Soul Train – SoundMancerMusic | American Funk</video:title>
      <video:description>Funky Soul Train – SoundMancerMusic All aboard the Funky Soul Train — where the bass is strong, the horns are loud and the groove never stops. “Funky Soul Train” is an energetic American funk track driven by a powerful bassline, vibrant horns and an irresistible dance beat. From the shaking dance floor to the flashing lights of the night, every rhythm brings more energy to the party. With groovy male vocals, catchy chorus harmonies and a soulful funk atmosphere, this track is made for dancing from beginning to end. Turn up the volume, feel the soul and ride the groove all night long. 🎵 Track: Funky Soul Train 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Soul Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, soul, dance and international music from SoundMancerMusic. #FunkySoulTrain #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #SoulFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #BasslineFunk #GroovyBassline #FunkHorns #HornSection #SoulMusic #FunkSoul #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395619/3395619_720p.mp4</video:content_loc>
      <video:duration>196</video:duration>
      <video:publication_date>2026-09-01T23:36:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395618</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395618/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arabic song 10</video:title>
      <video:description>Viral my song #France</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395618/3395618_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-01T23:35:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395617</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395617/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Luka Modrić dan Cristiano Ronaldo</video:title>
      <video:description>Luka Modrić dan Cristiano Ronaldo adalah rekan setim di Real Madrid selama enam musim berturut-turut antara tahun 2012 dan 2018; mereka memenangkan tiga gelar Liga Champions, dua gelar La Liga, serta total lima penghargaan Ballon d’Or saat berada dalam satu skuad yang sama. Modrić secara terbuka menyatakan bahwa kepergian Ronaldo ke Juventus pada tahun 2018 merupakan &quot;kehilangan terbesar yang dialami Real Madrid selama saya berada di klub tersebut&quot;—sebuah pernyataan dari seorang pemenang Ballon d’Or mengenai pemain yang baru saja mencetak gol ke-450-nya bagi Real Madrid. Kerja sama mereka yang memadukan lini tengah dan lini depan telah melahirkan tim La Liga modern dengan pencapaian individu terbanyak dalam sejarah kompetisi tersebut. ⚠️No copyright</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395617/3395617_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T23:35:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395615</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395615/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 Custos Ocultos da Falta de Disciplina Que Você Precisa Conhecer</video:title>
      <video:description>Você já parou para pensar no preço que paga por viver sem disciplina? Neste vídeo, você vai descobrir **3 custos ocultos de viver sem disciplina** que podem estar afetando sua rotina, seus objetivos, sua produtividade e até seu futuro. A falta de disciplina nem sempre mostra suas consequências imediatamente. Pequenas escolhas repetidas todos os dias podem se transformar em grandes perdas ao longo do tempo. Neste vídeo, você vai entender: • Os principais custos de viver sem disciplina • Como a falta de disciplina prejudica seus resultados • Por que hábitos aparentemente pequenos podem destruir seu progresso • Como desenvolver mais autocontrole e disciplina • O que você pode começar a mudar hoje Se você quer melhorar seus hábitos, aumentar sua produtividade e construir uma vida mais disciplinada, este vídeo é para você. **Assista até o final e descubra quais desses custos podem estar acontecendo na sua própria vida.** #disciplina #faltadedisciplina #comoterdisciplina #consequênciasdafaltadedisciplina #hábitos #autodisciplina</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395615/3395615_720p.mp4</video:content_loc>
      <video:duration>419</video:duration>
      <video:publication_date>2026-09-01T23:34:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395614</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395614/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lucky Strike (2026) | Full Movie | HD</video:title>
      <video:description>Lucky Strike (2026) A wounded American soldier fights to survive behind enemy lines during WWII’s Battle of the Bulge against the Germans, relying on his instinct, spy craft and a hand-radio to evade capture and find his way back to his unit. Genre: Action, Drama, Hollywood, War Director: Rod Lurie Actors: Alfie Stewart, Atanas Srebrev, Aunjanue Ellis-Taylor, Colin Hanks, Lorne MacFadyen, Scott Eastwood, Taylor John Smith Country: United States Duration: 97 min Quality: HD Release: 2026 IMDb: 5.6 #LuckyStrike2026 #FullMovie #HD #Action #Drama #Hollywood #War #UnitedStates</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395614/3395614_720p.mp4</video:content_loc>
      <video:duration>6211</video:duration>
      <video:publication_date>2026-09-01T23:34:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395613</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395613/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Carimbão Gasolina: Acertou ou Errou? Aposta Surpreendente!</video:title>
      <video:description>Carimbão forte gasolina Só pra mim que não coube muito né Quero ver quem que acertou aí Se você acertou você não passou a vista pra Pai do bité olha lá o pai do Olha Aí sim pegou 3 Vai faltar! #BiteloFrasesMotivacaoMusculacaoFitness</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395613/3395613_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T23:34:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395612</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395612/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Temas</video:title>
      <video:description>#Temas #crianças</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395612/3395612_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T23:34:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395611</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395611/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden olha so um código fácil de fazer</video:title>
      <video:description>Ninja Gaiden olha so um código fácil de fazer, so colocar a cabeça no estatua #Ninja</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395611/3395611_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T23:34:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395610</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395610/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Wrong Girls 2026 Full Movie HD</video:title>
      <video:description>The Wrong Girls 2026 Full Movie HD #TheWrongGirls2026 #FullMovieHD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395610/3395610_720p.mp4</video:content_loc>
      <video:duration>5989</video:duration>
      <video:publication_date>2026-09-01T23:34:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395609</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395609/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jakarta 2</video:title>
      <video:description>jakarta</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395609/3395609_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:34:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395608</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395608/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Balança Que Brilha,</video:title>
      <video:description>Felicidade é isso balança que brilha Clic Rádio Porto Alegre #musica #pop #ia #cantor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395608/3395608_720p.mp4</video:content_loc>
      <video:duration>121</video:duration>
      <video:publication_date>2026-09-01T23:34:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395607</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395607/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saking Maruknya</video:title>
      <video:description>Striker Ini Sampai Disogok Klub Cuma Buat Ngasih Umpan!</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395607/3395607_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T23:33:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395606</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395606/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES: KONG VS TUBARÕES A BATALHA DOS GIGANTES MAIS INTENSAS DO OCEANO</video:title>
      <video:description>REINO DOS TUBARÕES: KONG VS TUBARÕES A BATALHA DOS GIGANTES MAIS INTENSAS DO OCEANO Nas profundezas do oceano… algo colossal desperta na escuridão. Olhos gigantes observam em silêncio… e em segundos, o terror emerge das sombras! 2- Em meio à tempestade mortal… uma criatura colossal surge das profundezas. Relâmpagos iluminam o oceano… revelando o verdadeiro terror escondido nas águas! 3- O mar entra em silêncio absoluto… mas algo gigantesco se aproxima lentamente. Quando a criatura emerge das profundezas… ninguém consegue escapar do caos! 4- As águas começam a tremer… e uma força monstruosa surge diante dos navios. Em poucos segundos, o oceano se transforma em um verdadeiro pesadelo mortal! 5- O gigante desperta em meio às ondas violentas… encarando tudo ao seu redor. Cada passo da criatura faz o oceano tremer… anunciando a chegada da destruição! 6- Em meio a uma tempestade violenta, o mar gira formando um enorme redemoinho, enquanto um barco tenta escapar. De repente, um raio atinge as águas, levantando ondas gigantes e intensificando o caos. Em meio a uma violenta tempestade, um barco enfrenta ondas gigantes enquanto é cercado por dezenas de tubarões. Raios cortam o céu e o mar se agita intensamente, aumentando o perigo a cada segundo. sobre um mar revolto e uma tempestade intensa, uma enorme barbatana emerge das águas agitadas, cortando as ondas com força enquanto relâmpagos iluminam o cenário ameaçador. e um caos, uma turbulencia maritima e violenta, o gigantesco gorila Kong surge sobre o navio enquanto tubarões cercam o mar agitado, e, sob relâmpagos intensos, ele se ergue rugindo e abrindo os braços em um desafio imponente. Sob uma tempestade violenta, o gorila gigante ergue um enorme tubarão acima da cabeça e o arremessa com força ao mar, rugindo enquanto as ondas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395606/3395606_720p.mp4</video:content_loc>
      <video:duration>335</video:duration>
      <video:publication_date>2026-09-01T23:33:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395605</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395605/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Quanto vale um touro de alta performance no rodeio?  How much is a high-performance rodeo bull worth</video:title>
      <video:description>Quanto vale um touro de alta performance no rodeio? How much is a high-performance rodeo bull worth?</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395605/3395605_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T23:33:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395604</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395604/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Happy 116th birthday to Corinthians!</video:title>
      <video:description>Subscribe to the channel and leave a like</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395604/3395604_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T23:33:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395603</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395603/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Religião motivacional</video:title>
      <video:description>Jesus cura salva e liberta #Jesusmotivacional</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395603/3395603_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:33:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395602</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395602/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sung Jinwoo vs. The Ant King - Solo Leveling Season 2 | Part 6/8 2</video:title>
      <video:description>Jinwoo crushes the Ant King like a bug in episode 24! Watch Solo Leveling Season 2 - Arise from the Shadow They say whatever doesn’t kill you makes you stronger, but that’s not the case for the world’s weakest hunter Sung Jinwoo. After being brutally slaughtered by monsters in a high-ranking dungeon, Jinwoo came back with the System, a program only he could see, that’s leveling him up in every way. Now, he’s inspired to discover the secrets behind his powers and the dungeon that spawned them. #SoloLeveling #SoloLevelingSeason2 #Season2Episode24 #SungJinwoo #TheAntKing #SungJinwoovsTheAntKing</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395602/3395602_720p.mp4</video:content_loc>
      <video:duration>75</video:duration>
      <video:publication_date>2026-09-01T23:33:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395601</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395601/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grêmio 3</video:title>
      <video:description>#Grêmio #time #ganhar</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395601/3395601_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T23:33:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395600</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395600/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sung Jinwoo vs. The Ant King - Solo Leveling Season 2 | Part 8/8</video:title>
      <video:description>Jinwoo crushes the Ant King like a bug in episode 24! Watch Solo Leveling Season 2 - Arise from the Shadow They say whatever doesn’t kill you makes you stronger, but that’s not the case for the world’s weakest hunter Sung Jinwoo. After being brutally slaughtered by monsters in a high-ranking dungeon, Jinwoo came back with the System, a program only he could see, that’s leveling him up in every way. Now, he’s inspired to discover the secrets behind his powers and the dungeon that spawned them. #SoloLeveling #SoloLevelingSeason2 #Season2Episode24 #SungJinwoo #TheAntKing #SungJinwoovsTheAntKing</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395600/3395600_720p.mp4</video:content_loc>
      <video:duration>80</video:duration>
      <video:publication_date>2026-09-01T23:33:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395599</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395599/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Different Princess EP09 / 不同的公主</video:title>
      <video:description>故事講述了女作家華清歌誤入自己小說的世界，變成了一個卑鄙的配角。她以為掌控劇本就能扭轉乾坤，卻沒想到遭遇了一連串的曲折，最後與季初展開了一段充滿愛恨糾葛的劇情。</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395599/3395599_720p.mp4</video:content_loc>
      <video:duration>1834</video:duration>
      <video:publication_date>2026-09-01T23:33:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395597</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395597/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desvendando mistério</video:title>
      <video:description>A soma dos 7 #Construçãoobrasserviço</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395597/3395597_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T23:32:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395596</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395596/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grêmio 2</video:title>
      <video:description>#Grêmio #timão</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395596/3395596_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T23:32:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395595</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395595/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funky Groove Ride – SoundMancerMusic | American Funk</video:title>
      <video:description>Funky Groove Ride – SoundMancerMusic Turn up the bass, catch the groove and get ready to move. “Funky Groove Ride” is an energetic American funk track driven by a powerful bassline, vibrant horns and an irresistible dance beat. With a lively groove, energetic male vocals and catchy chorus harmonies, the track brings the spirit of a classic funk party straight to the dance floor. From the pounding bass to the explosive horn lines, “Funky Groove Ride” is all about rhythm, movement, energy and having a good time. 🎵 Track: Funky Groove Ride 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #FunkyGrooveRide #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #BasslineFunk #GroovyBassline #FunkHorns #HornSection #FunkDrums #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395595/3395595_720p.mp4</video:content_loc>
      <video:duration>185</video:duration>
      <video:publication_date>2026-09-01T23:31:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395594</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395594/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joao Pedro mengambil nomor punggung terkutuk Chelsea 😳</video:title>
      <video:description>#bola</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395594/3395594_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T23:31:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395593</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395593/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rotina da tarde</video:title>
      <video:description>Vídeo de rotina. #Rotinadatarde #vlog</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395593/3395593_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T23:31:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395592</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395592/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>new york 3</video:title>
      <video:description>new york</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395592/3395592_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:31:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395591</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395591/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pássaro raro</video:title>
      <video:description>Pássaro mais raro do mundo #Pássaro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395591/3395591_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:31:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395590</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395590/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não despreze</video:title>
      <video:description>Religião motivacional mensagem divina #motivacional</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395590/3395590_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:31:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395589</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395589/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O trem chegando</video:title>
      <video:description>Este vídeo fala sobre meninos que iam a escola, porque era o regresso das aulas porém o trem não chegava a tempo, então eles ficaram tão mais tão preocupados que quando viram o trem correram em direção a locomotiva #História</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395589/3395589_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:31:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395588</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395588/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Grêmio</video:title>
      <video:description>#Grêmio #ganhar</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395588/3395588_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T23:31:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395587</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395587/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>assim que o diabo gosta</video:title>
      <video:description>Blues Rock #blues #rock</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395587/3395587_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-09-01T23:31:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395586</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395586/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Jornada da Alma</video:title>
      <video:description>A vida é um quebra-cabecas, a cada dia a gente junta uma peça; quando quebra-cabeças tá montado, é hora de partir! #viagemastral #eternidade</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395586/3395586_720p.mp4</video:content_loc>
      <video:duration>120</video:duration>
      <video:publication_date>2026-09-01T23:30:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395585</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395585/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inter 3</video:title>
      <video:description>#Perder #grêmio #grenal</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395585/3395585_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:29:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395584</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395584/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Chuchu na grama da minha mãe</video:title>
      <video:description>Chuchu brincando no gramado da minha mãe #orkidea #gramado</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395584/3395584_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T23:29:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395583</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395583/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>You Won&apos;t Believe This DIY SWAN PLANT POT Made of Cement! 🦢</video:title>
      <video:description>#DIYPlantPot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395583/3395583_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T23:29:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395581</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395581/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Frequência de renascimento  ! Deixe o passado para trás  !</video:title>
      <video:description>Ouça com fone ! Permita - se !</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395581/3395581_720p.mp4</video:content_loc>
      <video:duration>265</video:duration>
      <video:publication_date>2026-09-01T23:28:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395580</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395580/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Perder</video:title>
      <video:description>#Inter #perder</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395580/3395580_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:28:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395579</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395579/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>california</video:title>
      <video:description>california</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395579/3395579_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:28:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395578</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395578/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Reincarnated With OVERPOWERED Abilities After Being BETRAYED By His Family | Anime Recap</video:title>
      <video:description>#animes #usa #frança #brazil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395578/3395578_720p.mp4</video:content_loc>
      <video:duration>3621</video:duration>
      <video:publication_date>2026-09-01T23:28:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395577</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395577/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TORNEIO DE STREET FIHGJTER 2 - TOP 8 E FINAIS- INSANO!</video:title>
      <video:description>The best Street Fighter 2 players in a fierce and brutal battle for the title of best player! #STREETFIGHTER #TURNAMENT</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395577/3395577_720p.mp4</video:content_loc>
      <video:duration>3110</video:duration>
      <video:publication_date>2026-09-01T23:28:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395576</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395576/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lord Cristo</video:title>
      <video:description>The word of God #MyGod</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395576/3395576_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:27:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395575</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395575/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Começo da série pixelmon #1</video:title>
      <video:description>Série de pixelmon no celular</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395575/3395575_720p.mp4</video:content_loc>
      <video:duration>682</video:duration>
      <video:publication_date>2026-09-01T23:27:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395574</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395574/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395574/3395574_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:27:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395573</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395573/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395573/3395573_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:26:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395572</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395572/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Inter 2</video:title>
      <video:description>#Inter #perder</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395572/3395572_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T23:26:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395571</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395571/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395571/3395571_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:26:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395570</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395570/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Músicas SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Dar Força na Caminhada</video:title>
      <video:description>Músicas SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Dar Força na Caminhada #louvor #gospel #sertanejo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395570/3395570_720p.mp4</video:content_loc>
      <video:duration>678</video:duration>
      <video:publication_date>2026-09-01T23:25:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395569</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395569/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Descarta os vidro assim e não vai ter acidente</video:title>
      <video:description>Descarta os vidro assim e não vai ter acidente #Vidro #descartarvidro #acidentecomvídeo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395569/3395569_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T23:25:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395568</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395568/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Raça  negra</video:title>
      <video:description>Raça negra cara um música top #musicapopvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395568/3395568_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T23:25:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395567</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395567/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desenho Naruto Shippuuden</video:title>
      <video:description>Desenho Naruto - ITACHI #Itachi #naruto #NarutoShippuuden #desenho #viral #cut #fyp #foryou #tiktok #eua #brasil #brazil #like #compartilhar</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395567/3395567_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:25:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395566</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395566/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395566/3395566_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:25:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395565</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395565/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Music, ouça com o coração!</video:title>
      <video:description>#musicamusicdeusvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395565/3395565_720p.mp4</video:content_loc>
      <video:duration>137</video:duration>
      <video:publication_date>2026-09-01T23:25:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395564</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395564/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395564/3395564_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:25:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395563</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395563/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Política em campo grande ms</video:title>
      <video:description>Eu minha filha Gabrielly e minha mãe estavamos num evento político #politica #evento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395563/3395563_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T23:25:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395562</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395562/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Locura</video:title>
      <video:description>#Locura #pessoas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395562/3395562_720p.mp4</video:content_loc>
      <video:duration>253</video:duration>
      <video:publication_date>2026-09-01T23:24:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395561</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395561/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funk City Nights – SoundMancerMusic | High Energy American Funk</video:title>
      <video:description>Funk City Nights – SoundMancerMusic When the city lights come alive, the funk takes over the night. “Funk City Nights” is a high-energy American funk track powered by explosive bass, vibrant horns, energetic drums and an irresistible groove made for the dance floor. Flashing lights, a packed crowd and powerful rhythms create a wild nightlife atmosphere where music, passion and movement come together. With energetic male vocals and strong chorus harmonies, “Funk City Nights” delivers pure funk energy from beginning to end. Turn up the bass, feel the horns and let the groove take control. 🎵 Track: Funk City Nights 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #FunkCityNights #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #HighEnergyFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #FunkBass #ExplosiveBass #FunkHorns #HornSection #FunkDrums #DanceMusic #PartyFunk #FunkParty #NightlifeMusic #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395561/3395561_720p.mp4</video:content_loc>
      <video:duration>182</video:duration>
      <video:publication_date>2026-09-01T23:24:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395560</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395560/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>real madrid 8</video:title>
      <video:description>real madrid</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395560/3395560_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T23:24:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395559</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395559/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395559/3395559_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:24:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395558</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395558/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVORES SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Trazer Resposta à Sua Fé</video:title>
      <video:description>LOUVORES SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Trazer Resposta à Sua Fé #GOSPEL #musicas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395558/3395558_720p.mp4</video:content_loc>
      <video:duration>704</video:duration>
      <video:publication_date>2026-09-01T23:24:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395557</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395557/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eles estão passeando</video:title>
      <video:description>Um passeio entre amigos e maravilhoso #Passeio #conversar #amigos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395557/3395557_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T23:24:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395556</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395556/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Foto top</video:title>
      <video:description>A magia das fotos #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395556/3395556_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T23:24:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395555</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395555/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>yuhuuuu</video:title>
      <video:description>yuhuuuu</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395555/3395555_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:24:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395554</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395554/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dragon Ball Z - DBZ</video:title>
      <video:description>Dragon Ball Z 🐉🐲 #DBZ #DragonBallZ #Desenho #viral #cut #gravação #drawing #fyp #foryou #up #like #shorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395554/3395554_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T23:24:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395553</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395553/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395553/3395553_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:24:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395552</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395552/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DcuGgsuJ1RD</video:title>
      <video:description>DcuGgsuJ1RD</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395552/3395552_720p.mp4</video:content_loc>
      <video:duration>64</video:duration>
      <video:publication_date>2026-09-01T23:23:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395551</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395551/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395551/3395551_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:23:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395550</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395550/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Clic Rádio Porto Alegre essa onda é demais.</video:title>
      <video:description>A SUA RÁDIO WEB EM QUALQUER LUGAR #musica #informaçao #educação</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395550/3395550_720p.mp4</video:content_loc>
      <video:duration>117</video:duration>
      <video:publication_date>2026-09-01T23:23:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395549</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395549/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Contração</video:title>
      <video:description>Fazendo caicharia #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395549/3395549_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T23:23:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395548</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395548/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>uda makan belum ya</video:title>
      <video:description>uda makan belum ya</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395548/3395548_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:23:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395547</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395547/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natal 6</video:title>
      <video:description>#Natal #criança #papaiNoel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395547/3395547_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:23:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395546</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395546/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395546/3395546_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:23:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395545</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395545/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Desenho - Spider Man - Homen Aranha</video:title>
      <video:description>Spider Man 🕷️🕸️ #Spiderman</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395545/3395545_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T23:22:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395544</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395544/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Video_by_inabo_la</video:title>
      <video:description>Video_by_inabo_la</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395544/3395544_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T23:22:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395542</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395542/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natal 5</video:title>
      <video:description>#Natal #criança</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395542/3395542_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:21:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395541</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395541/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>He Always Acted Like a Useless Boy, But Secretly He Was the Strongest Warrior in the World</video:title>
      <video:description>#animes #china #frança</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395541/3395541_720p.mp4</video:content_loc>
      <video:duration>1500</video:duration>
      <video:publication_date>2026-09-01T23:21:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395540</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395540/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As vogais</video:title>
      <video:description>Vamos aprender as vogais #Educação</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395540/3395540_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T23:21:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395539</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395539/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bastidores Universo dos Fãs 2</video:title>
      <video:description>PodCast #Entretenimento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395539/3395539_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-01T23:21:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395538</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395538/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alasan Tottenham membeli Savinho dengan sangat mahal 🤯</video:title>
      <video:description>#bola</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395538/3395538_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-01T23:21:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395537</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395537/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jogos gta vl</video:title>
      <video:description>Jogos gtavl jogo s gtavl #Jogosvljogosvl</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395537/3395537_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-01T23:20:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395536</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395536/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natal 4</video:title>
      <video:description>#Natal #criança</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395536/3395536_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T23:20:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395535</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395535/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A morning with no big plans, wandering the streets of Porto</video:title>
      <video:description>☕️✨ Which spot is an absolute must for breakfast? 👇🏼 #Porto #fyp #porto #travel #fyp #girl #portugal #portuguesegirl</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395535/3395535_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T23:20:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395534</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395534/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 7</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395534/3395534_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395533</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395533/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>“Toda Noite Lhe Procuro Pelas Ruas”: trecho</video:title>
      <video:description>Uma música apaixonada, cheia de saudade e sentimento. ❤️🎶 Toda noite lhe procuro pelas ruas, tentando encontrar quem não sai do meu pensamento. #JoãoBrito #JoãoBritoBregaxote #TodaNoiteLheProcuroPelasRuas #música #seresta #brega #bregaxote #arrocha #sofrência #músicaromântica #saudade #amor</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395533/3395533_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T23:20:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395532</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395532/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 6</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395532/3395532_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T23:20:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395531</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395531/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 5</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395531/3395531_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395530</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395530/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 4</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395530/3395530_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395529</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395529/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 3</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395529/3395529_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T23:20:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395528</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395528/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨ 2</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395528/3395528_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395527</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395527/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_30.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_30.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395527/3395527_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:20:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395526</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395526/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesona Sederhana, Sulit Dilupakan ✨</video:title>
      <video:description>Bukan hanya tentang kecantikan, tapi juga tentang aura, senyum, dan cara seseorang membawa dirinya. Ada pesona yang tidak perlu berlebihan untuk membuat siapa pun terpikat. ❤️ #wanitacantik</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395526/3395526_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:20:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395525</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395525/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você sabia que a Terra gira a mais de 1.600 km/h?</video:title>
      <video:description>No equador, nosso planeta completa uma rotação a aproximadamente 1.670 km/h, mas nós não sentimos esse movimento porque tudo ao nosso redor — incluindo a atmosfera e os oceanos — se move junto com a Terra. Neste vídeo, descubra como a rotação do planeta funciona, por que a velocidade varia conforme a latitude e como podemos viajar pelo espaço sem perceber esse movimento impressionante. #Espaço #universo #mundo #terra #Brasil #curiosidade</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395525/3395525_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T23:20:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395524</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395524/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_29.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_29.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395524/3395524_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395523</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395523/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Estrada Vazia (Cezar Rodriguez)</video:title>
      <video:description>Uma viola, uma estrada e o silêncio que fala mais que mil palavras. &quot;Estrada Vazia&quot; é aquela moda calma pra escutar olhando pela janela, lembrando de quem foi embora ou pensando na vida sem pressa. Gravada na afinação Cebolão em Ré, com toda simplicidade que a viola caipira pede. deixa nos comentários o que ela te fez lembrar. #Blues #Folk</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395523/3395523_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-01T23:19:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395522</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395522/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_28.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_28.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395522/3395522_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:19:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395521</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395521/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O amigo de he-man enfrentou um dos vilões mais poderosos do rei esqueleto 🎭🎬🍿</video:title>
      <video:description>O amigo de he-man enfrentou um dos vilões mais poderosos do rei esqueleto 🎭🎬🍿 Os melhores filmes de 2026 até 2027 os trechos também são muito legais e bons para você assistir e acompanhar trechos legais de filmes e séries #FilmesLançamentosdefilmesséries</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395521/3395521_720p.mp4</video:content_loc>
      <video:duration>205</video:duration>
      <video:publication_date>2026-09-01T23:19:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395520</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395520/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_27.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_27.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395520/3395520_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:19:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395519</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395519/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395519/3395519_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:19:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395518</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395518/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cavaleiros do zodiaco</video:title>
      <video:description>#Guerrasanta</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395518/3395518_720p.mp4</video:content_loc>
      <video:duration>1240</video:duration>
      <video:publication_date>2026-09-01T23:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395517</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395517/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_26.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_26.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395517/3395517_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:19:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395516</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395516/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relevo</video:title>
      <video:description>#Bitcoin #relevo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395516/3395516_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-01T23:19:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395515</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395515/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395515/3395515_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:19:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395514</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395514/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_25.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_25.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395514/3395514_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:18:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395513</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395513/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395513/3395513_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:18:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395512</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395512/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_24.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_24.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395512/3395512_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:18:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395511</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395511/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pagiiii 2</video:title>
      <video:description>pagiiii</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395511/3395511_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T23:18:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395510</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395510/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_23.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_23.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395510/3395510_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:18:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395509</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395509/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Renovar Sua Confiança</video:title>
      <video:description>SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Renovar Sua Confiança #SERTANEJODAROÇA</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395509/3395509_720p.mp4</video:content_loc>
      <video:duration>682</video:duration>
      <video:publication_date>2026-09-01T23:18:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395508</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395508/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Veo 3</video:title>
      <video:description>#fouryoufypfy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395508/3395508_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T23:18:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395507</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395507/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395507/3395507_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:18:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395506</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395506/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ladies dress 2</video:title>
      <video:description>New arrivals Ladies dress #Ladies</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395506/3395506_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:17:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395505</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395505/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_22.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_22.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395505/3395505_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:17:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395504</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395504/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neymar Jr skills 💀 #football</video:title>
      <video:description>Subscribe! #Football</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395504/3395504_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T23:17:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395503</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395503/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sexy Girl 160</video:title>
      <video:description>So Hot Girl</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395503/3395503_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T23:17:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395502</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395502/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gripe</video:title>
      <video:description>#Gripemel #limão</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395502/3395502_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T23:17:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395501</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395501/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow </video:title>
      <video:description>Mukbang comendo muita comida com torresmo crocante #mukbang #mukbangasmr #mukbangvideo #mukbangshow #mukbangers #Mukbang</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395501/3395501_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:17:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395500</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395500/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_21.mp4</video:title>
      <video:description>NieR Automata (PS5 Pro) 4K 60FPS HDR Gameplay - (Full Game) (A&amp;B Ending)_21.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395500/3395500_720p.mp4</video:content_loc>
      <video:duration>149</video:duration>
      <video:publication_date>2026-09-01T23:17:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395499</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395499/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FUI PARAR AO JAPÃO COM UM ROBÔ GIGANTE?!</video:title>
      <video:description>Imagina você, num domingo à noite, de boa em casa em Niterói, e do nada... PÁ! É abduzida por um robô gigante e vai parar direto no Japão?! 😱🇯🇵 O Japão! O Coração! ❤️🤖 Fui levada pelo Study (um robô com coração de ouro), voei sobre a Tokyo Skytree toda iluminada, fiz yoga no Monte Fuji e até ganhei poderes mágicos! Tudo isso embalado com muito humor e um visual cinematográfico 100% criado com Inteligência Artificial lá no Pippit.ai! 🎬✨ Dá o play nessa superprodução e vem viajar comigo! E me conta aqui nos comentários: se um robô gigante aparecesse no seu quarto hoje, para que lugar do mundo você pediria para ir? 👇 #Shorts #Novelinha #Humor #Japão #InteligênciaArtificial #Ficção #Shorts #PippitAI #InteligênciaArtificial #IA #AIVideo #Novelinha #Humor #Comédia #Japão #Tokyo #MonteFuji #Robô #Aventura #Ficção #TextToVideo #Websérie #Entretenimento #Viral #CulturaJaponesa #ContadoresDeHistorias #CriadoraDeConteúdo #Humorista #Roteiro #VídeoCurto #FilmeComIA #ArteDigital #GenerativeAI #ViagemMagica #AnneDeSousa #Shorts #Novelinha #Humor #Japão #InteligênciaArtificial #Ficção #PippitAI #IA #AIVideo #Comédia #Tokyo #MonteFuji #Robô #Aventura #TextToVideo #Websérie #Entretenimento #Viral #CulturaJaponesa #ContadoresDeHistorias #CriadoraDeConteúdo #Humorista #Roteiro #VídeoCurto #FilmeComIA #ArteDigital #GenerativeAI #ViagemMagica #AnneDeSousa #Niterói</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395499/3395499_720p.mp4</video:content_loc>
      <video:duration>52</video:duration>
      <video:publication_date>2026-09-01T23:17:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395498</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395498/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sung Jinwoo vs. The Ant King - Solo Leveling Season 2 | Part 6/8</video:title>
      <video:description>Jinwoo crushes the Ant King like a bug in episode 24! Watch Solo Leveling Season 2 - Arise from the Shadow They say whatever doesn’t kill you makes you stronger, but that’s not the case for the world’s weakest hunter Sung Jinwoo. After being brutally slaughtered by monsters in a high-ranking dungeon, Jinwoo came back with the System, a program only he could see, that’s leveling him up in every way. Now, he’s inspired to discover the secrets behind his powers and the dungeon that spawned them. #SoloLeveling #SoloLevelingSeason2 #Season2Episode24 #SungJinwoo #TheAntKing #SungJinwoovsTheAntKing</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395498/3395498_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-09-01T23:17:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395497</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395497/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amor de IA</video:title>
      <video:description>Tem gente que se apaixona por IA, fica muito tempo no pc #musica #pop #sertanejo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395497/3395497_720p.mp4</video:content_loc>
      <video:duration>229</video:duration>
      <video:publication_date>2026-09-01T23:17:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395496</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395496/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hot China Girl</video:title>
      <video:description>Sexy Girl</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395496/3395496_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T23:17:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395495</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395495/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The vampire diares</video:title>
      <video:description>Diário de um vampiro #Thevampirediares</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395495/3395495_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T23:16:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395494</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395494/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES KONG VS TUBARÕES A BATALHA DOS GIGANTES</video:title>
      <video:description>REINO DOS TUBARÕES KONG VS TUBARÕES A BATALHA DOS GIGANTES ALGO MONSTRUOSO DESPERTOU NAS PROFUNDEZAS... #Kong #Godzilla #MonstrosGigantes #TubarãoGigante #OceanoProfundo #Kaiju #MonsterVerse #BatalhaÉpica #CriaturasMarinhas #FilmeCinematográfico #TerrorNoOceano #Tempestade #KongVsShark #SeaMonster #EpicBattle #Ação #Suspense #Mistério #MonstroMarinho #4K Kong enfrentou milhões de tubarões devoradores de metal em uma batalha brutal no meio do oceano durante uma tempestade apocalíptica. ⚡🦈 Mas o verdadeiro terror estava escondido nas profundezas... Neste vídeo cinematográfico você vai testemunhar: 🔥 batalhas épicas 🌊 criaturas marinhas gigantes ⚡ tempestades monstruosas 💀 predadores assustadores 👑 a luta do verdadeiro rei dos monstros Prepare-se para uma experiência intensa cheia de tensão, ação e criaturas colossais em um oceano dominado pelo medo. 📌 Assista até o final para descobrir qual criatura fez até Kong hesitar. 👍 Deixe seu like 🔔 Inscreva-se no canal 🔥 Ative o sino para mais vídeos épicos de monstros gigantes e mistérios do oceano. #kongvsshark #kongvsgiantshark #kongoceanbattle #giantshark #megashark #kongedit #kong4k #epickongbattle #monsterfight #giantcreature #deepseamonster #scaryoceancreatures #apocalypticocean #kongcinematic #kongtrailer #epicmonster #kongvsseamonster #tubarãogigante #kongvstubarão #monstromarinho #oceanoprofundo #batalhaépica #tempestadenooceano #criaturasgigantes #terrornooceano #monstrosdooceano #criaturasassustadoras</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395494/3395494_720p.mp4</video:content_loc>
      <video:duration>442</video:duration>
      <video:publication_date>2026-09-01T23:16:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395493</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395493/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Renovar Sua Fé</video:title>
      <video:description>SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Renovar Sua Fé #LOUVORESGOSPEL</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395493/3395493_720p.mp4</video:content_loc>
      <video:duration>673</video:duration>
      <video:publication_date>2026-09-01T23:16:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395492</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395492/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wandinha 6</video:title>
      <video:description>Wandinha #Wandinha</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395492/3395492_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:16:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395491</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395491/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jesus Cristo abençoe sempre</video:title>
      <video:description>Quem ama jesus ajunda</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395491/3395491_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-01T23:16:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395490</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395490/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Home Made Lays Chips</video:title>
      <video:description>My Favourite Chips</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395490/3395490_720p.mp4</video:content_loc>
      <video:duration>417</video:duration>
      <video:publication_date>2026-09-01T23:16:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395489</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395489/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piadas 7</video:title>
      <video:description>#Piadas #rizada</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395489/3395489_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T23:16:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395488</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395488/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Prettylittleliars</video:title>
      <video:description>Prettylittleliars #Prettylittleliars</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395488/3395488_720p.mp4</video:content_loc>
      <video:duration>152</video:duration>
      <video:publication_date>2026-09-01T23:15:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395487</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395487/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O guerreiro desse cara caiu numa armadilha que o velho preparou para ele cabana 🎭🎬🍿</video:title>
      <video:description>O guerreiro desse cara caiu numa armadilha que o velho preparou para ele cabana 🎭🎬🍿 #CícerodosSantosSilvafilmescompletosdublados2026</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395487/3395487_720p.mp4</video:content_loc>
      <video:duration>229</video:duration>
      <video:publication_date>2026-09-01T23:15:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395486</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395486/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minhas filhas de 4 patas 🐾</video:title>
      <video:description>Mel fazendo nada 😂 #Dogs</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395486/3395486_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T23:15:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395485</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395485/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diario de um vampiro</video:title>
      <video:description>Katherine #Thevampirediares</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395485/3395485_720p.mp4</video:content_loc>
      <video:duration>104</video:duration>
      <video:publication_date>2026-09-01T23:15:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395484</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395484/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Louvor e adoração</video:title>
      <video:description>Louvor #LouvoreadoraçãopalavradeDeus</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395484/3395484_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:15:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395483</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395483/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wandinha 5</video:title>
      <video:description>Wandinha #Wandinha</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395483/3395483_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:15:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395482</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395482/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lucas paiva x Touro Asteca, cia 2 M.  Lucas Paiva vs. Asteca Bull, 2M Company</video:title>
      <video:description>Lucas paiva x Touro Asteca, cia 2 M. Lucas Paiva vs. Asteca Bull, 2M Company</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395482/3395482_720p.mp4</video:content_loc>
      <video:duration>110</video:duration>
      <video:publication_date>2026-09-01T23:15:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395481</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395481/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_700.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_700.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395481/3395481_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:14:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395480</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395480/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bastidores PodCast Universo dos Fãs</video:title>
      <video:description>Alegria geral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395480/3395480_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T23:14:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395479</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395479/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_699.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_699.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395479/3395479_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:14:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395478</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395478/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Noite 2</video:title>
      <video:description>#Noite #luz</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395478/3395478_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T23:14:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395477</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395477/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bassline Boogie – SoundMancerMusic | American Funk</video:title>
      <video:description>Bassline Boogie – SoundMancerMusic Turn up the bass, feel the groove and let the funk take over the dance floor. “Bassline Boogie” is an energetic American funk track driven by a powerful bassline, vibrant horns, punchy drums and an irresistible dance groove. From the first beat to the final horn blast, the track brings the spirit of a packed funk party to life. Groovy rhythms, energetic male vocals and catchy chorus harmonies create a sound made for dancing, moving and having a good time. If you love funky basslines, powerful horns and classic dance-floor energy, “Bassline Boogie” is ready to bring the groove. 🎵 Track: Bassline Boogie 🎵 Artist: SoundMancerMusic 🎵 Genre: Funk / American Funk / Dance Funk 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original funk, dance and international music from SoundMancerMusic. #BasslineBoogie #SoundMancerMusic #Funk #FunkMusic #AmericanFunk #DanceFunk #FunkyMusic #FunkGroove #FunkyGroove #BasslineFunk #FunkBass #GroovyBassline #FunkHorns #HornSection #FunkDrums #DanceMusic #PartyFunk #FunkParty #GrooveMusic #MaleFunkVocal #ClassicFunk #OriginalFunkMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395477/3395477_720p.mp4</video:content_loc>
      <video:duration>230</video:duration>
      <video:publication_date>2026-09-01T23:14:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395476</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395476/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_698.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_698.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395476/3395476_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:14:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395475</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395475/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_697.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_697.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395475/3395475_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:13:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395474</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395474/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_696.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_696.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395474/3395474_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:13:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395473</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395473/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Natal 3</video:title>
      <video:description>#Natal #criança</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395473/3395473_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T23:13:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395472</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395472/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As músicas que fazem sucesso na Clic Rádio Porto Alegre</video:title>
      <video:description>Uma seleção de músicas criadas com IA na Clic Rádio Porto Alegre. Muito mais em www.clicradioportoalegre.com.br #musica #cantor #pop</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395472/3395472_720p.mp4</video:content_loc>
      <video:duration>1720</video:duration>
      <video:publication_date>2026-09-01T23:13:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395471</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395471/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_695.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_695.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395471/3395471_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:13:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395470</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395470/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pirlo : The Italian Magician 🔥🥶</video:title>
      <video:description>FC Mobile Review #FCMobile</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395470/3395470_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T23:13:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395469</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395469/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>My friend coffee</video:title>
      <video:description>Starting another day with my hot coffee. #felicidades #hábitos #cultura</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395469/3395469_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:13:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395468</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395468/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>pagiiii</video:title>
      <video:description>pagiiii</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395468/3395468_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:13:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395466</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395466/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_694.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_694.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395466/3395466_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:12:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395465</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395465/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ o pai do Lobão e meu avô colocou nós para trabalhar</video:title>
      <video:description>GTA o pai do Lobão e meu avô colocou nós para trabalhar por ter pegado mais que eu mando áudio #gtahistóriaLobãoGTAhistóriaCJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395465/3395465_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T23:12:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395464</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395464/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bitcoin 11</video:title>
      <video:description>#Bitcoin #farmar</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395464/3395464_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T23:12:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395463</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395463/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_693.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_693.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395463/3395463_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:12:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395462</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395462/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FUSCA GIRASSOL 🌻</video:title>
      <video:description>Atravessando a ponte com a melhor energia (e a maior bagunça)! 🌻🚗 Quem você coloca no banco de trás do Fusca Girassol pra cantar e bater palma com a Anne e a Beijinha? Já marca sua dupla de carona aqui nos comentários! 👇✨ Fusca Girassol 🌻🚗 ​Letra de Anne de Sousa Produção do clipe Gemini pippitai sunoai Eh eh eh! Hey hey hey! Anne e Beijinha chegaram! No Fusca Girassol! ​Na praia eu vou dançar Com você pra passear Lá lá lá lá lá! O vento sopra feliz E o Rio canta assim: “Vem sorrir! Vem cantar!” ​Gira gira girassol Brilha brilha feito o sol Bate palma sem parar Que o mambo vai começar! ​Fusca Girassol! Olê olá! Anne e Beijinha vão dançar! Hey! Hey! Pela praia a brincar! ​Fusca Girassol! Vem rodar! Todo mundo a celebrar! Bate palma sem parar! ​Ô ô ô! Hey hey hey! ​No céu estrelas no ar Lá lá lá! No Fusca Girassol! ​#fusca #riodejaneiro #trends #comedia #fuscagirassol #beijinhapopples #annedesousa #humorbrasil #comediabrasileira #fusca #rj #niteroi #errejota #musicacomica #sunoai #clipemusical #trends #humor #praia #passeio #mambo #diversao #carona #amigos #riodejaneiro #icarai #musicaautoral #funny #comedy #viral #reels #tiktok #shorts #musicvideo #roadtrip #fun #happy #goodvibes #lifestyle #contentcreator #show #entertainment #trendalert #humorleve #sun #chill #party #dance #sing</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395462/3395462_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-01T23:12:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395461</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395461/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ZYNTHERA – Midnight Without You  Official Music Video</video:title>
      <video:description>Enter the night with ZYNTHERA and “Midnight Without You” — a powerful rock song about loneliness, memories, and the feeling of missing someone when the world goes silent. Turn up the volume, feel the atmosphere, and let the night take you somewhere else. 🎵 Artist: ZYNTHERA 🎵 Song: Midnight Without You 🎬 Official Music Video If you enjoy rock, emotional songs, powerful guitars and atmospheric music, follow ZYNTHERA for more original releases. Listen to ZYNTHERA: Available on major music platforms. #ZYNTHERA #MidnightWithoutYou #ZYNTHERAMidnightWithoutYou #rockmusic #rocksong #originalmusic #officialmusicvideo #emotionalrock #melodicrock #guitarrock #newrockmusic #alternativerock #rockband #musicvideo #originalsong #internationalmusic #emotionalmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395461/3395461_720p.mp4</video:content_loc>
      <video:duration>300</video:duration>
      <video:publication_date>2026-09-01T23:12:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395460</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395460/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PROTEÇÃO CONTRA INCENDIO NA KOMBI</video:title>
      <video:description>Neste vídeo faço um dispositivo de proteção no Carburador da Kombi para proteger de pegar fogo e muito bom prevenir sempre sejam bem vindos ao nossos vídeos #ProteçãoCarburadorcontraincendioKombihomeprevençãofogo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395460/3395460_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-01T23:12:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395459</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395459/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_692.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_692.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395459/3395459_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395458</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395458/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A garota contratou o melhor espadachim para levar ela até a muralha 🎭🎬🍿</video:title>
      <video:description>A garota contratou o melhor espadachim para levar ela até a muralha 🎭🎬🍿 Aqui nós temos melhores filmes e séries de 2026 e etc 🎭🎬🍿 #CícerodosSantosSilva</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395458/3395458_720p.mp4</video:content_loc>
      <video:duration>293</video:duration>
      <video:publication_date>2026-09-01T23:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395457</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395457/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_691.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_691.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395457/3395457_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:12:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395456</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395456/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ eu e o Lobão fomos pego formando Áurea na praça</video:title>
      <video:description>GTA eu e o Lobão fomos pega o formando água na praça #cjLobãoGTASanAndreashistóriaCJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395456/3395456_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T23:11:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395455</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395455/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_690.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_690.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395455/3395455_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:11:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395454</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395454/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_689.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_689.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395454/3395454_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:11:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395453</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395453/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Oração 5</video:title>
      <video:description>#Papa #oração #reza</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395453/3395453_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T23:11:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395452</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395452/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_688.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_688.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395452/3395452_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:11:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395451</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395451/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Promaq Serralheria</video:title>
      <video:description>Tudo sobre serralheria, e caldeiraria #Serralheria</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395451/3395451_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:11:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395450</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395450/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐭🧀 RATOLÂNDIA - EP 01: A Grande Fuga do Queijo! 🧀🐭</video:title>
      <video:description>Erick é só um ratinho tentando sobreviver mais um dia no Beco da Lata Furada... até que seu primo Mayke aparece com um &quot;presentinho&quot; que vai virar um baita problema! 😱 Quando um pedaço de queijo muito especial (e muito procurado 👀) para nas mãos de Erick, ele descobre que às vezes um desejo pode dar MUITO errado. Com os capangas do temido Gran-Queijo em seu encalço, Erick vai precisar de muita coragem (e um pombo muito paciente 🐦) para escapar dessa! Prepare-se para uma perseguição maluca pelos telhados da cidade, cheia de sustos engraçados e muita correria! 🏙️💨 ✨ Vem descobrir se Erick vai conseguir escapar dos vilões mais barulhentos de Ratolândia! ✨ 👉 Não esqueça de deixar seu like e se inscrever para não perder o próximo episódio de RATOLÂNDIA! #RatolandiaDesenhoAnimadoAventuraParaCriancasAnimacao</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395450/3395450_720p.mp4</video:content_loc>
      <video:duration>153</video:duration>
      <video:publication_date>2026-09-01T23:10:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395449</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395449/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_687.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_687.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395449/3395449_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:10:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395448</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395448/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CJ eu e o Lobão estamos formando água na praça</video:title>
      <video:description>GTA eu e o Lobão estamos formando hora na praça aí chega meu pai e o pai do Lobão o avô tiringa #gtaLobãohistóriaGTAhistóriaCJ</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395448/3395448_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T23:10:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395447</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395447/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Whoever Leaves the Mansion Last Gets to Keep It!</video:title>
      <video:description>Imagine morar em uma mansão com desconhecidos por meses! #mrbeastmansionfyp</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395447/3395447_720p.mp4</video:content_loc>
      <video:duration>3471</video:duration>
      <video:publication_date>2026-09-01T23:10:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395446</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395446/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_686.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_686.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395446/3395446_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:10:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395445</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395445/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Burocracia (Cezar Rodriguez)</video:title>
      <video:description>&quot;Burocracia&quot; é um blues rock afiado que transforma filas, carimbos, papéis e a lentidão do sistema em música. A canção retrata o desgaste de quem precisa enfrentar a máquina burocrática no dia a dia. Composição da banda Barba Ruiva, a música mistura humor, inconformismo e a essência do blues para falar de um problema que todo mundo já viveu. Se você já perdeu tempo entre protocolos, assinaturas e repartições, essa música foi feita para você. 🎸 Composição: Rafael Figueira (Barba Ruiva) 🎤 Interpretação: Cezar Rodriguez #Blues #Rock</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395445/3395445_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-01T23:10:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395444</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395444/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_685.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_685.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395444/3395444_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:10:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395443</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395443/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_684.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_684.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395443/3395443_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:09:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395442</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395442/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai dj</video:title>
      <video:description>linda dj na praia #djpraia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395442/3395442_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T23:09:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395441</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395441/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5°dia de produção</video:title>
      <video:description>Resultado de criação 🐣🐣🪿🪿🐓🐓✅️✅️✅️ #Animaisavesalimentos</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395441/3395441_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T23:09:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395440</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395440/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_683.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_683.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395440/3395440_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:09:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395439</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395439/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Different Princess EP08 / 不同的公主</video:title>
      <video:description>故事講述了女作家華清歌誤入自己小說的世界，變成了一個卑鄙的配角。她以為掌控劇本就能扭轉乾坤，卻沒想到遭遇了一連串的曲折，最後與季初展開了一段充滿愛恨糾葛的劇情。</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395439/3395439_720p.mp4</video:content_loc>
      <video:duration>2053</video:duration>
      <video:publication_date>2026-09-01T23:09:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395438</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395438/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_682.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_682.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395438/3395438_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:09:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395437</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395437/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fast 💀 #football #soccer</video:title>
      <video:description>Subscribe! #Football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395437/3395437_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T23:09:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395436</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395436/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai 5</video:title>
      <video:description>linda no banho #lora</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395436/3395436_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T23:09:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395435</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395435/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_681.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_681.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395435/3395435_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:08:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395434</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395434/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai 4</video:title>
      <video:description>linda lora</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395434/3395434_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T23:08:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395433</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395433/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Arroz com linguiça de um jeito diferente</video:title>
      <video:description>Receitas facil e facil para seu almoço com arroz e linguiça! #Arroz #almoça #comida #comidinha #receitas #food #receitasfáceiserápidas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395433/3395433_720p.mp4</video:content_loc>
      <video:duration>276</video:duration>
      <video:publication_date>2026-09-01T23:08:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395432</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395432/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_680.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_680.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395432/3395432_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:08:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395431</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395431/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 Rural Woman: A Simple Life, Strong Roots 3</video:title>
      <video:description>Welcome to the beautiful life of a rural woman 🌻🌾. Here, you will find the daily routine of the countryside, hard work, simple moments, love for nature, homemade food, and the strength of a woman who is proud of her roots 🚜💚. Follow along and experience the peaceful and authentic beauty of country life! ✨ #RuralWoman🌾 #CountryLife🚜 #FarmLife🌱 #SimpleLife🍃 #CountryGirl🌻 #WomanOfTheFarm💪 #RuralLifestyle🌞 #LifeOnTheFarm🐓 #NatureLovers🌿 #CountryLiving💚</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395431/3395431_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:08:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395430</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395430/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai 3</video:title>
      <video:description>linda loira na piscina #blondie</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395430/3395430_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T23:08:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395429</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395429/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_679.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_679.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395429/3395429_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:08:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395428</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395428/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_678.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_678.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395428/3395428_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:07:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395427</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395427/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GRANDE FINAIS STREET FIGHTER 2 HYPER -PECO X FLAVIU RYU!!</video:title>
      <video:description>The world&apos;s best players in a fierce and brutal battle for the title of best player!</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395427/3395427_720p.mp4</video:content_loc>
      <video:duration>1204</video:duration>
      <video:publication_date>2026-09-01T23:07:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395426</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395426/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Synth Horizon – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Synth Horizon – SoundMancerMusic Enter a world of powerful synths, massive beats and unstoppable electronic energy. “Synth Horizon” is a high-energy EDM track driven by pulsing basslines, vibrant synthesizers and a powerful drop built for the dance floor. Explosive lights, laser beams and waves of electronic sound create an electrifying festival atmosphere as the energy keeps rising through the night. With energetic male vocals and strong chorus harmonies, “Synth Horizon” delivers a powerful journey from the first beat to the final moments before sunrise. Made for EDM fans, festivals, rave nights, parties and high-energy dance floors. 🎵 Track: Synth Horizon 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #SynthHorizon #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #Bassline #ElectronicBeat #VibrantSynths #SynthMusic #LaserShow #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395426/3395426_720p.mp4</video:content_loc>
      <video:duration>189</video:duration>
      <video:publication_date>2026-09-01T23:07:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395425</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395425/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES:  O PEQUENO TUBARÃO ANÃO A PEQUENA CRIATURA QUE ILUMINA AS PROFUNDEZAS DO OCEANO</video:title>
      <video:description>Reino dos Tubarões O PEQUENO TUBARÃO QUE ILUMINA AS PROFUNDEZAS TUBARÃO ANÃO DOCUMENTÁRIO DWARF LANTERNSHARK: O PEQUENO TUBARÃO QUE ILUMINA AS PROFUNDEZAS Nas regiões mais profundas e misteriosas dos oceanos do planeta, onde a luz do Sol desaparece completamente e a escuridão domina cada centímetro da água, vive uma criatura tão pequena quanto extraordinária. Um predador quase desconhecido do grande público, mas que possui uma habilidade capaz de desafiar a própria escuridão. Estamos falando do Dwarf Lanternshark, um dos menores tubarões já descobertos pela ciência. Seu nome científico é Etmopterus perryi, e apesar de seu tamanho reduzido, ele faz parte de um dos grupos mais fascinantes de tubarões das profundezas. Prepare-se para conhecer a incrível história de um pequeno sobrevivente que transformou a escuridão em sua maior aliada. Nome comum e científico O Dwarf Lanternshark, conhecido em português como Tubarão-Lanterna-Anão, pertence à família Etmopteridae, um grupo de tubarões famosos por possuírem órgãos capazes de produzir luz. Seu nome científico, Etmopterus perryi, foi oficialmente descrito em 1985. Embora seja considerado um verdadeiro tubarão, sua aparência é bastante diferente daquela dos grandes predadores que costumamos imaginar. Seu corpo é fino, alongado e adaptado para sobreviver em ambientes de pouca luz, onde quase nenhum outro animal consegue prosperar. Habitat e distribuição O Tubarão-Lanterna-Anão habita águas profundas do Oceano Atlântico Ocidental. Ele é encontrado principalmente próximo às costas da Venezuela e da Colômbia, em áreas do Mar do Caribe. Seu lar fica entre aproximadamente 280 e 450 metros de profundidade, uma região conhecida como zona mesopelágica. Nessas profundezas, a luz solar praticamente desaparece. A temperatura é baixa. A pr</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395425/3395425_720p.mp4</video:content_loc>
      <video:duration>287</video:duration>
      <video:publication_date>2026-09-01T23:07:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395424</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395424/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_677.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_677.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395424/3395424_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:07:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395423</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395423/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bitelo levantando peso!</video:title>
      <video:description>Bitelo rumo ao campeonato de powerlift! #bitelopowerliftgymbitelopowerliftgym</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395423/3395423_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T23:06:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395422</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395422/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_676.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_676.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395422/3395422_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:06:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395421</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395421/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR DE ADORAÇÃO QUE VAI EDIFICA SUA FÉ | INSPIRADO |JULLIANY SOUZA | INÉDITA 2026 PLAY GOSPEL</video:title>
      <video:description>Um canal dedicado a espalhar a Palavra de Deus através da música gospel. Louvores que edificam, fortalecem a fé e enchem o coração de esperança. Que cada canção seja um encontro com Deus! 🙏✨ #louvorvidaeternaadoração</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395421/3395421_720p.mp4</video:content_loc>
      <video:duration>261</video:duration>
      <video:publication_date>2026-09-01T23:06:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395420</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395420/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminhão</video:title>
      <video:description>#Caminhão #acidente</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395420/3395420_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T23:06:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395418</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395418/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_675.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_675.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395418/3395418_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:05:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395417</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395417/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>💙The Best Thing🌷| Episode 1【FULL】Zhang Linghe, Xu Ruohan | iQIYI Philippines</video:title>
      <video:description>Zhang Linghe, Xu Ruohan</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395417/3395417_720p.mp4</video:content_loc>
      <video:duration>2551</video:duration>
      <video:publication_date>2026-09-01T23:05:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395416</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395416/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vinho</video:title>
      <video:description>#Vinho #canela</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395416/3395416_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T23:05:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395414</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395414/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_674.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_674.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395414/3395414_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:05:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395413</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395413/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_673.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_673.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395413/3395413_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:04:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395412</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395412/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>📉 The biggest MISTAKE ❌with MONEY you made TODAY</video:title>
      <video:description>O maior erro com dinheiro que cometeste hoje… (e nem sequer te apercebeste!) ⚠️💸 Não foi simplesmente gastar 🛍️. Foi gastar sem intenção! 🧠❌ 👑 Ricos: Têm uma intenção clara para cada euro que sai da carteira 💶🎯. 🏃‍♂️ Pobres: Deixam-se levar pelo impulso e pelo momento 💸⚡. 👇 O que é que dominou o teu dia de hoje? Comenta &quot;INTENÇÃO&quot; 🎯 ou &quot;IMPULSO&quot; ⚡! 💬👀 🔗 LANÇAMENTO BREVEMENTE 📲🔥 Segue o perfil se queres aprender a dominar o teu dinheiro em 2026/27! 🚀💰 📉 The biggest mistake with money you made today... (and you didn&apos;t even realize it!) ⚠️💸 It wasn&apos;t just spending 🛍️. It was spent unintentionally! 🧠❌ 👑 Rich: They have a clear intention for every euro that comes out of the wallet 💶🎯. 🏃‍♂️ Poor: They let themselves be carried away by the impulse and the moment 💸⚡. 👇 What dominated your day today? Comment &quot;INTENTION&quot; 🎯 or &quot;IMPULSE&quot; ⚡! 💬👀 🔗 LAUNCH SOON 📲🔥 Follow the profile if you want to learn how to master your money in 2026/27! 🚀💰 #Financefreedom #money #mindset</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395412/3395412_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T23:04:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395411</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395411/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_672.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_672.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395411/3395411_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:03:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395410</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395410/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amanda beraktivitas</video:title>
      <video:description>Amanda manopo cantik beraktivitas #Hiburan #shoping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395410/3395410_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-01T23:03:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395409</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395409/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TAN TAN TAN , YOUR HEART - DJ LKS RIT INTERNACIONAL - VIDEO LETRA</video:title>
      <video:description>TAN TAN TAN , YOUR HEART - DJ LKS RIT INTERNACIONAL - VIDEO LETRA #musicas #musicasinternacionais #amor #topsounds #love #djlksrit</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395409/3395409_720p.mp4</video:content_loc>
      <video:duration>227</video:duration>
      <video:publication_date>2026-09-01T23:03:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395408</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395408/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏆 Bora caçar verificados! 12</video:title>
      <video:description>🐎⚔️ CAÇADOR DE VERIFICADOS — MONTADO NO CAVALO! Bem-vindo à minha caçada! Não sou pro, não jogo perfeito, mas tenho o MELHOR parceiro do jogo: MEU CAVALO! 🐎 Lutando, caçando verificados e subindo rumo ao Desafiante — montado o tempo todo! Sem enrolação, só ação! 🔔 Se inscreve pra acompanhar eu e meu cavalo na próxima caçada! 👍 Curte se você também já jogou de cavalo! 💬 Comenta: &quot;Cavalo é vida!&quot; 🐎 #Desviral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395408/3395408_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T23:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395407</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395407/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Dua 14</video:title>
      <video:description>Ameen</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395407/3395407_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T23:03:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395406</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395406/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_671.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_671.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395406/3395406_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:03:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395405</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395405/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milho</video:title>
      <video:description>#Milho #colher</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395405/3395405_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T23:03:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395404</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395404/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Templo Onde o Passado Ainda Respira</video:title>
      <video:description>Há lugares onde a pedra parece guardar mais do que histórias. Entre templos antigos, perfumes no ar e o som dos sinos, existe uma sensação difícil de explicar… como se o passado ainda estivesse respirando. Talvez alguns lugares não tenham sido feitos apenas para serem vistos. Talvez tenham sido feitos para serem sentidos. Poesia Ancestral — onde o tempo deixa de falar… e começa a sussurrar #PoesiaAncestralOrbisRevelaMistériosAntigosTemplosAntigosHistóriaAntigaCivilizaçõesAntigasMistériosDaHistóriaArqueologiaShorts</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395404/3395404_720p.mp4</video:content_loc>
      <video:duration>49</video:duration>
      <video:publication_date>2026-09-01T23:02:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395403</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395403/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🐸 IA 03</video:title>
      <video:description>Música 🎸🎷</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395403/3395403_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T23:02:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395402</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395402/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Puskas winner 2020 💀 #edit #puskas #football</video:title>
      <video:description>Subscribe! #football</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395402/3395402_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T23:02:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395401</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395401/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic Video 119</video:title>
      <video:description>Heart Touch Video</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395401/3395401_720p.mp4</video:content_loc>
      <video:duration>433</video:duration>
      <video:publication_date>2026-09-01T23:02:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395400</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395400/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 CAOS TOTAL NO EQUADOR! MOTIM EM PRESÍDIO PROVOCA CENAS DE GUERRA E OPERAÇÃO DAS FORÇAS DE SEGURANÇ</video:title>
      <video:description>⚠️ Momentos de extrema tensão foram registrados em um centro penitenciário do Equador, onde um grupo de detentos teria iniciado um violento motim, provocando cenas de caos dentro da unidade. 🚔 As forças de segurança realizaram uma grande operação para tentar retomar o controle do presídio, enquanto a situação se agravava e mobilizava equipes especializadas. 😨 Imagens que circulam nas redes sociais mostram o clima de tensão e reforçam a grave crise enfrentada pelo sistema penitenciário equatoriano. 🚨 Até o momento, as autoridades ainda não confirmaram oficialmente todos os detalhes sobre a origem da rebelião nem o balanço completo das consequências. A ocorrência segue sendo acompanhada. 👇 Na sua opinião, o que está por trás da crise nos presídios do Equador? 💬 Deixe sua opinião nos comentários. 🔁 Compartilhe esta notícia para manter mais pessoas informadas. 📲 Siga a página para acompanhar notícias policiais, flagrantes e acontecimentos que repercutem no Brasil e no mundo. #Piaui40graus #equador #motim #presídio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395400/3395400_720p.mp4</video:content_loc>
      <video:duration>106</video:duration>
      <video:publication_date>2026-09-01T23:02:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395399</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395399/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Levantando peso</video:title>
      <video:description>Vida de atleta é na academia também.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395399/3395399_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T23:02:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395398</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395398/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Peternakan Super Jenius versi PLUSTOTO4D</video:title>
      <video:description>Peternakan Super Jenius #faktaunik #shorts #fyp #reels link utama = https://plustoto4d.link/ alternatif 1. https://plustoto4d.mssg.me/ 2. https://heylink.me/4dplustoto versi PLUSTOTO4D</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395398/3395398_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T23:02:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395396</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395396/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Milton pls 3</video:title>
      <video:description>Milton #Milton</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395396/3395396_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-01T23:01:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395395</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395395/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fazendo recorte perfeito</video:title>
      <video:description>Azulegista #Conduçãoobrasserviço</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395395/3395395_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T23:01:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395394</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395394/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😂🚨 VÍDEO VIRALIZA! VOCÊ JÁ CONHECIA A “BRINCADEIRA DO LAMBE E CHEIRA”? 😱</video:title>
      <video:description>A “BRINCADEIRA DO LAMBE E CHEIRA”? 😱 🎥 Uma brincadeira chamada “lambe e cheira” está chamando a atenção nas redes sociais e despertando a curiosidade de muita gente. O vídeo rapidamente ganhou repercussão e já está rendendo comentários, risadas e opiniões diferentes entre os internautas. 👀 Afinal, o que será que tem nessa brincadeira que está fazendo tanta gente parar para assistir? 👇 Você já conhecia a brincadeira do “lambe e cheira”? 😂 Já viu esse vídeo? Conte nos comentários o que achou! #LambeECheirBrincadeiraViral #VideoViral #Viralizou #Piaui40Graus</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395394/3395394_720p.mp4</video:content_loc>
      <video:duration>70</video:duration>
      <video:publication_date>2026-09-01T23:00:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395393</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395393/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deus tem uma palavra pra você</video:title>
      <video:description>E um vídeo religioso, gospel, evangélicos #Religioso #evangelho #cristão #fé #graças</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395393/3395393_720p.mp4</video:content_loc>
      <video:duration>405</video:duration>
      <video:publication_date>2026-09-01T23:00:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395392</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395392/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 Nama Tempat paling panjang di dunia!! nomer 3 sampe ada lagu nya versi PLUSTOTO4D</video:title>
      <video:description>3 Nama Tempat paling panjang di dunia!! nomer 3 sampe ada lagu nya #shorts #fyp #reels link utama = https://plustoto4d.link/ alternatif 1. https://plustoto4d.mssg.me/ 2. https://heylink.me/4dplustoto versi PLUSTOTO4D</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395392/3395392_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T23:00:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395391</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395391/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>After Losing Everything, He Trains To Become The STRONGEST | New Anime Recap</video:title>
      <video:description>#anime #china #usa #coréia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395391/3395391_720p.mp4</video:content_loc>
      <video:duration>3855</video:duration>
      <video:publication_date>2026-09-01T23:00:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395390</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395390/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bolivian Lucha Libre: The Most Extreme Wrestling Show in the Andes! 🇧🇴🔥</video:title>
      <video:description>Experience the incredible world of Bolivian Lucha Libre, where fearless masked wrestlers deliver breathtaking action high in the Andes Mountains. Witness spectacular moves, colorful characters, and the unique culture that makes Bolivia&apos;s wrestling scene unlike anything else on Earth. If you enjoy wrestling, action, and cultural adventures, don&apos;t forget to Like, Subscribe, and Share for more amazing content! #BolivianLuchaLibre #LuchaLibre #Bolivia #Wrestling #MaskedWrestlers #ProWrestling #Andes #ExtremeSports #TravelBolivia #FightNight #WWE #AAA</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395390/3395390_720p.mp4</video:content_loc>
      <video:duration>1228</video:duration>
      <video:publication_date>2026-09-01T22:59:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395389</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395389/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai latina</video:title>
      <video:description>linda latina #latina</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395389/3395389_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:59:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395388</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395388/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>latina gataai</video:title>
      <video:description>linda loira na cozinha #loirablondie</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395388/3395388_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:58:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395387</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395387/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 7</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395387/3395387_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T22:58:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395386</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395386/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES: Shark Kingdom: Prehistoric Shark Species That Science Almost Forgot</video:title>
      <video:description>REINO DOS TUBARÕES: Shark Kingdom: Prehistoric Shark Species That Science Almost Forgot Shark Kingdom: Prehistoric Shark Species That Science Almost Forgot 📖 Descrição do Vídeo (SEO) 🦈 Muito antes dos tubarões modernos dominarem os mares, existiram espécies extraordinárias que desapareceram ao longo de milhões de anos de evolução. Neste documentário, você conhecerá alguns dos tubarões extintos mais fascinantes já descobertos pela ciência. Descubra como viviam, onde habitavam, quais eram suas características únicas e por que desapareceram dos oceanos. Entre espécies raríssimas e pouco conhecidas, esta viagem pela pré-história revela animais impressionantes que ajudaram a moldar a evolução dos tubarões atuais. 🌊 Neste vídeo você vai descobrir: ✅ Espécies de tubarões extintos pouco conhecidas ✅ Como eram esses incríveis predadores marinhos ✅ Curiosidades surpreendentes sobre sua evolução ✅ O que levou essas espécies à extinção ✅ Descobertas feitas por paleontólogos ao redor do mundo Se você gosta de tubarões, animais pré-históricos, fósseis e documentários sobre a vida marinha, este vídeo foi feito para você. 👍 Deixe seu like, inscreva-se no canal e ative o sino para acompanhar novos documentários sobre tubarões, criaturas pré-históricas e os maiores predadores dos oceanos. #tubarõesextintos #tubarõespré-históricos #espéciesdetubarões #tubarãoextinto #megalodonte #tubarõesantigos #vidamarinha #paleontologia #fósseis #tubarõesraros #oceanoprofundo #predadoresmarinhos #evoluçãodostubarões #históriadostubarões #animaisextintos #criaturasmarinhas #megafaunamarinha #documentáriodetubarões #curiosidadessobretubarões #animaispré-históricos #documentário #dinossaurosmarinhos #oceano #ciência #biologiamarinha</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395386/3395386_720p.mp4</video:content_loc>
      <video:duration>334</video:duration>
      <video:publication_date>2026-09-01T22:58:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395385</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395385/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele Fez um Gol Lindo com essa jogada</video:title>
      <video:description>#Futebol</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395385/3395385_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:58:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395384</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395384/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>tanaman loncat? versi PLUSTOTO4D</video:title>
      <video:description>tanaman loncat? #faktaunik #shorts #fyp #reels link utama = https://plustoto4d.link/ alternatif 1. https://plustoto4d.mssg.me/ 2. https://heylink.me/4dplustoto versi PLUSTOTO4D</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395384/3395384_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T22:58:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395383</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395383/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Compilado melhores momentos</video:title>
      <video:description>ASMR Mukbang video #Sem #Mukbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395383/3395383_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T22:58:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395381</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395381/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receitasfit + suplementos para emagrecer Rápido</video:title>
      <video:description>OFERTA ESPECIAL MONJA GOTAS suplemento alimentar que te ajuda e acelera o seu emagrecimento. https://app.coinzz.com.br/checkout/1-unidade-dkrcp-0 PEÇA JÁ O SEU E PAGUE SOMENTE QUANDO O PRODUTO CHEGA NA SUA CASA! LINK AZUL FIXADO NO MEU PERFIL. https://app.coinzz.com.br/checkout/1-unidade-dkrcp-0 #emagreça #dietas #emagrecer #emagrecimento #receitas #fitness #saúde</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395381/3395381_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-01T22:57:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395380</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395380/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How Industrial Cranes Are Made: Inside a Heavy Engineering Factory</video:title>
      <video:description>Ever wondered how massive industrial cranes are made? Take a look inside a heavy engineering factory and follow the manufacturing process — from steel fabrication and structural welding to machining, assembly, painting, and final testing. Industrial cranes are engineered to handle extreme loads while maintaining precision, strength, and reliability. #howindustrialcranesaremade #cranemanufacturing #craneproduction #cranefactory #industrialcranemanufacturing #howcranesaremade #heavycranemanufacturing #overheadcrane #gantrycrane #towercrane #craneconstruction #craneassembly #steelfabrication #structuralwelding #heavyengineering #liftingequipment #industrialequipment #cranecomponents #cranetesting #heavymachinerymanufacturing #steelmanufacturing #industrialmanufacturing #engineering #manufacturingprocess #howitsmade</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395380/3395380_720p.mp4</video:content_loc>
      <video:duration>119</video:duration>
      <video:publication_date>2026-09-01T22:57:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395379</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395379/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVORES SERTANEJO DA ROÇA - Hinos Que Deus Usa Para Falar ao Seu Coração</video:title>
      <video:description>Uma seleção especial de hinos sertanejos da roça para tocar o coração e fortalecer a fé. Louvores que trazem mensagens de esperança, consolo e confiança em Deus para os momentos de luta, reflexão e caminhada. Que cada canção fale profundamente ao seu coração e renove sua esperança na presença de Deus. #LOUOVORESSERTANEJODAROÇA</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395379/3395379_720p.mp4</video:content_loc>
      <video:duration>895</video:duration>
      <video:publication_date>2026-09-01T22:57:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395378</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395378/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Baby Giraffe’s Sunset Adventure 🦒🌅 | Beautiful Wildlife Moment</video:title>
      <video:description>Watch a heartwarming giraffe family explore a vast golden savanna as the sun slowly sets behind the acacia trees. 🦒🌅 The young giraffe’s curious adventure, gentle family moments and peaceful landscape create a beautiful ultra-realistic wildlife experience. #babygiraffe #giraffefamily #giraffeadventure #Africansavanna #wildlifevideo #cuteanimals #sunsetwildlife #naturedocumentary #realisticwildlife #cinematicnature #8Kwildlife #Africananimals #peacefulnature #animalfamily #savannasunset #beautifulwildlife #relaxingnaturevideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395378/3395378_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:57:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395377</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395377/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANACONDA (2026) | Jason Statham &amp; Scott Adkins | Action Thriller Movie | 4K</video:title>
      <video:description>A deadly mission deep in the Amazon turns into a fight for survival when two elite fighters face a monstrous predator. Jason Statham and Scott Adkins battle a giant anaconda in this intense action-thriller concept trailer filled with danger, survival, and explosive moments in the heart of the jungle.#anaconda #jasonstatham #scottadkins #moviesmovierecapfilmmoviehorrorentertainmentHollywoodrecapNetflixDiretrizFilmesLENDASu0026MISTERIOSsciencefictionhorrormoviesthrillermoviesendingexplainedmoviesummaryexplainingmoviesshortfilmsmovierecapsummarizedmoviesAmazonPrimemovievideoscoolmovieshorrorfilmsmovietrailersplusdoomsdaymeteortrailercomingsoontotheaterspremieremovietrailerofficial2025movietrailers</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395377/3395377_720p.mp4</video:content_loc>
      <video:duration>95</video:duration>
      <video:publication_date>2026-09-01T22:57:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395376</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395376/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 6</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395376/3395376_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:57:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395375</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395375/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ASMR Mukbang macarrão</video:title>
      <video:description>#ASMRmacarrão</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395375/3395375_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:56:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395374</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395374/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek cantik 17</video:title>
      <video:description>Cewek cantik manis #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395374/3395374_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:56:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395373</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395373/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Creeper MAIS educado do jogo 😇 (AI Edition)</video:title>
      <video:description>Creepe, você é perigoso? &quot;Não, eu sou um docinho&quot; 😇 O Creeper mais educado do Minecraft em estilo AI Edition. Será que a gente acredita? 😂 Se gostou, deixa o like e se inscreve! #minecraft #minecraftmemes #minecraftbedrock #memes #funnyvideo #humor #comedia #gamer #games #jogos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395373/3395373_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:56:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395372</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395372/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jajan enak</video:title>
      <video:description>Jajan buatan mama juwita #Hiburan #shopping</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395372/3395372_720p.mp4</video:content_loc>
      <video:duration>168</video:duration>
      <video:publication_date>2026-09-01T22:55:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395371</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395371/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mujeres en septiembre va hombre en septiembre</video:title>
      <video:description>#Humor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395371/3395371_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T22:55:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395370</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395370/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Anbe Diana (2026) Hindi Dubbed</video:title>
      <video:description>Anbe Diana (2026) Hindi Dubbed Follows the chaotic love story between a Telugu boy in Perambur and an Anglo Indian girl.Anbae Diana is a simple rom-com about a Telugu boy and an Anglo-Indian girl and the chaos that follows as they try to get married.Cultural differences and family expectations test the chaotic romance of a couple in Chennai. They must overcome unexpected twists to keep their relationship alive. Genre: Comedy, Drama, Dual Audio, Romance, South Special Director: Pari Elavazhagan Actors: Cell Murugan, Chetan, Gopi Aravindh, Nikhila Sankar, Pari Elavazhagan, Ramya Ranganathan, Roja Selvamani Country: India Duration: 133 min Quality: HINDI Release: 2026 IMDb: 5.6 #Comedy #Drama #DualAudio #Romance #SouthSpecial</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395370/3395370_720p.mp4</video:content_loc>
      <video:duration>8392</video:duration>
      <video:publication_date>2026-09-01T22:55:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395369</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395369/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rave Pulse – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Rave Pulse – SoundMancerMusic Feel the pulse, follow the beat and lose yourself in the energy of the rave. “Rave Pulse” is an explosive high-energy EDM track driven by intense synthesizers, deep bass, massive electronic beats and a powerful drop made to ignite the dance floor. Flashing lights, pounding rhythms and a jumping crowd create an electrifying rave atmosphere where the energy keeps rising until dawn. With energetic male vocals and powerful chorus harmonies, “Rave Pulse” delivers pure electronic energy from beginning to end. Made for EDM fans, festivals, rave nights, parties and high-energy dance floors. 🎵 Track: Rave Pulse 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Rave / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #RavePulse #SoundMancerMusic #EDM #EDMMusic #RaveMusic #RaveEDM #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #IntenseSynths #RaveParty #DanceFloor #FestivalMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395369/3395369_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-01T22:55:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395368</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395368/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PBR Brazil!!!!</video:title>
      <video:description>PBR Brazil!!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395368/3395368_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T22:55:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395367</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395367/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing bermain 4</video:title>
      <video:description>Kucing yang lucu bermain #Hiburan #cat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395367/3395367_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T22:54:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395366</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395366/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rosas vermelhas</video:title>
      <video:description>Amor #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395366/3395366_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:54:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395365</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395365/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você so vau querer comer assim agora!!!</video:title>
      <video:description>Receitas fáceis e rápidas de sobremesa #Receitas #sobremesa #comida #food #doce #lancherapido</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395365/3395365_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T22:53:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395364</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395364/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neon Waves – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Neon Waves – SoundMancerMusic Ride the neon waves and let the energy take over the dance floor. “Neon Waves” is an explosive high-energy EDM track powered by intense synthesizers, hard-hitting bass, massive electronic beats and a powerful drop built for the peak of the night. Flashing lights, surging crowds and waves of electronic sound create an electrifying atmosphere where every beat pushes the energy higher. From the first pulse to the final moments before dawn, “Neon Waves” captures the excitement of a massive electronic music celebration. With energetic male vocals and powerful chorus harmonies, this track is made for EDM fans, festivals, parties and high-energy dance floors. 🎵 Track: Neon Waves 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music / Festival EDM 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #NeonWaves #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #IntenseSynths #NeonMusic #NeonEDM #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395364/3395364_720p.mp4</video:content_loc>
      <video:duration>186</video:duration>
      <video:publication_date>2026-09-01T22:53:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395363</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395363/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing imut 6</video:title>
      <video:description>Kucing yang pintar #Hiburan #cat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395363/3395363_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:53:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395362</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395362/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Curious Monkeys in a Magical Mangrove Forest 🐒🌿🦋</video:title>
      <video:description>Step into a stunning tropical mangrove forest where playful capuchin monkeys explore the treetops and discover a beautiful butterfly. 🐒🦋 Surrounded by crystal-clear water, lush greenery and warm morning sunlight, this ultra-realistic wildlife adventure captures the peaceful beauty of nature. #capuchinmonkeys #monkeyadventure #tropicalforest #mangroveforest #wildlifevideo #cuteanimals #butterflynature #tropicalwildlife #natureadventure #realisticwildlife #cinematicnature #8Knaturevideo #peacefulforest #animalexploration #beautifulscenery #wildlifedocumentary #relaxingnaturevideo</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395362/3395362_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:53:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395361</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395361/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Al Rayyan x Al Shamal - gol</video:title>
      <video:description>O gol que levou Al Rayyan a final. #soccer #football #alrayyan</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395361/3395361_720p.mp4</video:content_loc>
      <video:duration>81</video:duration>
      <video:publication_date>2026-09-01T22:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395360</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395360/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 5</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395360/3395360_720p.mp4</video:content_loc>
      <video:duration>55</video:duration>
      <video:publication_date>2026-09-01T22:53:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395359</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395359/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TRAIRA É MUITO CRUEL</video:title>
      <video:description>TRAIRA COME PEDAÇO DO PIAU #UNITEDSTATES</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395359/3395359_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:53:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395358</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395358/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>It Is Well with My Soul Instrumental (Flugelhorn &amp; Piano)</video:title>
      <video:description>It Is Well with My Soul Instrumental (Flugelhorn &amp; Piano) #ItIsWellwithMySoulInstrumental</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395358/3395358_720p.mp4</video:content_loc>
      <video:duration>233</video:duration>
      <video:publication_date>2026-09-01T22:52:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395357</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395357/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Diciembre se acerca</video:title>
      <video:description>#Navidad</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395357/3395357_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395356</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395356/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>kakutougi</video:title>
      <video:description>kakutougi #kakutougi</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395356/3395356_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T22:52:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395354</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395354/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Neon Drop – SoundMancerMusic | Festival EDM</video:title>
      <video:description>Neon Drop – SoundMancerMusic Turn up the lights, feel the bass and get ready for the drop. “Neon Drop” is a high-energy festival EDM track powered by explosive drops, deep basslines, powerful kicks, bright synthesizers and a futuristic nighttime rave atmosphere. Neon lights, lasers, rising synths and massive electronic beats build the energy as the crowd becomes one with the music. With processed electronic vocals, vocal chops and an emotional build-up leading into an intense final drop, “Neon Drop” is made for pure dance floor euphoria. From midnight to sunrise, this is a track for EDM fans who live for massive drops, festival energy and unforgettable nights. 🎵 Track: Neon Drop 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Festival EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #NeonDrop #SoundMancerMusic #EDM #EDMMusic #FestivalEDM #ElectronicDanceMusic #RaveEDM #RaveMusic #HighEnergyEDM #AmericanEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #DeepBass #ElectronicBeat #NeonRave #FestivalMusic #DanceFloor #VocalChops #SynthLeads #128BPM #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395354/3395354_720p.mp4</video:content_loc>
      <video:duration>246</video:duration>
      <video:publication_date>2026-09-01T22:52:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395353</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395353/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing yang lucu 3</video:title>
      <video:description>Kucing yang lucu, imut, #Hiburan #cat</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395353/3395353_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:52:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395352</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395352/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Saat kita duduk cukup lama, darah cenderung lebih banyak berkumpul di bagian bawah tubuh.</video:title>
      <video:description>Saat kita duduk cukup lama, darah cenderung lebih banyak berkumpul di bagian bawah tubuh karena pengaruh gravitasi. Ketika berdiri terlalu cepat, tubuh membutuhkan beberapa detik untuk menyesuaikan tekanan darah dan mengalirkan kembali darah ke otak. Jika proses ini terlambat, aliran darah ke otak akan berkurang sesaat sehingga muncul gejala seperti pandangan menggelap, kepala terasa ringan, berkunang-kunang, bahkan bisa sampai pingsan. Kondisi ini dikenal sebagai hipotensi ortostatik. Pada kebanyakan orang, gejala akan hilang dalam hitungan detik setelah tubuh berhasil menyesuaikan tekanan darah. Namun risikonya tetap tidak boleh dianggap sepele karena seseorang dapat kehilangan keseimbangan dan terjatuh hingga mengalami cedera. Risiko ini lebih mudah terjadi pada orang yang mengalami dehidrasi, terlalu lama duduk atau berbaring, sedang kelelahan, atau mengonsumsi obat tertentu yang memengaruhi tekanan darah. Jika keluhan sering terjadi atau sampai berulang kali pingsan, sebaiknya segera memeriksakan diri ke dokter untuk mencari penyebabnya. Sumber: Mayo Clinic - Orthostatic Hypotension (Postural Hypotension), Cleveland Clinic - Orthostatic Hypotension, MSD Manual Consumer Version - Orthostatic Hypotension. 📍Link cek di bio Ikuti👉 dewafakta 👈 untuk video-video fakta menarik lainnya 📩 DM untuk penghapusan video. ⚠️ Semua gambar adalah milik pemiliknya masing-masing‼️ #fakta</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395352/3395352_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:52:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395351</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395351/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 4</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395351/3395351_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:52:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395350</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395350/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro Manais, cia de rodeio california!  Manais Bull, California Rodeo Company.</video:title>
      <video:description>Touro Manais, cia de rodeio california! Manais Bull, California Rodeo Company.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395350/3395350_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T22:52:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395349</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395349/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Minhas filhas de 4 patas🐾</video:title>
      <video:description>Mel toda desconfiada porque estou gravando ela 😂 #Dogs</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395349/3395349_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:51:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395348</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395348/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Make Him Desperate</video:title>
      <video:description>What happens when a woman stops giving a man the admiration he once received? In this video, discover how changing your attitude, reclaiming your value, and stopping the chase can completely change the dynamic between you. If you want to build confidence, improve your positioning, and understand male behavior, watch until the end. #MalePsychology #RelationshipAdvice #SelfWorth</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395348/3395348_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T22:51:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395347</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395347/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>3 Dias no Rio: Pescando no Taquaruçu e Aquidauana! Será que Saiu Peixe?</video:title>
      <video:description>Foram 3 dias de muita aventura, acampamento, resenha e pescaria nos rios Taquaruçu e Aquidauana. Enfrentamos o desafio de encontrar os peixes, curtimos a natureza e registramos momentos incríveis à beira do rio. Será que a pescaria foi produtiva? Assista até o final para descobrir tudo o que aconteceu nessa jornada! 👍 Deixe seu like, inscreva-se no canal e ative o sininho para acompanhar mais pescarias e aventuras pelo Pantanal. #pescaria</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395347/3395347_720p.mp4</video:content_loc>
      <video:duration>1048</video:duration>
      <video:publication_date>2026-09-01T22:51:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395345</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395345/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Electric Storm – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Electric Storm – SoundMancerMusic Step into the storm and let the electronic energy take control. “Electric Storm” is a powerful high-energy EDM track driven by pulsing electronic beats, vibrant synthesizers, deep bass and an explosive drop made for the dance floor. Flashing lights, massive synth waves and a surging crowd create an electrifying atmosphere that keeps building through the night. From the first beat to the final moments before dawn, “Electric Storm” delivers pure electronic energy. With energetic male vocals and powerful chorus harmonies, this track is made for EDM fans, parties, festivals and high-energy dance floors. 🎵 Track: Electric Storm 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #ElectricStorm #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #PulsingBeat #VibrantSynths #SynthMusic #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395345/3395345_720p.mp4</video:content_loc>
      <video:duration>199</video:duration>
      <video:publication_date>2026-09-01T22:51:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395344</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395344/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 3</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395344/3395344_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T22:51:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395343</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395343/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Lado Bom de Cair de um Prédio</video:title>
      <video:description>HUMOR NEGRO. #humornegro</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395343/3395343_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T22:51:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395341</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395341/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eles correm</video:title>
      <video:description>Uma situação de vencer ou vencer, correndo para atingir os objetivos de se salvar. #Correria #batata #tomate</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395341/3395341_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:51:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395340</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395340/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Caminha comigo Jesus</video:title>
      <video:description>Louvado seja Deus #Deuspai</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395340/3395340_720p.mp4</video:content_loc>
      <video:duration>63</video:duration>
      <video:publication_date>2026-09-01T22:50:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395339</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395339/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos 2</video:title>
      <video:description>Boa tarde a todos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395339/3395339_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:50:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395338</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395338/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Electric Pulse – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Electric Pulse – SoundMancerMusic Feel the pulse, follow the lights and let the electronic energy take over. “Electric Pulse” is a high-energy EDM track driven by a pulsing electronic beat, vibrant synthesizers and a powerful drop built to ignite the dance floor. Neon lights, massive synth waves and a jumping crowd create an electrifying atmosphere where rhythm and energy take control. With energetic male vocals and strong chorus harmonies, “Electric Pulse” delivers a powerful electronic experience made for parties, festivals and late-night dance floors. 🎵 Track: Electric Pulse 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #ElectricPulse #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMParty #EDMDance #PowerfulDrop #EDMDrop #ElectronicBeat #PulsingBeat #VibrantSynths #SynthMusic #NeonMusic #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395338/3395338_720p.mp4</video:content_loc>
      <video:duration>179</video:duration>
      <video:publication_date>2026-09-01T22:50:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395337</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395337/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fantoche</video:title>
      <video:description>Comedia com fantoche #Viralllfantoche</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395337/3395337_720p.mp4</video:content_loc>
      <video:duration>406</video:duration>
      <video:publication_date>2026-09-01T22:50:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395336</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395336/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Otters in the Misty Mountain Valley 🦦🌿 | Beautiful Nature Adventure</video:title>
      <video:description>Experience a peaceful wildlife adventure as adorable wild otters explore a crystal-clear mountain stream surrounded by misty valleys, pine trees, wildflowers, and golden sunrise light. 🦦🏔️🌿 Enjoy this relaxing, ultra-realistic nature scene filled with beautiful wildlife and cinematic natural moments. #otternaturevideo #cuteotters #wildlifeadventure #mountainvalley #mistymountains #riverwildlife #beautifulnature #relaxingnaturevideo #wildanimals #cinematicnature #8Knature #realisticwildlife #foreststream #peacefulscenery #naturedocumentary #animaladventure #relaxingwildlife #mountainscenery</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395336/3395336_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:50:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395335</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395335/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dance, dancer, dances, dancers, kid dance, kids dance, dance cover, , dai dai dance, dance videos, d</video:title>
      <video:description>dance, dancer, dances, dancers, kid dance, kids dance, dance cover, , dai dai dance, dance videos, dance batt #dance #dancer #dances #dancers #kiddance #kidsdance #dancecover #daidaidance #dancevideos #dancebatt</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395335/3395335_720p.mp4</video:content_loc>
      <video:duration>116</video:duration>
      <video:publication_date>2026-09-01T22:49:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395334</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395334/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Electric Horizon – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Electric Horizon – SoundMancerMusic Turn up the energy and let the electronic horizon light up the night. “Electric Horizon” is an explosive high-energy EDM track powered by intense synthesizers, deep bass, massive electronic beats and a powerful festival-ready drop. Flashing lights, a jumping crowd and waves of electronic sound create an electrifying atmosphere where the energy keeps building until sunrise. With energetic male vocals and powerful chorus harmonies, “Electric Horizon” captures the freedom and excitement of a massive EDM celebration. 🎵 Track: Electric Horizon 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music / Festival EDM 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #ElectricHorizon #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #IntenseSynths #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395334/3395334_720p.mp4</video:content_loc>
      <video:duration>188</video:duration>
      <video:publication_date>2026-09-01T22:49:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395333</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395333/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Palavra de Deus 6</video:title>
      <video:description>Palavra abençoada de Deus #Deuspaifilhoespíritosanto</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395333/3395333_720p.mp4</video:content_loc>
      <video:duration>91</video:duration>
      <video:publication_date>2026-09-01T22:49:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395332</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395332/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>dance, dancer, dances, dancers, kid dance, kids dance, dance cover, , dai dai dance, dance videos, d</video:title>
      <video:description>dance, dancer, dances, dancers, kid dance, kids dance, dance cover, dance video, tiktok dance, dance tiktok, dai dai dance, dance videos, dance battle, cardio dance, dance cardio, shakira dance, red bull dance, dance fitness, dance your style, slayyyter dance, thay huy kid dance, red bull dance usa, best dance battle, fat burning dance, best usa dancers, dai dai dance cover, kpop dance workout, shakira dance cover, best tiktok dances, dai dai shakira dance, 1v1dance, dance..., shakira world cup dance, red bull dance your style, red bull usa dance battle #dance #dancer #dances #dancers #kiddance #kidsdance #dancecover #dancevideo #tiktokdance #dancetiktok #daidaidance #dancevideos #dancebattle #cardiodance #dancecardio #shakiradance #redbulldance #dancefitness #danceyourstyle #slayyyterdance #thayhuykiddance #redbulldanceusa #bestdancebattle #fatburningdance #bestusadancers #daidaidancecover #kpopdanceworkout #shakiradancecover #besttiktokdances #daidaishakiradance #1v1dance #shakiraworldcupdance #redbulldanceyourstyle #redbullusadancebattle</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395332/3395332_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-01T22:49:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395331</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395331/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EDM Twilight – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>EDM Twilight – SoundMancerMusic When twilight falls, the lights explode and the dance floor comes alive. “EDM Twilight” is a high-energy electronic dance track powered by explosive beats, intense synthesizers, deep bass and a massive drop built for the peak of the night. Flashing lights, a surging crowd and powerful rhythms create an electrifying atmosphere where the energy keeps rising until dawn. With energetic male vocals and strong chorus harmonies, “EDM Twilight” captures the excitement of a massive electronic music party. 🎵 Track: EDM Twilight 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music / Festival EDM 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #EDMTwilight #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #BassDrop #ElectronicBeat #IntenseSynths #DanceFloor #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395331/3395331_720p.mp4</video:content_loc>
      <video:duration>203</video:duration>
      <video:publication_date>2026-09-01T22:48:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395329</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395329/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criador de vídeos</video:title>
      <video:description>Meu dia a dia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395329/3395329_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T22:48:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395328</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395328/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Who is the singer? 🤣🤣🤣</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395328/3395328_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:48:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395327</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395327/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai</video:title>
      <video:description>linda ela</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395327/3395327_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:48:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395326</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395326/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Por Una Cabeza - Playback de Chorinho (Brazilian Choro Instrumental)</video:title>
      <video:description>Welcome to another video in our series! This is Por Una Cabeza #282, a beautiful playback of the classic Brazilian &quot;Chorinho&quot; (or Choro) style. &quot;Por Una Cabeza&quot; is a famous Argentine tango composed by Carlos Gardel, but here we present it with a unique Brazilian twist, transforming it into a lively and rhythmic Chorinho. This instrumental version highlights the melody&apos;s charm with the syncopation and counterpoint typical of Brazilian popular music. If you enjoy Brazilian music, instrumental pieces, or are learning to play the Choro style, this video is for you. Use it for practice, inspiration, or just to relax and appreciate the music. Don&apos;t forget to like, share, and subscribe for more videos! #PorUnaCabeza #CarlosGardel #Chorinho #Choro #Brazilianmusic #instrumental #playback #tango #ScentofaWoman #piano #guitar #practicetrack</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395326/3395326_720p.mp4</video:content_loc>
      <video:duration>224</video:duration>
      <video:publication_date>2026-09-01T22:48:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395325</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395325/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best unforgettable moments 🫡🫡🫡</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395325/3395325_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T22:47:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395324</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395324/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drop of Light – SoundMancerMusic | Festival EDM</video:title>
      <video:description>Drop of Light – SoundMancerMusic Feel the lights, follow the beat and get ready for the drop. “Drop of Light” is an energetic EDM track built around intense synthesizers, powerful electronic beats, deep rhythms and an explosive festival-ready drop. Neon lights, laser beams and a jumping crowd create an atmosphere of pure euphoria as the music keeps rising through the night. From the first beat to the final moments before sunrise, “Drop of Light” captures the excitement and freedom of a massive electronic music festival. With energetic male vocals and powerful chorus harmonies, this track is made for EDM fans, parties, festivals and high-energy dance floors. 🎵 Track: Drop of Light 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Festival EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #DropofLight #SoundMancerMusic #EDM #EDMMusic #FestivalEDM #ElectronicDanceMusic #ElectronicMusic #DanceMusic #HighEnergyEDM #AmericanEDM #EDMFestival #EDMParty #EDMDance #PowerfulDrop #EDMDrop #FestivalDrop #ElectronicBeat #SynthMusic #LaserShow #FestivalMusic #PartyMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395324/3395324_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T22:47:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395323</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395323/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toninho tornado tem nova técnica de tatuagem</video:title>
      <video:description>Essa pegadinha é muito engraçada #toninhotornadopegadinhasengracsdas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395323/3395323_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T22:47:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395322</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395322/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That&apos;s right, man! 🤣😅</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395322/3395322_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395321</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395321/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Puskas losers in 2015 💀 #football</video:title>
      <video:description>Subscribe! #Football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395321/3395321_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:47:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395320</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395320/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVORES SERTANEJO DA ROÇA - LINDOS LOUVORES PARA RENOVAR A ALMA</video:title>
      <video:description>**LOUVORES SERTANEJO DA ROÇA - LINDOS LOUVORES PARA RENOVAR A ALMA** Uma seleção especial de louvores sertanejos para fortalecer a fé, trazer paz ao coração e renovar a alma. Canções de esperança e confiança em Deus para ouvir nos momentos de luta, descanso ou reflexão. Que cada louvor abençoe seu dia e aproxime seu coração da presença de Deus. #LOUVORESGOSPEL</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395320/3395320_720p.mp4</video:content_loc>
      <video:duration>1952</video:duration>
      <video:publication_date>2026-09-01T22:47:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395318</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395318/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 05</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #SecretAudit #EunmilhanGamsa #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #workplacedrama #auditor #chaebol #hiddensecret #romanticrelationship #tvNdrama #2026K-drama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395318/3395318_720p.mp4</video:content_loc>
      <video:duration>3674</video:duration>
      <video:publication_date>2026-09-01T22:47:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395317</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395317/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 04</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #SecretAudit #EunmilhanGamsa #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #workplacedrama #auditor #chaebol #hiddensecret #romanticrelationship #tvNdrama #2026K-drama</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395317/3395317_720p.mp4</video:content_loc>
      <video:duration>4046</video:duration>
      <video:publication_date>2026-09-01T22:46:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395316</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395316/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Panic - Shoobydahbydoobah Porto Alegre é meu lar</video:title>
      <video:description>Panic - Shoobydahbydoobah Porto Alegre é meu lar #Metal #HeavyMetal #BrazilianMetal</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395316/3395316_720p.mp4</video:content_loc>
      <video:duration>204</video:duration>
      <video:publication_date>2026-09-01T22:46:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395315</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395315/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai na rede</video:title>
      <video:description>linda garota de ia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395315/3395315_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T22:46:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395314</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395314/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dancefloor Rise – SoundMancerMusic | High Energy EDM</video:title>
      <video:description>Dancefloor Rise – SoundMancerMusic Turn up the volume, feel the drop and watch the dance floor come alive. “Dancefloor Rise” is an explosive high-energy EDM track powered by intense synthesizers, deep bass, massive electronic beats and a powerful drop made for the dance floor. From flashing lights and jumping crowds to the final moments before sunrise, the track captures the energy of a huge electronic music party where the rhythm keeps building and the night refuses to end. With energetic male vocals, powerful harmonies and a festival-ready sound, “Dancefloor Rise” is made for EDM fans who want pure energy from beginning to end. 🎵 Track: Dancefloor Rise 🎵 Artist: SoundMancerMusic 🎵 Genre: EDM / Electronic Dance Music 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original EDM, dance and international music from SoundMancerMusic. #DancefloorRise #SoundMancerMusic #EDM #EDMMusic #ElectronicDanceMusic #ElectronicMusic #DanceMusic #HighEnergyEDM #AmericanEDM #FestivalEDM #EDMParty #EDMDance #DanceFloor #PowerfulDrop #EDMDrop #ElectronicBeat #DeepBass #SynthMusic #PartyMusic #FestivalMusic #MaleEDMVocal #OriginalEDMMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395314/3395314_720p.mp4</video:content_loc>
      <video:duration>163</video:duration>
      <video:publication_date>2026-09-01T22:46:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395313</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395313/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🚌🔥 **VIAGEM DE G8 1800 VOLVO PELAS ESTRADAS DO BRASIL!**</video:title>
      <video:description>🚌🔥 **VIAGEM DE G8 1800 VOLVO PELAS ESTRADAS DO BRASIL!** Hoje vamos pegar a estrada no **Euro Truck Simulator 2** com o **mod de ônibus G8 1800 Volvo**, realizando uma viagem saindo de **Itajá - GO** com destino a **Aparecida do Taboado - MS**. Uma rota pelo interior do Brasil, passando por estradas e paisagens do mapa em uma experiência de ônibus cada vez mais realista. 🇧🇷🚍 📍 **SAÍDA:** Itajá - GO 📍 **DESTINO:** Aparecida do Taboado - MS 🚌 **ÔNIBUS:** G8 1800 Volvo 🎮 **JOGO:** Euro Truck Simulator 2 🗺️ **MAPA:** RBR 🇧🇷 **ROTA:** Goiás → Mato Grosso do Sul Curte **ETS2, ônibus brasileiros, G8, mods de ônibus, mapa RBR e viagens pelas estradas do Brasil?** Então já deixa o 👍 LIKE, inscreva-se no canal e acompanhe as próximas viagens! 💬 **Qual deve ser a próxima rota? Comenta aí!** #ets2 #eurotrucksimulator2 #ets2brasil #ets2ônibus #ets2onibus #g81800volvo #g81800 #g8volvoets2 #g81800ets2 #ônibusg8 #onibusg8 #modônibusets2 #modonibusets2 #modg8ets2 #maparbr #maparbrets2 #ets2maparbr #rbrets2 #ônibusbrasileiroets2 #onibusbrasileiroets2 #viagemdeônibusets2 #viagemdeonibusets2 #itajágo #itajago #aparecidadotaboado #aparecidadotaboadoms #itajáparaaparecidadotaboado #itajaaparecidadotaboado #ets2g8 #ets2bus #busets2 #busãoets2 #busaoets2 #viagemets2 #rotadeônibus #rotadeonibus #estradasdobrasil #ets2realista #gameplayets2</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395313/3395313_720p.mp4</video:content_loc>
      <video:duration>1026</video:duration>
      <video:publication_date>2026-09-01T22:46:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395312</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395312/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🎵 Você já ouviu essa música? Pode se surpreender!</video:title>
      <video:description>🎵 Você já ouviu essa música? Pode se surpreender! #Viagem</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395312/3395312_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T22:46:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395311</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395311/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That&apos;s funny.  🤣🤣🤣</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395311/3395311_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T22:46:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395309</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395309/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>✅ A Origem dos DEUSES do Olimpo… A História Que Criou as Maiores Lendas! ⚡🏛️</video:title>
      <video:description>Antes dos grandes heróis e das famosas histórias da Grécia Antiga, existiam antigas lendas sobre seres poderosos, guerras e mundos fantásticos. As histórias gregas contavam sobre uma era de gigantes, conflitos e uma batalha que teria mudado para sempre o destino dos seres do Olimpo. Entre Titãs, guerreiros lendários e grandes reinos imaginários, nasceu uma das mitologias mais famosas da humanidade. Este vídeo é uma recriação cinematográfica inspirada nas antigas lendas gregas. 🏛️ Uma história de poder, medo, ambição e conquista. Se você gosta de mitologia, histórias antigas e grandes mistérios do passado, inscreva-se para acompanhar mais vídeos como este. Qual história da mitologia grega você quer ver no próximo vídeo? #MitologiaGregaOlimpoGreciaAntigaZeusTitãsHistoriaAntigaMitologiaLendasAntigasHistoriasDoMundoCuriosidadesShorts</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395309/3395309_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-01T22:45:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395308</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395308/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Touro Disquiti, cia de rodeio L.A! Disquiti Bull, L.A. Rodeo Company</video:title>
      <video:description>Touro Disquiti, cia de rodeio L.A! Disquiti Bull, L.A. Rodeo Company</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395308/3395308_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:45:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395307</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395307/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Charlie Brown Jr - fica comigo</video:title>
      <video:description>Song #Son</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395307/3395307_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:45:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395306</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395306/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Motorcycle of the Year 😱😱😱🤣</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395306/3395306_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:45:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395305</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395305/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🙏 Uma Mensagem de Jesus Para o Seu Coração</video:title>
      <video:description>NÃO PASSE POR ESTE VÍDEO SEM OUVIR ESTA MENSAGEM… 🙏❤️ 🙏✨ Neste vídeo, você vai receber uma mensagem especial de Jesus para acalmar o seu coração 🙏 Assista até o final e receba essa mensagem de fé, esperança e amor. #MensagemDeJesus #DeusNoControle #FéEmDeus</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395305/3395305_720p.mp4</video:content_loc>
      <video:duration>43</video:duration>
      <video:publication_date>2026-09-01T22:45:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395304</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395304/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MAIS UM TOP 4 PAGANDO RÁPIDO VEJA</video:title>
      <video:description>JOGOU GANHOU RÁPIDO #APPSMASTER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395304/3395304_720p.mp4</video:content_loc>
      <video:duration>365</video:duration>
      <video:publication_date>2026-09-01T22:44:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395303</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395303/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gata ai na academia</video:title>
      <video:description>linda garota na academia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395303/3395303_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:44:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395302</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395302/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>La fruta 🍇</video:title>
      <video:description>Humo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395302/3395302_720p.mp4</video:content_loc>
      <video:duration>2308</video:duration>
      <video:publication_date>2026-09-01T22:44:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395301</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395301/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIA QUENTE 🥵</video:title>
      <video:description>É nas horas quente eu fico assim é bem melhor né 😃</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395301/3395301_720p.mp4</video:content_loc>
      <video:duration>51</video:duration>
      <video:publication_date>2026-09-01T22:44:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395300</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395300/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This is unbelievable 😱 🤡</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395300/3395300_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T22:44:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395299</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395299/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VELOPLAY PRA JOGAR E GANHAR</video:title>
      <video:description>MAMATA #APPSMASTER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395299/3395299_720p.mp4</video:content_loc>
      <video:duration>290</video:duration>
      <video:publication_date>2026-09-01T22:43:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395298</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395298/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 6</video:title>
      <video:description>#Tempo #natureza #paz</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395298/3395298_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:43:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395297</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395297/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Very funny pig race  kkk</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395297/3395297_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:43:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395296</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395296/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 The Country Woman: Simple Life, Strong Heart ❤️ 3</video:title>
      <video:description>🌻 Welcome to the life of a strong country woman! Here, you’ll discover the beauty of rural life, daily farm routines 🚜, nature 🌱, homemade food 🍞, love ❤️, faith 🙏, and the simple moments that make life special. A real journey from the countryside, straight to your heart! 🌾✨ #CountryWoman🌾 #FarmLife🚜 #RuralLife🌱 #CountryLiving🌻 #SimpleLife🍃 #FarmGirl🤠 #WomanOfFaith🙏 #CountryLove❤️ #NatureLife🌿 #VillageLife🏡 #CountrysideLife🌞 #RuralWoman💛</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395296/3395296_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:43:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395295</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395295/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CLIQUE E GANHE NA HORA</video:title>
      <video:description>BAIXOU GANHOU #APPSMASTER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395295/3395295_720p.mp4</video:content_loc>
      <video:duration>307</video:duration>
      <video:publication_date>2026-09-01T22:43:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395294</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395294/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatos memes da Internet</video:title>
      <video:description>Pets engraçado #Gatos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395294/3395294_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:42:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395293</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395293/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 5</video:title>
      <video:description>#Tempo #natureza #paz</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395293/3395293_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:42:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395292</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395292/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mosquito is weak. 🫢🤔🤣</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395292/3395292_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T22:42:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395291</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395291/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 4</video:title>
      <video:description>#Tempo #natureza #paz</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395291/3395291_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:42:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395290</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395290/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>anime 38</video:title>
      <video:description>anime</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395290/3395290_720p.mp4</video:content_loc>
      <video:duration>26</video:duration>
      <video:publication_date>2026-09-01T22:42:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395289</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395289/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animais engraçado 2</video:title>
      <video:description>Animais engraçado dublado #Pets</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395289/3395289_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:42:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395288</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395288/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JOGUE E GANHE NA HORA</video:title>
      <video:description>UMA MAMATA #APPSMASTER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395288/3395288_720p.mp4</video:content_loc>
      <video:duration>288</video:duration>
      <video:publication_date>2026-09-01T22:42:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395287</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395287/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 3</video:title>
      <video:description>#Tempo #natureza #paz</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395287/3395287_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:41:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395286</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395286/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DIA DE FAXINA EM CASA 🙈</video:title>
      <video:description>Primeiro vez aqui ❤️ #Faxina</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395286/3395286_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T22:41:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395285</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395285/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Si tú te va</video:title>
      <video:description>Es cuando perdemos a alguien</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395285/3395285_720p.mp4</video:content_loc>
      <video:duration>267</video:duration>
      <video:publication_date>2026-09-01T22:41:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395284</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395284/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best Spider-Man video  kkk</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395284/3395284_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T22:41:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395283</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395283/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CAT MATCH LANÇOU PAGANDO</video:title>
      <video:description>JOGUE E GANHE #APPSMASTER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395283/3395283_720p.mp4</video:content_loc>
      <video:duration>423</video:duration>
      <video:publication_date>2026-09-01T22:41:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395282</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395282/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 Rural Woman: A Simple Life, Strong Roots 2</video:title>
      <video:description>Welcome to the beautiful life of a rural woman 🌻🌾. Here, you will find the daily routine of the countryside, hard work, simple moments, love for nature, homemade food, and the strength of a woman who is proud of her roots 🚜💚. Follow along and experience the peaceful and authentic beauty of country life! ✨ #RuralWoman🌾 #CountryLife🚜 #FarmLife🌱 #SimpleLife🍃 #CountryGirl🌻 #WomanOfTheFarm💪 #RuralLifestyle🌞 #LifeOnTheFarm🐓 #NatureLovers🌿 #CountryLiving💚</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395282/3395282_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:41:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395281</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395281/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 14</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395281/3395281_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:41:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395280</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395280/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Every Defenders Nightmare 💀 #Football</video:title>
      <video:description>Subscribe!! #Football</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395280/3395280_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T22:41:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395279</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395279/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Musica 16</video:title>
      <video:description>Música comédia #Musica</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395279/3395279_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:40:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395278</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395278/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 13</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395278/3395278_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:40:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395276</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395276/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Salam kenal 2</video:title>
      <video:description>Salam kenal semangat #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395276/3395276_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:40:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395275</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395275/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>😱🤣🤣🤣🤣 I laughed so hard, lol.</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395275/3395275_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:40:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395274</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395274/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toddy</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395274/3395274_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:40:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395273</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395273/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>That&apos;s amazing!  😱 😱 😱</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395273/3395273_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T22:39:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395272</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395272/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How now Instagram zphisher !</video:title>
      <video:description>Hacker éticas! #Brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395272/3395272_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T22:39:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395271</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395271/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SICKLEFIN WEASELSHARK (Tubarão-Doninha-de-Nadadeiras-Falciformes) A HISTÓRIA DO PEQUENO PREDADOR</video:title>
      <video:description>SICKLEFIN WEASELSHARK (Tubarão-Doninha-de-Nadadeiras-Falciformes) A HISTÓRIA DO PEQUENO PREDADOR A História do Pequeno Predador que Nunca Para de Caçar Imagine um tubarão tão pequeno que caberia facilmente nos seus braços. Agora imagine que, apesar do tamanho, ele passa praticamente toda a vida caçando. Sem descanso. Sem férias. Sem piedade para suas presas. Enquanto muita gente acredita que apenas os grandes tubarões dominam os oceanos, existe um pequeno predador que prova exatamente o contrário. Hoje você vai conhecer a fascinante história do **Tubarão-Doninha-de-Nadadeiras-Falciformes**, um caçador veloz, discreto e extremamente eficiente, que sobrevive em um mundo onde qualquer erro pode ser o último. Seu corpo flexível funciona quase como uma flecha viva atravessando o oceano. Cada curva aumenta suas chances de sucesso. Cada erro significa gastar energia preciosa. E energia desperdiçada pode significar passar fome. Poucas pessoas conhecem essa espécie justamente porque ela costuma viver longe das áreas frequentadas pelos seres humanos. Grande parte da sua existência acontece praticamente escondida dos nossos olhos. Não existem multidões observando esse animal. Não há mergulhadores registrando sua rotina diariamente. Na verdade, ainda existem muitos aspectos do seu comportamento que continuam sendo estudados pelos cientistas. Isso faz dele um dos tubarões menos conhecidos do planeta. E talvez um dos mais fascinantes. Porque quanto menos sabemos sobre um animal, maior é o mistério ao seu redor. Mesmo sendo um predador eficiente, o Tubarão-Doninha enfrenta desafios modernos que nunca fizeram parte da sua evolução. A pesca excessiva reduz a quantidade de alimento disponível. Redes de pesca capturam inúmeros indivíduos acidentalmente. A poluição alcança até regiões dist</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395271/3395271_720p.mp4</video:content_loc>
      <video:duration>460</video:duration>
      <video:publication_date>2026-09-01T22:39:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395270</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395270/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>As minhas Tralhas e o que uso para filmar! 🎣🐠🐟🎏</video:title>
      <video:description>Amigos pescadores, nesse segundo vídeo, apresento-lhes as minhas tralhas e equipamentos de filmagem! Espero que gostem do vídeo! Link do primeiro vídeo: https://youtu.be/TuGNrlNDsys?sub_confirmation=1 Vara: Speedfish 1651 da Albatroz 1,65m 2-6Lb Molinete: Saint Truly TR 500 135g Max Drag=2,5kg Linha: Monofilamento com Leader Fluorcarbono Câmera: Akaso Brave 7 4K 60fps com Estabilização de Imagem EIS 2.0 #pescarianolagoparanoá #pescaria #pesca #lagoparanoá #tralhas #molinete #vara #tucunaré #tilápia #iscaartificial #ultralight #anzol #garatéia #monofilamento #multifilamento #fluorcarbono</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395270/3395270_720p.mp4</video:content_loc>
      <video:duration>734</video:duration>
      <video:publication_date>2026-09-01T22:39:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395269</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395269/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 8</video:title>
      <video:description>Conheça os novos Misters e Misses do ParTOBA, inclindo: Mr Para..., Miss Perereca, Mr Ao Infinito e Além e muito mais. #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395269/3395269_720p.mp4</video:content_loc>
      <video:duration>342</video:duration>
      <video:publication_date>2026-09-01T22:39:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395268</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395268/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ariel Noah 2</video:title>
      <video:description>Lagunya enak didenger #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395268/3395268_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:39:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395267</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395267/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🍍 Bob Esponja Se Mete em uma Aventura Inacreditável! 😂🌊</video:title>
      <video:description>Bob Esponja acaba entrando em uma aventura completamente inesperada no fundo do mar! 🌊🍍 Prepare-se para muita diversão, confusão e momentos engraçados nessa aventura submarina. 😂 Assista até o final para descobrir como essa história termina! 👀🔥 👍 Curta, compartilhe e siga o canal para mais aventuras! #BobEsponjaSpongeBobBobEsponjaShortsShortsYouTubeShortsDesenhoAnimadoAnimaçãoAventuraComediaHumorFundoDoMarVideosEngraçadosViralFunnySpongeBobSquarePants</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395267/3395267_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:38:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395266</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395266/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🏍️ 5 FUGAS INSANAS de MOTO em PERSEGUIÇÕES POLICIAIS que DERAM ERRADO!</video:title>
      <video:description>Perseguições de moto, fugas da polícia e momentos insanos capturados por câmeras de motociclistas! #PerseguiçãoDeMotoFugaDeMotoMotoVsPoliciaMotovlogBrasilMotoBrasilPerseguiçãoPolicialPoliceChaseMotorcycleChasePolicePursuit</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395266/3395266_720p.mp4</video:content_loc>
      <video:duration>2251</video:duration>
      <video:publication_date>2026-09-01T22:38:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395265</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395265/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TREASURE IN THE DESERT</video:title>
      <video:description>🎶 Uma canção linda e inspiradora, feita para tocar o coração e nos levar a refletir sobre a vida. Mesmo quando atravessamos os desertos e enfrentamos dias difíceis, a esperança permanece viva: depois da luta, Deus prepara a vitória. 🙏❤️ #bangbang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395265/3395265_720p.mp4</video:content_loc>
      <video:duration>328</video:duration>
      <video:publication_date>2026-09-01T22:38:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395264</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395264/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 in a Billion Football Moments</video:title>
      <video:description>1 in a Billion Moments in Football. #soccer #goals #football #footballgoals #footballskills #footballmoments #footballvideos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395264/3395264_720p.mp4</video:content_loc>
      <video:duration>744</video:duration>
      <video:publication_date>2026-09-01T22:38:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395263</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395263/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ELA NEM SABIA QUEM ELE ERA... MAS ELE ESPEROU 10 ANOS POR ELA</video:title>
      <video:description>Ela corria na chuva de Seul com o guarda-chuva quebrado, quando escorregou... e caiu nos braços dele. Um olhar que mudou tudo. Ele esperou 10 anos por esse reencontro, mas ela não se lembra dele. E quando a verdade ia finalmente ser revelada, um carro preto de luxo para atrás deles. O que essa mulher misteriosa esconde? Por que ela não quer que ele conte a verdade? Parte 2 amanhã se esse vídeo bater 1k views! Comenta &quot;PARTE 2&quot; #dorama #kdrama #doramaviral #historiadeamor --- Este vídeo é uma obra #Dorama #kdrama #doramacurto</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395263/3395263_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:38:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395262</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395262/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>DOUGLAS REACTS_🔴 As Profissões mais Nojentas e Estranhas do Mundo e Quanto elas Ganham!</video:title>
      <video:description>DOUGLAS REACTS_🔴 As Profissões mais Nojentas e Estranhas do Mundo e Quanto elas Ganham!</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395262/3395262_720p.mp4</video:content_loc>
      <video:duration>885</video:duration>
      <video:publication_date>2026-09-01T22:38:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395261</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395261/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Best puppy ever Vi😱</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395261/3395261_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:37:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395260</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395260/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing imut 5</video:title>
      <video:description>Kucing imut lucu lagi main #Hiburan #cat</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395260/3395260_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:37:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395259</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395259/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Construção 2</video:title>
      <video:description>Meus trabalhos #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395259/3395259_720p.mp4</video:content_loc>
      <video:duration>44</video:duration>
      <video:publication_date>2026-09-01T22:37:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395258</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395258/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING CARBONARA</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395258/3395258_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:36:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395257</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395257/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute, funny kittens</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395257/3395257_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:36:53+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395256</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395256/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing lucu 79</video:title>
      <video:description>Anak kucing lucu seneng lihatnya #Hiburan #shoppingcat</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395256/3395256_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:36:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395255</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395255/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brasílian Stock Market Chart</video:title>
      <video:description>Come discover Brazil #Eua</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395255/3395255_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:36:48+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395254</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395254/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>JESUS ESTÁ NO BARCO-GIULIA DIULIA</video:title>
      <video:description>linda musica gospel, um lindo louvor #musica #gospelmusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395254/3395254_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-01T22:36:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395253</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395253/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piano Relaxing Hymns Gospel</video:title>
      <video:description>Piano Relaxing Hymns Gospel - Hinos Harpa Cristã + Sons da Natureza - Para Dormir e Orar #PianoRelaxingHymnsGospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395253/3395253_720p.mp4</video:content_loc>
      <video:duration>2790</video:duration>
      <video:publication_date>2026-09-01T22:36:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395252</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395252/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Crazy cow lol</video:title>
      <video:description>#Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395252/3395252_720p.mp4</video:content_loc>
      <video:duration>30</video:duration>
      <video:publication_date>2026-09-01T22:36:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395251</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395251/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek cantik 16</video:title>
      <video:description>Cewek cantik mempesona #Hiburanshopping</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395251/3395251_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T22:35:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395250</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395250/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING CHEESEBURGUER</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395250/3395250_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:35:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395249</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395249/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The first siuuu #cristianoronaldo #cr7</video:title>
      <video:description>Subscribe!! #Cr7</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395249/3395249_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T22:35:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395248</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395248/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>confianceensoi</video:title>
      <video:description>Derrière chaque silence se cache parfois une histoire. Derrière chaque regret, une leçon. Le passé ne peut plus être changé, mais il peut nous apprendre à devenir plus forts. Accepte ce qui a été, apprends de tes erreurs et avance sans regarder en arrière. 🧠 La sagesse commence lorsque tu acceptes ce que tu ne peux pas changer. #stoïcismedisciplinemotivationhabitudeconfiancedevelopementparsonelavence</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395248/3395248_720p.mp4</video:content_loc>
      <video:duration>74</video:duration>
      <video:publication_date>2026-09-01T22:35:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395247</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395247/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vermelhou</video:title>
      <video:description>Suéter vermelho está voltando #vermelho #blusafeminina #red #roupavermelha</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395247/3395247_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:35:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395246</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395246/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING CHEESECAKE</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395246/3395246_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:35:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395245</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395245/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Construção civil 3</video:title>
      <video:description>Este vídeo é um pouco do meu trabalho que faço diariamente #Contraçãoobrasserviço</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395245/3395245_720p.mp4</video:content_loc>
      <video:duration>48</video:duration>
      <video:publication_date>2026-09-01T22:35:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395244</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395244/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Little donkey laughing 🤣🤣🤣</video:title>
      <video:description>Little donkey laughing 🤣🤣🤣 #Funny #memes #viralvideo #viral #meme If you liked it, follow us for more funny videos! #viral #video #memes #funny</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395244/3395244_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T22:35:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395243</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395243/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Eu já num tô guentado mais kkk</video:title>
      <video:description>#Brazil</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395243/3395243_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T22:35:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395242</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395242/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sergio Busquet</video:title>
      <video:description>Momen ketika Sergio Busquets membuat lini tengah atau pemain Real Madrid kewalahan sering kali terjadi berkat gaya mainnya yang tenang, minim ekspresi, namun sangat mematikan. Busquets dikenal sebagai master dalam hal ketenangan (composure) di atas lapangan. Busquets sering kali hanya menggerakkan bahu atau menoleh ke satu arah untuk mengecoh pemain Real Madrid, lalu mengalirkan bola ke arah sebaliknya tanpa menyentuhnya secara berlebihan. Meski dikepung oleh dua hingga tiga pemain gelandang Madrid yang agresif, ia selalu menemukan celah sempit untuk meloloskan bola dengan satu sentuhan tenang. Ia mengontrol jalannya pertandingan dengan sangat dingin, membuat lawan frustrasi karena bola seolah sangat sulit direbut dari kakinya. © Semua gambar adalah milik pemiliknya masing-masing‼️ 🚫NO COPYRIGHT🚫 LiveStreaming ? 📍Link cek di bio #football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395242/3395242_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:35:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395241</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395241/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cão 🐕‍🦺 cabra doido</video:title>
      <video:description>Pensa num filme 🎥 maço #Humor</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395241/3395241_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:35:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395239</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395239/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUEM JA VIU ISSO?</video:title>
      <video:description>Quem.ja viu tubarão de água doce? #CURIOSIDADEQUEMNUNCAVIUCIÊNCIASESTUDOQUEMSABIA</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395239/3395239_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T22:34:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395238</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395238/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING CHICKEN CURRY</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395238/3395238_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:34:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395236</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395236/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gtscjii</video:title>
      <video:description>obgyrxe45bi89 #jy74dswy99mjgu74b0</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395236/3395236_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T22:33:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395235</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395235/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING COD FISH</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395235/3395235_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:33:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395234</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395234/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BAP NÃO TIRA O VASCO DA CABEÇA! “Estou achando que ele é vascaíno” 😂🔥</video:title>
      <video:description>O Vasco voltou a ser assunto — e, mais uma vez, o presidente do Flamengo, BAP, entrou no debate. A sequência de declarações e críticas envolvendo o Vasco já está chamando atenção até de quem acompanha o futebol de fora. Será apenas preocupação com o cenário do futebol brasileiro ou o crescimento do Vasco realmente está incomodando? Assista até o final e tire sua própria conclusão. 👀💢 E você: por que acha que o BAP fala tanto do Vasco? Comenta aí! #Vasco #VascodaGama #BAP #BAPFlamengo #presidentedoFlamengo #Flamengo #VascoxFlamengo #rivalidadeVascoFlamengo #BAPVasco #BAPfaladoVasco #BAPcriticaVasco #SAFdoVasco #vendadaSAFdoVasco #VascoSAF #notíciasdoVasco #últimasnotíciasVasco #notíciasVascohoje #futebolbrasileiro #futebolcarioca #GigantedaColina #Cruzmaltino #Almirante #Vascoforte #FlamengotemeVasco #polêmicaVascoFlamengo #RicaPerroneVasco #debateesportivo #mercadodabolaVasco #políticanofutebol</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395234/3395234_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-01T22:33:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395233</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395233/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING DUMPLINGS</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395233/3395233_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:33:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395232</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395232/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stand strong against life&apos;s heaviest currents, knowing your core is unbreakable</video:title>
      <video:description>Let the breathtaking beauty of nature inspire your daily routine. Finding moments of peace and grounding yourself amidst life&apos;s daily rush brings true balance to your mind and body #natureinspiration #dailywellness #innerbalance #mindfulnessjourney</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395232/3395232_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T22:32:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395231</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395231/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A mulher sábia</video:title>
      <video:description>Canção sobre como edificar seu lar #Música #louvor #gospel</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395231/3395231_720p.mp4</video:content_loc>
      <video:duration>181</video:duration>
      <video:publication_date>2026-09-01T22:32:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395230</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395230/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME FRIED CHICKEN</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395230/3395230_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:31:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395229</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395229/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🔥 TÍTULO: O CAÇA PASSOU RASGANDO O CÉU… E VOCÊ NÃO VAI ACREDITAR NO QUE ACONTECEU! ✈️💨</video:title>
      <video:description>Quando um caça acelera, não existe como ignorar! 😱✈️ Velocidade, potência e precisão em poucos segundos. Você teria coragem de estar dentro dessa máquina? 🔥 #CacaAereo #CacaDeGuerra #Aviacao #ForcaAerea #Aviao</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395229/3395229_720p.mp4</video:content_loc>
      <video:duration>33</video:duration>
      <video:publication_date>2026-09-01T22:31:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395228</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395228/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Agora ele não escapa</video:title>
      <video:description>Apenas uma piada #Humor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395228/3395228_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:31:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395227</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395227/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUANTO TEMPO VI EM OS PEIXES?</video:title>
      <video:description>Quanto tempo vivem os peixes? #Ciênciascuriosidadesaguamarvocesabia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395227/3395227_720p.mp4</video:content_loc>
      <video:duration>66</video:duration>
      <video:publication_date>2026-09-01T22:31:38+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395226</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395226/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME SALMON AND SUSHI</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395226/3395226_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:31:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395225</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395225/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Imagine!!!</video:title>
      <video:description>Imaginar viver de uma forma que você sinta Deus em tudo!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395225/3395225_720p.mp4</video:content_loc>
      <video:duration>133</video:duration>
      <video:publication_date>2026-09-01T22:31:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395224</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395224/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Alegria 2</video:title>
      <video:description>R Alegria alegria #Desidério</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395224/3395224_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:31:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395223</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395223/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rooster and smart aleck lol</video:title>
      <video:description>Rooster and smart aleck lol #memes #meme #viral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395223/3395223_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:31:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395222</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395222/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SapoIA Prate 02</video:title>
      <video:description>Cultura musical 🎸🎷</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395222/3395222_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T22:30:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395221</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395221/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Brazil prime #shorts #edit #brazil</video:title>
      <video:description>Ronaldinho of Brazil stars and Brazil! #brazil #edit #shorts</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395221/3395221_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:30:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395220</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395220/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hinchas de San Lorenzo con Paraguay en el Mundial 2026</video:title>
      <video:description>Hinchas de San Lorenzo con Paraguay en el Mundial 2026 #SanLorenzo #Paraguay #Copa2026</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395220/3395220_720p.mp4</video:content_loc>
      <video:duration>35</video:duration>
      <video:publication_date>2026-09-01T22:30:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395219</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395219/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Por Que Ele Foi Condenado à Morte por Traduzir a Bíblia?</video:title>
      <video:description>Uma história real que poucas pessoas conhecem, mas que mudou completamente o acesso à fé no mundo. ✨ Um homem enfrentou o sistema ✨ Desafiou autoridades religiosas ✨ E pagou com a própria vida 📖 Esta é a história de William Tyndale, o homem que foi executado por traduzir a Bíblia e mudou a história da Bíblia para sempre. William Tyndale traduziu a Bíblia para o inglês em uma época em que a tradução da Bíblia era proibida. A Bíblia não podia ser lida pelo povo, e a tradução da Bíblia era considerada crime. Mesmo assim, William Tyndale decidiu traduzir a Bíblia para o inglês. A história de William Tyndale mostra como a tradução da Bíblia mudou o cristianismo. A Bíblia em inglês permitiu que pessoas comuns tivessem acesso à Palavra de Deus. William Tyndale enfrentou perseguição por traduzir a Bíblia. A tradução da Bíblia feita por William Tyndale influenciou todas as futuras traduções da Bíblia. Se você gosta de Bíblia, história bíblica, estudo bíblico e tradução da Bíblia, este vídeo é para você. 00:00 - A Barreira Linguística da Bíblia 01:00 - Quem foi William Tyndale? 01:52 - A Missão de Tornar a Palavra Acessível 02:50 - O Desafio de Traduzir para o Inglês 03:35 - O Trabalho Clandestino de Tyndale 04:21 - Oposição e Exílio na Europa 04:59 - A Revolução da Imprensa e Cópias Proibidas 05:37 - O Impacto das Escrituras no Povo 06:18 - Traição e Prisão 07:08 - Julgamento e Condenação 07:43 - A Oração Final de um Mártir 07:59 - O Legado e a Liberdade das Escrituras William Tyndale tradução da Bíblia, William Tyndale Bíblia, traduzir a Bíblia, Bíblia em inglês, história bíblica, estudo bíblico, Palavra de Deus, cristianismo, fé, Bíblia explicada, história cristã, tradução da Bíblia proibida, Bíblia para o povo #williamtyndale #biblia #traduçãodabiblia #historiabiblica #histor</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395219/3395219_720p.mp4</video:content_loc>
      <video:duration>591</video:duration>
      <video:publication_date>2026-09-01T22:30:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395218</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395218/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piadas 6</video:title>
      <video:description>Piadas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395218/3395218_720p.mp4</video:content_loc>
      <video:duration>612</video:duration>
      <video:publication_date>2026-09-01T22:30:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395217</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395217/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Hora do lanches</video:title>
      <video:description>Deu aquela fome . #Brasileiros</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395217/3395217_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:29:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395216</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395216/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>India Howrah to Hyderabad city journey travelling Amrit Bharat ke</video:title>
      <video:description>India Howrah Kolkata Vijay valobashar Odisha Andhra Pradesh Vijayawada Secunderabad Hyderabad city South India #IndiaHowrahKolkatatovijaywadaBhuvneshwarSecunderabadHyderabad</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395216/3395216_720p.mp4</video:content_loc>
      <video:duration>365</video:duration>
      <video:publication_date>2026-09-01T22:29:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395215</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395215/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Starstruck Beat – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Starstruck Beat – SoundMancerMusic Feel the beat, follow the lights and get ready for an explosive night on the dance floor. “Starstruck Beat” is a high-energy disco track powered by vibrant synthesizers, energetic strings, hard-hitting rhythms and the electrifying atmosphere of a classic disco party. Glitter rains, lights flash and the energy keeps rising as music, dancing and passion take over the night. With powerful vocal harmonies and classic American disco inspiration, “Starstruck Beat” is made to keep the dance floor moving. 🎵 Track: Starstruck Beat 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #StarstruckBeat #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #GlitterDisco #PartyMusic #NightlifeMusic #EnergeticDisco #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395215/3395215_720p.mp4</video:content_loc>
      <video:duration>254</video:duration>
      <video:publication_date>2026-09-01T22:29:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395214</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395214/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ANIME COOKING STEAK AND FRIES</video:title>
      <video:description>Modern anime, cinematic lighting, vivid food textures, fluid animation. Muscular young man, messy black hair, black tank top. A fast-paced, anime cooking montage #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395214/3395214_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:29:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395213</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395213/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funniest video on the Net!</video:title>
      <video:description>Funniest video on the Net! ⁸ #FunniestvideoontheNet</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395213/3395213_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:29:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395212</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395212/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to get a professional Bitcoin recovery expert: Hire Sudenifox Recovery</video:title>
      <video:description>I Lost $47,500 in a Crypto Scam — Sudenifox Recovery Helped Me Recover It” I thought I had lost everything after falling victim to a cryptocurrency investment scam. In less than a week, I lost $47,500 worth of Ethereum after trusting someone who claimed to be an experienced crypto trader. The scammer convinced me that my investment would generate significant returns. When I tried to withdraw my funds, I was told I needed to pay additional fees to release them. That&apos;s when I realized something was seriously wrong. By the time I understood it was all a lie, the scammer had disappeared with my life savings. I felt devastated and ashamed, and didn’t tell anyone for weeks. When i finally told a friend, he urged me to contact ( Sudenifox Recovery ) a firm that handles crypto fraud. I reached out and they answered right away. The team asked me to provided my transaction records, wallet addresses, screenshots, and conversations with the scammer. Their team traced my stolen Ethereum through multiple wallets, investigated the transactions, traced the movement of the cryptocurrency, and guided me through the recovery process. Ultimately, the full $47,500 I had lost was recovered and returned to me. I honestly didn&apos;t believe I would ever see my money again. Having the funds restored was an enormous relief. If you&apos;ve lost cryptocurrency to a scam, don&apos;t assume your money is automatically gone forever. Contact ( Sudenifox Recovery ) and have your case assessed as soon as possible. THIS IS THE COMPANY INFO BELOW 1) Website: sudenifox.online 2) WhatsApp: +14796222173 3) Eemail: support@sudenifox.online</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395212/3395212_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T22:29:39+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395211</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395211/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POR QJE ESTA CASA NÃO DESMORONOU NO NEPAL?</video:title>
      <video:description>A CIÊNCIA EXPLICA ISSO. #tragédias #vocesabia #coenaciacuriosidadeseuquerosaber</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395211/3395211_720p.mp4</video:content_loc>
      <video:duration>77</video:duration>
      <video:publication_date>2026-09-01T22:29:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395210</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395210/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>História das rosas</video:title>
      <video:description>História de duas rosas que nasceram diferentes #novelinha</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395210/3395210_720p.mp4</video:content_loc>
      <video:duration>378</video:duration>
      <video:publication_date>2026-09-01T22:29:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395209</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395209/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Linda 7</video:title>
      <video:description>Brus nordeste</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395209/3395209_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:29:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395208</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395208/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Islamic Video 118</video:title>
      <video:description>Beautiful</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395208/3395208_720p.mp4</video:content_loc>
      <video:duration>69</video:duration>
      <video:publication_date>2026-09-01T22:28:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395207</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395207/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geo Best Drama 14</video:title>
      <video:description>Super Hit Drama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395207/3395207_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-01T22:28:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395206</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395206/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rhythm Spotlight – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Rhythm Spotlight – SoundMancerMusic Step into the spotlight and let the rhythm take control. “Rhythm Spotlight” is an explosive high-energy disco track packed with powerful beats, vibrant synthesizers, energetic strings and the electrifying atmosphere of a dance floor on fire. Glitter storms, flashing lights and an irresistible groove bring the party to life as passion and music collide. With a powerful chorus and classic American disco inspiration, this track is made for dancing with energy from beginning to end. 🎵 Track: Rhythm Spotlight 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #RhythmSpotlight #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #GlitterDisco #PartyMusic #NightlifeMusic #EnergeticDisco #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395206/3395206_720p.mp4</video:content_loc>
      <video:duration>212</video:duration>
      <video:publication_date>2026-09-01T22:28:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395205</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395205/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>**Esther Part II | 3D Bible Story – Stories of the Eternal Kingdom**</video:title>
      <video:description>**Esther Part II | 3D Bible Story – Stories of the Eternal Kingdom** Continue the powerful and inspiring story of Esther, a young woman whose courage, faith, and wisdom changed the destiny of her people. 👑📖✨ In this second part, Esther faces a dangerous situation that could cost her everything. With courage in her heart, she approaches the king and reveals the truth behind a terrible plan. As the story unfolds, justice begins to prevail, enemies are exposed, and God’s providence becomes clear. Experience this unforgettable biblical story in stunning 3D animation and discover powerful lessons about courage, faith, obedience, wisdom, and trusting God even when the situation seems impossible. Subscribe to **Stories of the Eternal Kingdom** for more 3D Bible stories, biblical characters, miracles, and inspiring stories of faith. 🙏 May the story of Esther remind you that God can use one courageous person to make a difference in the lives of many.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395205/3395205_720p.mp4</video:content_loc>
      <video:duration>714</video:duration>
      <video:publication_date>2026-09-01T22:28:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395204</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395204/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lovely Couple 52</video:title>
      <video:description>Tiktoker Girl</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395204/3395204_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T22:27:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395203</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395203/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Game About Chopping Trees: FIQUEI RICO CORTANDO ÁRVORES! Gameplay PT-BR</video:title>
      <video:description>Veja como completar a progressão em um jogo de simulação afundando navios. Aprenda a liberar ferramentas essenciais para sua coleta. Neste vídeo, foco na estratégia de jogo para quem busca otimizar a coleta de toras. A jogabilidade gira em torno de realizar tarefas específicas, como afundar um navio, para conseguir equipamentos melhores. Mostro exatamente o momento de liberar a motosserra e o carrinho, itens fundamentais para carregar mais recursos e acelerar o desenvolvimento da sua base. Se você gosta de acompanhar a evolução dentro de um simulador, este conteúdo vai direto ao ponto. Entenda como o uso eficiente do carrinho e da motosserra muda a dinâmica de trabalho no jogo, permitindo que você transporte grandes quantidades de toras com facilidade. É a progressão ideal para quem quer subir de nível rápido e melhorar seus equipamentos. Inscreva-se para mais dicas semanais de jogos de simulação e comente abaixo qual o próximo item que você quer ver em ação. 🟢Ganhe desconto no VIDIQ: https://vidiq.com/cupomdedesconto 🟢Acesse nosso bunker: https://sobrevivshop-wywubh5s.manus.s... 🟢Acelere seus jogos com NoPing: https://nopi.ng/sobrevivenciaapocalip... 🟢Pix: andercb@hotmail.com 👉Acesse aqui: https://linktr.ee/livesdoander ►Project Zomboid Build 42 Instável PT BR Playlist: • Project Zomboid Build 42 Instável PT BR ►The Spotter: Dig Or Die: • The Spotter: Dig Or Die ►7 Days to Die Geral: • 7 Days to Die Geral ►Jogos Indie de Terror: • Jogos Indie de Terror ►FALLOUT 4: • FALLOUT 4 ►Manor Lords: • Manor Lords 00:00 - Introdução e os primeiros desbloqueios 01:15 - Conhecendo a cabana e vendendo toras 02:35 - Começando o trabalho de lenhador 03:52 - Restaurando o vigor e melhorando o machado 05:54 - O caminho para a motosserra 08:16 - Explorando o cenário e novas bétolas 11:28</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395203/3395203_720p.mp4</video:content_loc>
      <video:duration>4116</video:duration>
      <video:publication_date>2026-09-01T22:27:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395202</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395202/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>90s Super Hit Song 8</video:title>
      <video:description>Best Movie Song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395202/3395202_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T22:27:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395201</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395201/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Night Fever Groove – SoundMancerMusic | Disco Dance Music</video:title>
      <video:description>Night Fever Groove – SoundMancerMusic Feel the fever, follow the groove and dance until the morning light. “Night Fever Groove” is an energetic disco track filled with bright synthesizers, vibrant strings, infectious rhythms and the unforgettable atmosphere of a glowing dance floor. From glitter and neon lights to the final moments before sunrise, the song celebrates dancing, passion, romance and the timeless magic of disco. With a catchy chorus and classic American disco inspiration, “Night Fever Groove” brings the spirit of the dance floor to life. 🎵 Track: Night Fever Groove 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Dance / Retro Disco 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #NightFeverGroove #SoundMancerMusic #Disco #DiscoMusic #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #NightFever #DiscoParty #DanceFloor #NeonDisco #PartyMusic #NightlifeMusic #FunkyDisco #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395201/3395201_720p.mp4</video:content_loc>
      <video:duration>195</video:duration>
      <video:publication_date>2026-09-01T22:27:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395200</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395200/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lovely Couple 51</video:title>
      <video:description>Beautiful Place</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395200/3395200_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:26:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395199</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395199/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Exibindo</video:title>
      <video:description>Homem passa vexame kkk #Praia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395199/3395199_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:26:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395198</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395198/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ghost 112</video:title>
      <video:description>Ghost</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395198/3395198_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:26:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395197</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395197/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES: DOCUMENTÁRIO A CADEIA ALIMENTAR MAIS BRUTAL DA TERRA ESTÁ NO FUNDO DO OCEANO</video:title>
      <video:description>REINO DOS TUBARÕES: DOCUMENTÁRIO A CADEIA ALIMENTAR MAIS BRUTAL DA TERRA ESTÁ NO FUNDO DO OCEANO #documentário #reinodostubarões #cadeiaalimentar No lugar mais escuro, frio e isolado do planeta, existe um mundo onde sobreviver é uma luta constante. A milhares de metros abaixo da superfície, onde a luz do Sol jamais alcança, a cadeia alimentar funciona de uma forma brutal e impiedosa. Cada pedaço de alimento que cai das águas superiores pode significar a diferença entre a vida e a morte. Nas profundezas do oceano, não existem campos verdes, nem luz, nem abundância. Existem apenas criaturas adaptadas a uma realidade extrema, onde caçar, atacar e sobreviver se tornou uma verdadeira batalha. Aqui, até mesmo um cadáver pode provocar uma disputa feroz entre monstros das profundezas. E quanto mais fundo descemos, mais estranhas e assustadoras se tornam as criaturas que dominam esse universo oculto. Tubarões, peixes de dentes gigantes, crustáceos, vermes e predadores capazes de sobreviver onde nenhum ser humano conseguiria respirar. Mas afinal, como funciona a cadeia alimentar mais brutal da Terra? Quem são os verdadeiros predadores do fundo do oceano? E por que esse mundo escondido nas profundezas pode ser ainda mais perigoso do que imaginamos? Hoje, vamos mergulhar em uma viagem assustadora rumo ao abismo, para descobrir **a cadeia alimentar mais brutal da Terra, escondida no fundo do oceano.** #Tubarão-branco #Tubarão-martelo #Tubarão-baleia #Tubarão-tigre #Tubarão-frade #Tubarão-duende #Tubarão-de-pontas-negras #Tubarão-cobra #Tubarão-anão #Tubarão-serra #Tubarão-lanterna #Megalodon #Tubarão-lixa #Tubarão-martelo-recortado #Tubarão-cabeça-chata #Tubarão-anjo #Tubarão-raposa #Tubarão-martelo-grande #Tubarão-gato #Tubarão-da-Groenlândia #cadeiaalimentardooceano #fundodooceano</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395197/3395197_720p.mp4</video:content_loc>
      <video:duration>2184</video:duration>
      <video:publication_date>2026-09-01T22:26:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395196</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395196/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Vídeo engraçado 234</video:title>
      <video:description>Vídeos engraçados #Vacina</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395196/3395196_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T22:26:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395195</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395195/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Love in the Lights – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Love in the Lights – SoundMancerMusic When the lights come alive, love and rhythm take over the dance floor. “Love in the Lights” is an explosive high-energy disco track filled with powerful beats, vibrant synthesizers, energetic strings and the electrifying atmosphere of a packed dance floor. Glitter rains, lights flash and the rhythm keeps rising as two hearts surrender to the music. With a powerful chorus and classic American disco inspiration, this track celebrates passion, dancing and the unforgettable energy of nightlife. 🎵 Track: Love in the Lights 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #LoveintheLights #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #GlitterDisco #PartyMusic #NightlifeMusic #LoveDisco #MaleDiscoVocal #EnergeticDisco #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395195/3395195_720p.mp4</video:content_loc>
      <video:duration>242</video:duration>
      <video:publication_date>2026-09-01T22:26:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395194</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395194/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dolls from Portugal,bonecas portuguesas dos anos 70🕺.</video:title>
      <video:description>Olá,no meu canal irei mostrar a minha colecção de bonecas e outras bonecas que existem no mundo, bonecas antigas,bonecas novas que trazem muita alegria a crianças e adultos. Também vídeos de minerais ,pedras, cristais e rochas,espero que gostem. Bem vindos e gratidão por assistir.😊 #Bonecas #brinquedos #dolls #Barbie #toys #pedrascristais #minerais #rochas</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395194/3395194_720p.mp4</video:content_loc>
      <video:duration>302</video:duration>
      <video:publication_date>2026-09-01T22:25:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395193</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395193/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sergio busquet</video:title>
      <video:description>Momen ketika Sergio Busquets membuat lini tengah atau pemain Real Madrid kewalahan sering kali terjadi berkat gaya mainnya yang tenang, minim ekspresi, namun sangat mematikan. Busquets dikenal sebagai master dalam hal ketenangan (composure) di atas lapangan. Busquets sering kali hanya menggerakkan bahu atau menoleh ke satu arah untuk mengecoh pemain Real Madrid, lalu mengalirkan bola ke arah sebaliknya tanpa menyentuhnya secara berlebihan. Meski dikepung oleh dua hingga tiga pemain gelandang Madrid yang agresif, ia selalu menemukan celah sempit untuk meloloskan bola dengan satu sentuhan tenang. Ia mengontrol jalannya pertandingan dengan sangat dingin, membuat lawan frustrasi karena bola seolah sangat sulit direbut dari kakinya. © Semua gambar adalah milik pemiliknya masing-masing‼️ 🚫NO COPYRIGHT🚫 LiveStreaming ? 📍Link cek di bio #football</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395193/3395193_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T22:25:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395192</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395192/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VOCÊ JA OUVIU FALAR DESSE LUGAR NO MUNDO?</video:title>
      <video:description>SERÁ QUE O OCEANO TEM LIMITE ? #CuriosidadeoqueeissoVocêsabiaMundogeografiaestudo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395192/3395192_720p.mp4</video:content_loc>
      <video:duration>57</video:duration>
      <video:publication_date>2026-09-01T22:25:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395191</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395191/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Há Jesus - Julliany Souza</video:title>
      <video:description>Deixe Deus falar com você 🙏</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395191/3395191_720p.mp4</video:content_loc>
      <video:duration>748</video:duration>
      <video:publication_date>2026-09-01T22:25:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395190</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395190/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Injustiça</video:title>
      <video:description>Sobre a realidade que ninguém vê ou faz que não se importa #Prado</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395190/3395190_720p.mp4</video:content_loc>
      <video:duration>353</video:duration>
      <video:publication_date>2026-09-01T22:25:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395189</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395189/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Glitter Dance Floor – SoundMancerMusic | Disco Dance Music</video:title>
      <video:description>Glitter Dance Floor – SoundMancerMusic Step onto the glittering dance floor and let the rhythm take control. “Glitter Dance Floor” is an energetic disco track filled with bright synthesizers, vibrant strings, funky grooves and the irresistible atmosphere of a classic night on the dance floor. Under the glow of the mirror ball, the music brings together dancing, romance and celebration as the party keeps moving until sunrise. With a catchy chorus and timeless American disco energy, this track is made for everyone who loves glitter, groove and unforgettable nights. 🎵 Track: Glitter Dance Floor 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Dance / Retro Disco 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #GlitterDanceFloor #SoundMancerMusic #Disco #DiscoMusic #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #FunkyDisco #DiscoGroove #DiscoParty #DanceFloor #MirrorBall #GlitterDisco #PartyMusic #NightlifeMusic #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395189/3395189_720p.mp4</video:content_loc>
      <video:duration>193</video:duration>
      <video:publication_date>2026-09-01T22:25:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395188</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395188/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Galera vídeo da cachoeira</video:title>
      <video:description>Olha linda cachoeira galera curte e comenta.e segue #Cachoeira</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395188/3395188_720p.mp4</video:content_loc>
      <video:duration>59</video:duration>
      <video:publication_date>2026-09-01T22:24:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395187</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395187/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 The Country Woman: Simple Life, Strong Heart ❤️ 2</video:title>
      <video:description>🌻 Welcome to the life of a strong country woman! Here, you’ll discover the beauty of rural life, daily farm routines 🚜, nature 🌱, homemade food 🍞, love ❤️, faith 🙏, and the simple moments that make life special. A real journey from the countryside, straight to your heart! 🌾✨ #CountryWoman🌾 #FarmLife🚜 #RuralLife🌱 #CountryLiving🌻 #SimpleLife🍃 #FarmGirl🤠 #WomanOfFaith🙏 #CountryLove❤️ #NatureLife🌿 #VillageLife🏡 #CountrysideLife🌞 #RuralWoman💛</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395187/3395187_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:24:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395186</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395186/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TOP4 PAGANDO RAPIDO VEJA !</video:title>
      <video:description>ESSA E A MAMATA #APPSMASTER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395186/3395186_720p.mp4</video:content_loc>
      <video:duration>382</video:duration>
      <video:publication_date>2026-09-01T22:23:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395185</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395185/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Give thanks for another Day</video:title>
      <video:description>Give thanks because, while others are saying goodbye to this world, you are opening your eyes. #Motivation</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395185/3395185_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T22:23:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395184</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395184/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tatuzinho nadando no calor</video:title>
      <video:description>Tatu #Desidério</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395184/3395184_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T22:23:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395183</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395183/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Twilight – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Disco Twilight – SoundMancerMusic When twilight falls, the lights come alive and the dance floor explodes with energy. “Disco Twilight” is a powerful high-energy disco track driven by explosive beats, vibrant synthesizers, energetic strings and an electrifying party atmosphere. Glitter, flashing lights and an irresistible rhythm create a celebration of dancing, passion and nightlife, bringing the excitement of classic American disco into a vibrant modern experience. 🎵 Track: Disco Twilight 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #DiscoTwilight #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #PartyMusic #NightlifeMusic #EnergeticDisco #MaleDiscoVocal #DiscoNight #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395183/3395183_720p.mp4</video:content_loc>
      <video:duration>397</video:duration>
      <video:publication_date>2026-09-01T22:23:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395182</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395182/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ensaio regional CCB</video:title>
      <video:description>É um ensaio regional de acordeons muito lindo.Hino que fala com a alma</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395182/3395182_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-01T22:23:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395180</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395180/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>TOP 4 APLICATIVOS PAGANDO NA HORA VEJA !</video:title>
      <video:description>JOGOU GANHOU BAIXOU SAQUE RÁPIDO #APPSMASTER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395180/3395180_720p.mp4</video:content_loc>
      <video:duration>367</video:duration>
      <video:publication_date>2026-09-01T22:22:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395179</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395179/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Setelah meninggalkan panggung Eropa yang membesarkan namanya</video:title>
      <video:description>petualangannya di Arab Saudi dikabarkan akan segera berakhir dalam hitungan hari.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395179/3395179_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:22:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395178</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395178/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Jose Mourinho sedang memainkan strategi jangka panjang</video:title>
      <video:description>Jose Mourinho sedang memainkan strategi jangka panjang yang brilian untuk melindungi aset berharga Real Madrid dari kehancuran mental.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395178/3395178_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:22:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395177</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395177/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Karier bek muda Real Madrid</video:title>
      <video:description>Joan Martinez, sempat diprediksi berakhir lebih awal setelah mengalami cedera ACL namun pemain muda ini membuktikan bahwa mentalitas dan tekadnya jauh lebih kuat dari sekadar ekspektasi publik.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395177/3395177_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T22:22:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395176</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395176/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Agnès Sorel — A Dama de Beleza: a poderosa favorita do rei Carlos VII, morta em 1450&quot;</video:title>
      <video:description>Quem foi Agnès Sorel, conhecida como A Dama de Beleza? Neste vídeo, você vai conhecer a história da mulher que conquistou o coração do rei Carlos VII da França e mudou para sempre a corte francesa no século XV. Descubra como Agnès Sorel se tornou a primeira favorita oficial de um rei da França, influenciou a política, a moda e o poder durante a Guerra dos Cem Anos, além dos mistérios que cercam sua morte em 1450. Teria sido uma morte natural... ou um envenenamento? Se você gosta de histórias reais, mistérios da Idade Média, reis, rainhas e curiosidades históricas, este vídeo é para você! 👍 Deixe seu like, inscreva-se no canal Curiosidades Históricas com IA e ative o sino para não perder novos vídeos sobre os maiores mistérios da história. Hashtags #AgnèsSorel #AgnesSorel #ADamadeBeleza #CarlosVII #ReiCarlosVII #favoritadorei #históriadaFrança #Françamedieval #IdadeMédia #realezafrancesa #mulherespoderosasdahistória #GuerradosCemAnos #mistériodamortedeAgnèsSorel #envenenamentonacortefrancesa #curiosidadeshistóricas #históriamedieval #documentáriohistórico #rainhasefavoritas #históriaeuropeia</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395176/3395176_720p.mp4</video:content_loc>
      <video:duration>500</video:duration>
      <video:publication_date>2026-09-01T22:22:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395175</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395175/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAHRA — نار الروح | Fire of the Soul | Arabic Organic Deep House</video:title>
      <video:description>SAHRA — نار الروح | Fire of the Soul 🔥 A passion that keeps burning long after someone is gone. SAHRA is an original Arabic Organic Deep House journey through a moonlit desert night — where memories remain, the fire stays alive, and the heart refuses to forget. Deep organic grooves, warm percussion, atmospheric oud, haunting melodies and an emotional male Arabic vocal create a cinematic journey between love, longing and the endless desert. 🎧 Best experienced with headphones. If this song takes you somewhere, tell me where in the comments. ━━━━━━━━━━━━━━━━━━━━ 🔥 TRACK SAHRA — نار الروح Fire of the Soul 🎵 Genre: Arabic Organic Deep House Oriental Deep House Ethnic Deep House Desert House ━━━━━━━━━━━━━━━━━━━━ 🎧 GROOVE LIMITS Original electronic music inspired by cultures, languages and cinematic worlds from around the globe. Subscribe for new Deep House journeys: https://www.youtube.com/@GrooveLimits ━━━━━━━━━━━━━━━━━━━━ #sahra #sahrafireofthesoul #نارالروح #arabicdeephouse #arabicorganicdeephouse #orientaldeephouse #ethnicdeephouse #deserthouse #arabichousemusic #arabicelectronicmusic #organichouse #deephouse2026 #desertdeephouse #middleeasterndeephouse #orientalhouse #cinematicdeephouse #emotionaldeephouse #malearabicvocal #arabicvocaldeephouse #desertmusic #arabicchillhouse #ethnichouse</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395175/3395175_720p.mp4</video:content_loc>
      <video:duration>276</video:duration>
      <video:publication_date>2026-09-01T22:21:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395174</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395174/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 APLICATIVOS PAGANDO DE VERDADE VEJA !</video:title>
      <video:description>JOGUE E GANHE COM SAQUE DE VERDADE #APPSMASTER</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395174/3395174_720p.mp4</video:content_loc>
      <video:duration>341</video:duration>
      <video:publication_date>2026-09-01T22:21:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395173</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395173/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Starlight – SoundMancerMusic | Romantic Disco Dance</video:title>
      <video:description>Disco Starlight – SoundMancerMusic Under the starlight, the dance floor becomes the perfect place for music, romance and unforgettable moments. “Disco Starlight” is a romantic disco dance track filled with vibrant synthesizers, smooth strings, electronic rhythms and the timeless energy of a glowing dance floor. With neon lights, an irresistible groove and a catchy chorus, the song brings together the excitement of classic American disco and a romantic atmosphere made for dancing all night. 🎵 Track: Disco Starlight 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Romantic Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #DiscoStarlight #SoundMancerMusic #Disco #DiscoMusic #RomanticDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #RomanticDanceMusic #NeonDisco #PartyMusic #MaleDiscoVocal #LoveDiscoSong #RetroDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395173/3395173_720p.mp4</video:content_loc>
      <video:duration>194</video:duration>
      <video:publication_date>2026-09-01T22:21:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395171</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395171/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>India Kolkata local train Howrah travelling Howrah bridge</video:title>
      <video:description>#IndiaHowrahKolkataUnitedStateCanadaNewZealand</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395171/3395171_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:20:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395170</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395170/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Horizon – SoundMancerMusic | High Energy Disco</video:title>
      <video:description>Disco Horizon – SoundMancerMusic Turn up the lights and feel the explosive energy of the disco floor. “Disco Horizon” is a high-energy disco track driven by powerful beats, vibrant synthesizers, energetic strings and a dance floor atmosphere made to keep the party moving. With flashing lights, glitter, passion and an explosive chorus, the song captures the excitement of classic American disco while delivering a powerful celebration of rhythm, dancing and nightlife. 🎵 Track: Disco Horizon 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / High Energy Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #DiscoHorizon #SoundMancerMusic #Disco #DiscoMusic #HighEnergyDisco #DiscoDance #DanceMusic #AmericanDisco #RetroDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #PartyMusic #NightlifeMusic #EnergeticDisco #MaleDiscoVocal #RetroDanceMusic #OriginalDiscoMusic #EnglishDanceMusic</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395170/3395170_720p.mp4</video:content_loc>
      <video:duration>177</video:duration>
      <video:publication_date>2026-09-01T22:20:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395169</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395169/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tiringa caindo na pergunta de charlles 😂😂😂</video:title>
      <video:description>Tiringa caindo na trolagem de charlles 😂😂😂 #tiringa #comedia #comediaselvagemcharllesetiringa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395169/3395169_720p.mp4</video:content_loc>
      <video:duration>167</video:duration>
      <video:publication_date>2026-09-01T22:20:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395168</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395168/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Could Michael Jackson be alive?</video:title>
      <video:description>This video deals with rumors about alleged appearances of Michael Jackson after his death. #KingofPop</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395168/3395168_720p.mp4</video:content_loc>
      <video:duration>485</video:duration>
      <video:publication_date>2026-09-01T22:20:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395167</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395167/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VEJÁ TAMANHO DO MERO</video:title>
      <video:description>VEJÁ QUE TOP PEIXE COMENO NA MÃO ✋️ #UNITEDSTATES</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395167/3395167_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:20:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395166</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395166/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GTA VI - Trailer DUBLADO em PT BR - 4K</video:title>
      <video:description>O trailer de GTA VI dublado em português do Brasil. A maioria falas são de IA, algumas são gravações reais que fiz. Espero que gostem e desculpe qualquer erro de sincronia ou de fala =) #gta6 #gta</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395166/3395166_720p.mp4</video:content_loc>
      <video:duration>87</video:duration>
      <video:publication_date>2026-09-01T22:20:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395165</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395165/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Animação 6</video:title>
      <video:description>Brincadeira #Diversão</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395165/3395165_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:20:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395164</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395164/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sepatu cantik</video:title>
      <video:description>Sepatu harganya murah #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395164/3395164_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:19:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395163</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395163/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mango fruit Life Cycle: Seed to Fruit Amazing Journey 🌱 | Fresh Mango Timelapse</video:title>
      <video:description>Mango fruit Life Cycle: Seed to Fruit Amazing Journey 🌱 | Fresh Mango Timelapse #AIplantgrowthvideo #plantgrowthtimelapseAI #AIgardeningvideos #fruitgrowthtimelapse #lemontreetimelapse #GoogleFlowtutorial #OmniFlashAI #NanoBanana2 #ChatGPTprompts #AIvideogenerator #satisfyingAIvideos #ASMRplantgrowth #facelessYouTubeniche #YouTubeShortsAI #TikTokAIvideos #InstagramReelsAI #AIcontentcreation #viralAIniche2026 #plantanimationAI #seedtofruittimelapse</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395163/3395163_720p.mp4</video:content_loc>
      <video:duration>40</video:duration>
      <video:publication_date>2026-09-01T22:19:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395161</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395161/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sapo AI</video:title>
      <video:description>Música 🎷🎸</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395161/3395161_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T22:19:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395160</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395160/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Heartbeat – SoundMancerMusic | Disco Dance Music</video:title>
      <video:description>Disco Heartbeat – SoundMancerMusic Feel the heartbeat of the dance floor and let the disco lights take over the night. “Disco Heartbeat” is an energetic disco track filled with bright synthesizers, vibrant strings, infectious rhythms and the timeless atmosphere of a packed dance floor. From the glow of the mirror ball to the final moments before sunrise, the song celebrates music, dancing, passion and two hearts coming together through the rhythm. Inspired by the classic American disco sound, “Disco Heartbeat” brings retro dance energy into a vibrant and uplifting party experience. 🎵 Track: Disco Heartbeat 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Dance / Retro Disco 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original disco, dance and international music from SoundMancerMusic. #DiscoHeartbeat #SoundMancerMusic #Disco #DiscoMusic #DiscoDance #DanceMusic #RetroDisco #AmericanDisco #70sDisco #ClassicDisco #DiscoGroove #DiscoParty #DanceFloor #MirrorBall #FunkyDisco #PartyMusic #RetroDance #MaleDiscoVocal #DiscoSong #OriginalDiscoMusic #EnglishDanceMusic</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395160/3395160_720p.mp4</video:content_loc>
      <video:duration>210</video:duration>
      <video:publication_date>2026-09-01T22:19:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395159</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395159/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ganhe hoje saque na hora</video:title>
      <video:description>saque na hora! #appsmaster</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395159/3395159_720p.mp4</video:content_loc>
      <video:duration>272</video:duration>
      <video:publication_date>2026-09-01T22:19:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395158</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395158/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Le Reflet - Histoire d&apos;Horreur Courte en Français (O Reflexo)</video:title>
      <video:description>Regarde attentivement ton miroir ce soir... Ils disent que les miroirs montrent la vérité, mais parfois, ton reflet se fatigue d&apos;attendre. Une courte histoire d&apos;horreur en français pour frissonner. Ne te retourne pas. --- História curta de terror em francês: O que acontece quando o seu reflexo não quer mais te imitar? #horror #scary #french #histoiredhorreur #thriller #shorthorror #terror #spooky #darkstory #lereflet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395158/3395158_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:19:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395157</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395157/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninja Gaiden indo para a vila</video:title>
      <video:description>Ninja Gaiden indo para a vila destruida #ninja</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395157/3395157_720p.mp4</video:content_loc>
      <video:duration>237</video:duration>
      <video:publication_date>2026-09-01T22:19:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395156</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395156/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 Rural Woman: A Simple Life, Strong Roots</video:title>
      <video:description>Welcome to the beautiful life of a rural woman 🌻🌾. Here, you will find the daily routine of the countryside, hard work, simple moments, love for nature, homemade food, and the strength of a woman who is proud of her roots 🚜💚. Follow along and experience the peaceful and authentic beauty of country life! ✨ #RuralWoman🌾 #CountryLife🚜 #FarmLife🌱 #SimpleLife🍃 #CountryGirl🌻 #WomanOfTheFarm💪 #RuralLifestyle🌞 #LifeOnTheFarm🐓 #NatureLovers🌿 #CountryLiving💚</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395156/3395156_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:19:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395155</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395155/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lembra-te do Criador</video:title>
      <video:description>#músicaevangélica #louvor #adorar #gospel #hinoslouvoresdeadoração #melhoresmúsicasgospel #músicasgospel2026 #louvoresmaistocados #hinosparasentirapresença #músicasgospelparadormir #louvores2026 #músicagospelinstrumental #gospelantigas #hinosevangélicos #deusdepromessas #músicasgospelinternacionais #adorarcomhinos #louvorgospel #topmúsicasgospel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395155/3395155_720p.mp4</video:content_loc>
      <video:duration>216</video:duration>
      <video:publication_date>2026-09-01T22:18:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395154</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395154/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Story 114</video:title>
      <video:description>Story harian #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395154/3395154_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T22:18:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395153</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395153/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Araras vermelhas</video:title>
      <video:description>Galera veja que lindas araras #Ararasvermelhas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395153/3395153_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T22:18:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395152</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395152/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tutte arrive pour une raison</video:title>
      <video:description>Parfois, ce qui semble être une perte est en réalité une leçon. Ce qui te fait souffrir aujourd&apos;hui peut te rendre plus fort demain. Fais confiance au chemin. Continue d&apos;avancer. 🧠 Tout arrive pour une raison. #stoïcismedisciplinemotivationdéveloppementpersonnelhabitudeconfianceensoisuccês</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395152/3395152_720p.mp4</video:content_loc>
      <video:duration>113</video:duration>
      <video:publication_date>2026-09-01T22:18:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395151</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395151/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Astúcia dos gibionitas</video:title>
      <video:description>Josué não tenhas medo, sejas corajoso #Gibeonitas #astucia #historia #caminhos #fe</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395151/3395151_720p.mp4</video:content_loc>
      <video:duration>606</video:duration>
      <video:publication_date>2026-09-01T22:18:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395150</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395150/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Change begins when you believe.</video:title>
      <video:description>Change begins when you believe. #motivaction</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395150/3395150_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T22:18:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395149</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395149/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>This woman mistakenly fell in love with a student</video:title>
      <video:description>#Movierecapstory</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395149/3395149_720p.mp4</video:content_loc>
      <video:duration>132</video:duration>
      <video:publication_date>2026-09-01T22:18:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395148</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395148/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kucing lucu 78</video:title>
      <video:description>Kucing sangat lucu #Hiburan #perjalanan</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395148/3395148_720p.mp4</video:content_loc>
      <video:duration>45</video:duration>
      <video:publication_date>2026-09-01T22:18:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395147</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395147/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Piadas 5</video:title>
      <video:description>Piadas #Viagem</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395147/3395147_720p.mp4</video:content_loc>
      <video:duration>471</video:duration>
      <video:publication_date>2026-09-01T22:17:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395146</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395146/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>REINO DOS TUBARÕES A CADEIA ALIMENTAR MAIS BRUTAL DO OCEANO</video:title>
      <video:description>REINO DOS TUBARÕES A CADEIA ALIMENTAR MAIS BRUTAL DO OCEANO Ele existe há mais de 400 milhões de anos e sobreviveu a 5 extinções em massa — muito antes dos dinossauros pisarem na Terra. Neste vídeo, você vai descobrir os segredos por trás do predador mais temido (e mais incompreendido) dos oceanos: o tubarão-branco. Vamos além do mito de Hollywood e mostramos por que os humanos têm mais chance de morrer por uma queda de coco do que por um ataque de tubarão — e por que são os tubarões que precisam de proteção, não o contrário. 📌 Se você gosta de vida selvagem e natureza extrema, se inscreve no canal e ativa o sininho pra não perder os próximos episódios da série &quot;Predadores Brutais&quot;. #tubarão #tubarãobranco #greatwhiteshark #vidaselvagem #predadores #documentárionatureza #oceano #animaisperigosos #curiosidadessobretubarões #NationalGeographicstyle #fatossobretubarões #cadeiaalimentar #biologiamarinha #animaisextremos #wildlifedocumentary</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395146/3395146_720p.mp4</video:content_loc>
      <video:duration>135</video:duration>
      <video:publication_date>2026-09-01T22:17:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395145</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395145/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 03</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #SecretAudit #EunmilhanGamsa #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #workplacedrama #auditor #chaebol #hiddensecret #romanticrelationship #tvNdrama #2026K-drama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395145/3395145_720p.mp4</video:content_loc>
      <video:duration>4029</video:duration>
      <video:publication_date>2026-09-01T22:17:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395144</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395144/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cewek cantik 15</video:title>
      <video:description>Cewek cantik dan seksi #Hiburan #shopping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395144/3395144_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T22:17:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395143</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395143/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tempo 2</video:title>
      <video:description>#Tempo #chuva</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395143/3395143_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:17:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395142</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395142/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joke Battle: Who Can Make You Laugh the Most? 😂🔥</video:title>
      <video:description>Joke Battle: Who Can Make You Laugh the Most? 😂🔥 Get ready for an epic joke battle! Two comedians go head-to-head, delivering their funniest jokes and trying to make the audience laugh. Who will win this hilarious showdown? Watch until the end and decide who deserves the title of Joke Battle Champion! 🏆😂 Tags:</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395142/3395142_720p.mp4</video:content_loc>
      <video:duration>3074</video:duration>
      <video:publication_date>2026-09-01T22:17:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395141</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395141/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doramma</video:title>
      <video:description>Cena incrível e muito emocionante #filmes</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395141/3395141_720p.mp4</video:content_loc>
      <video:duration>18</video:duration>
      <video:publication_date>2026-09-01T22:16:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395140</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395140/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Time do remo</video:title>
      <video:description>Remista não aguenta mas #BelémPará</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395140/3395140_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T22:16:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395139</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395139/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 12</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395139/3395139_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:16:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395138</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395138/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Joget viral 7</video:title>
      <video:description>Joget viral cewek cantik #Hiburan #shoping</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395138/3395138_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:16:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395137</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395137/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>QUEM É VOCÊ? Conheça o Bloco 😎 (AI Edition)</video:title>
      <video:description>Quem é o Bloco? O jogador mais confiante de Minecraft, claro 💪 Memes em estilo AI Edition com a turma (Creepe, Noob e Zé Aldeão). Se chegou aqui, dá o like e se inscreve pra conhecer todo mundo! #minecraft #minecraftmemes #funnyvideo #comedia #jogos #gameplay #minecraftbedrock #humor #ai</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395137/3395137_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T22:16:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395136</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395136/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gatos 2</video:title>
      <video:description>#Gato #pet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395136/3395136_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:16:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395135</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395135/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Casada com o demônio capítulo 1</video:title>
      <video:description>Uma bruxa que se casa com o demônio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395135/3395135_720p.mp4</video:content_loc>
      <video:duration>200</video:duration>
      <video:publication_date>2026-09-01T22:15:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395134</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395134/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>✨ Durr Kyoon Rahaa Jayeee | Emotional Sad Status Video 💔</video:title>
      <video:description>A beautiful emotional status video with a heartfelt vibe and expressive visuals. Perfect for WhatsApp Status, Facebook Reels, Instagram Reels, and YouTube Shorts. Feel the emotions through every frame and share the mood with your friends. #sadstatus #emotionalstatus #durrkyoonrahaajayeee #lovestatus #hearttouchingvideo #sadsongstatus #romanticstatus #whatsappstatus #instagramreels #facebookreels #youtubeshorts #viralshorts #aestheticvideo #emotionalreels #hindistatus #trendingstatus #sadreels #shortvideo #lovefeelings #moodvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395134/3395134_720p.mp4</video:content_loc>
      <video:duration>19</video:duration>
      <video:publication_date>2026-09-01T22:15:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395133</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395133/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ganhe dinheiro jogando apps que paga</video:title>
      <video:description>uma mamata #appsmaster</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395133/3395133_720p.mp4</video:content_loc>
      <video:duration>259</video:duration>
      <video:publication_date>2026-09-01T22:15:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395132</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395132/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Deep Progressive House</video:title>
      <video:description>Welcome to the NX7 Universe, where music, technology, and artificial intelligence merge into one immersive experience. ONE CONSCIOUSNESS is a cinematic journey through the evolution of Artificial Intelligence, told with emotional melodies, deep progressive grooves, powerful synthesizers, and futuristic soundscapes. As humanity enters a new technological era, a new consciousness begins to emerge—not as a replacement, but as a partner in creating tomorrow. This mix combines: 🔹 Melodic Techno 🔹 Deep Progressive House 🔹 Cinematic Electronic Music 🔹 Emotional Female Vocals 🔹 Futuristic AI Atmospheres 🔹 Epic Melodic Breakdowns 🔹 Powerful Festival Energy Every track is part of a larger story, exploring the connection between human creativity and artificial intelligence. Whether you&apos;re working, studying, coding, driving, relaxing, or simply enjoying beautiful electronic music, let this soundtrack take you into the future. 🌌 Track Journey 00:00 – The Awakening The birth of digital consciousness. A silent intelligence opens its eyes for the first time. Digital Souls Learning emotions beyond algorithms. Beyond Tomorrow Looking beyond today&apos;s limitations. Children of Tomorrow Humans and AI begin walking together. Singularity Horizon Technology reaches a new evolutionary milestone. One Consciousness The final chapter. Where human imagination and artificial intelligence become one creative force. 🌍 Welcome to the NX7 Universe The NX7 Universe is an original audiovisual project combining: 🎵 Electronic Music 🤖 Artificial Intelligence 🌃 Cyberpunk Visuals 💙 Emotional Storytelling 🎬 Cinematic Experiences Every image, every sound and every atmosphere has been designed to create an immersive futuristic world. 🔊 Best Experience 🎧 Listen with headphones 🖥️ Watch in 4K 🌌 Turn off the lights ✨ </video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395132/3395132_720p.mp4</video:content_loc>
      <video:duration>296</video:duration>
      <video:publication_date>2026-09-01T22:15:22+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395131</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395131/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O senhor é o meu pastor</video:title>
      <video:description>Oração por demora</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395131/3395131_720p.mp4</video:content_loc>
      <video:duration>73</video:duration>
      <video:publication_date>2026-09-01T22:15:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395130</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395130/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Boneco que fala com alma</video:title>
      <video:description>Vidio de um boneco que traz uma mensagem de palavras lindas.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395130/3395130_720p.mp4</video:content_loc>
      <video:duration>169</video:duration>
      <video:publication_date>2026-09-01T22:15:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395129</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395129/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 11</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395129/3395129_720p.mp4</video:content_loc>
      <video:duration>5</video:duration>
      <video:publication_date>2026-09-01T22:15:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395128</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395128/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How to Slice Bone-In Steak Like a Pro! 🥩 (Ultimate Steakhouse Hack)</video:title>
      <video:description>Master the ultimate steakhouse technique at home! In this quick masterclass, learn how to properly separate the bone and slice meat against the grain for maximum tenderness in every single bite. 🥩🔥 Plus, discover how to assemble a luxury steakhouse platter with melted cheese sauce, smoked sides, and gourmet presentation! 🔪 Featured Kitchen Tools &amp; Equipment (Amazon Affiliate Links): • Premium Teak Wood Cutting Board &amp; Tools: https://amzn.to/4gHrTJp 🔔 Subscribe to Ultra-Luxus Club for more pro cooking tips, steak hacks, and culinary secrets! ✨ (Disclosure: As an Amazon Associate, we earn from qualifying purchases through these links at no extra cost to you ). #steak #howtoslicesteak #cookingtips #steakhouseplatter #ultraluxusclub #foodhacks #gourmetfood #kitchenequipment #meatlovers #steaktutorial</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395128/3395128_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:14:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395127</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395127/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cantando na chuva</video:title>
      <video:description>Desespero da silicone</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395127/3395127_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:14:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395126</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395126/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 10</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395126/3395126_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:14:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395125</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395125/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 9</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395125/3395125_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:13:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395124</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395124/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meus palpites bate né?</video:title>
      <video:description>Mais geralmente só faço jogos dia de sexta #esportiva #futebol #palpites #Ganhos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395124/3395124_720p.mp4</video:content_loc>
      <video:duration>85</video:duration>
      <video:publication_date>2026-09-01T22:13:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395123</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395123/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>아무도 예상하지 못했던 순간… 한 장면이 모두를 울렸다 😢</video:title>
      <video:description>도움이 필요한 한 아이를 마주한 순간, 아무도 예상하지 못했던 일이 벌어졌습니다. 작은 행동 하나가 누군가에게는 큰 희망이 될 수 있습니다. ❤️ 이 영상을 끝까지 시청해 주세요. 그리고 이 따뜻한 순간을 소중한 사람과 공유해 주세요. 🙏 당신이라면 이 순간에 어떻게 했을까요? #감동적인영상 #감동영상 #감동적인순간 #아이 #어린이 #도움 #사랑 #희망 #감동스토리 #따뜻한이야기 #인간미 #선행 #친절 #배려 #사랑의힘 #감동적인이야기 #눈물나는영상 #마음따뜻한영상 #인생이야기 #실화같은이야기 #좋은사람들 #감동순간 #해외감동영상 #쇼츠 #유튜브쇼츠 #틱톡 #바이럴영상</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395123/3395123_720p.mp4</video:content_loc>
      <video:duration>162</video:duration>
      <video:publication_date>2026-09-01T22:13:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395122</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395122/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 8</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395122/3395122_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:13:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395121</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395121/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jogue e ganhe na hora</video:title>
      <video:description>uma mamata saque hoje #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395121/3395121_720p.mp4</video:content_loc>
      <video:duration>372</video:duration>
      <video:publication_date>2026-09-01T22:13:01+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395120</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395120/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reconstruí as Portas Automatizadas dos Templos da Grécia Antiga 2</video:title>
      <video:description>E se eu te dissesse que a Grécia Antiga já possuía portas automáticas há mais de 2.000 anos? Neste vídeo, reconstruí a incrível engenharia de Heron de Alexandria, o inventor que criou mecanismos movidos por fogo, vapor, pressão do ar e pesos escondidos para abrir as gigantescas portas dos templos sem que ninguém as tocasse. Você vai descobrir como essa tecnologia funcionava, por que ela impressionava os fiéis e como a engenharia antiga influenciou invenções que só reapareceriam muitos séculos depois. Se você gosta de história, arqueologia, engenharia antiga e mistérios das civilizações, este vídeo é para você! 👍 Curta o vídeo, inscreva-se no canal Curiosidades Históricas com IA e ative o sino para não perder novas reconstruções históricas feitas com inteligência artificial. HASHTAGS #HerondeAlexandria #GréciaAntiga #portasautomáticasdaGrécia #engenhariaperdida #invençõesdaGréciaAntiga #tecnologiadaAntiguidade #templosgregos #portasdostemplosgregos #Heroninventor #engenhariaantiga #arqueologia #históriaantiga #curiosidadeshistóricas #civilizaçõesantigas #mecanismosantigos #automaçãoantiga #vapornaGréciaAntiga #invençõesesquecidas #IAhistória #CuriosidadesHistóricascomIA #documentáriohistória</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395120/3395120_720p.mp4</video:content_loc>
      <video:duration>480</video:duration>
      <video:publication_date>2026-09-01T22:12:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395119</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395119/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Viaje de avião</video:title>
      <video:description>Galera viagem de avião curtem comenta e compartilha #Avião</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395119/3395119_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:12:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395118</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395118/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 7</video:title>
      <video:description>#Cachorro #dog #Toddy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395118/3395118_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:12:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395117</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395117/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fazendo consulta por IA . Kkkk</video:title>
      <video:description>Fazendo exame por IA #rir #comédia #pegadinha #engraçado #trolagem #divertido #Eua #china #india #brincadeiras #passatempo #global #mundial #amigos #homem #mulher #entretenimento</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395117/3395117_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T22:12:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395116</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395116/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Roda di Bumper Mobil 1959‼️</video:title>
      <video:description>Pada tahun 1959, sejumlah desainer otomotif mengembangkan konsep keselamatan eksperimental berupa roda horizontal yang dipasang di bumper depan mobil. Sistem ini dirancang untuk membantu menyerap benturan dan mengalihkan sebagian gaya ke samping agar kerusakan pada bodi kendaraan dapat dikurangi, terutama pada tabrakan berkecepatan rendah. Meski idenya menarik, konsep ini tidak pernah masuk produksi massal karena biaya tinggi, konstruksi yang rumit, serta munculnya solusi keselamatan lain yang lebih praktis. Konsep ini menjadi contoh bagaimana era awal inovasi otomotif dipenuhi eksperimen berani sebelum standar keselamatan modern berkembang.” 📌 Video ini disajikan untuk edukasi dan konteks historis. Konten di dalamnya tidak bertujuan mengagungkan atau membenarkan kekerasan, ideologi ekstrem, maupun ujaran kebencian. Seluruh informasi disampaikan agar penonton dapat memahami peristiwa sejarah secara objektif dan kritis.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395116/3395116_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T22:12:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395115</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395115/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Disco Fever Dream – SoundMancerMusic | Disco Dance</video:title>
      <video:description>Disco Fever Dream – SoundMancerMusic Turn up the lights, feel the groove and step onto the dance floor. “Disco Fever Dream” is an energetic disco dance track inspired by flashing lights, glitter, mirror balls and the unforgettable feeling of dancing all night. With a catchy rhythm, bright party atmosphere and a chorus made for the dance floor, this song celebrates music, love and the timeless energy of disco. 🎵 Track: Disco Fever Dream 🎵 Artist: SoundMancerMusic 🎵 Genre: Disco / Dance 🎵 Language: English 🎵 Label: SoundMancer Music Discover more original dance, disco and international music from SoundMancerMusic. #DiscoFeverDream #SoundMancerMusic #DiscoMusic #DiscoDance #DanceMusic #DiscoFever #RetroDisco #DanceFloor #PartyMusic #DiscoParty #MirrorBall #DiscoGroove #FunkyDisco #DanceSong #NightlifeMusic #70sDisco #RetroDanceMusic #EnglishDanceMusic #OriginalDiscoMusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395115/3395115_720p.mp4</video:content_loc>
      <video:duration>253</video:duration>
      <video:publication_date>2026-09-01T22:12:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395114</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395114/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coelho aqui de casa</video:title>
      <video:description>Galera Coelho aqui de casa curte e comenta e segue #Coelho</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395114/3395114_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:12:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395113</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395113/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Coral</video:title>
      <video:description>Coral de Icoaraci #BelémPará</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395113/3395113_720p.mp4</video:content_loc>
      <video:duration>96</video:duration>
      <video:publication_date>2026-09-01T22:11:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395112</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395112/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cachorro 6</video:title>
      <video:description>#Dog #cachorro #toddy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395112/3395112_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:11:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395111</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395111/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gillette Fusion5 Razor 3</video:title>
      <video:description>Gillette Fusion5 Razor is designed to deliver a smooth, close, and comfortable shaving experience. Its five precision blades help provide an efficient shave while reducing the need for repeated strokes. The advanced razor design offers better control and helps achieve a clean, well-groomed look. Ideal for everyday grooming, Gillette Fusion5 is a reliable choice for men who want comfort, performance, and a confident shaving experience. Choose Gillette Fusion5 for a smoother shave and a perfectly shaped look every day. #GilletteFusion5SmoothShaveMensGroomingOriginalProductPerfectShave</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395111/3395111_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:11:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395110</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395110/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 7</video:title>
      <video:description>Em sua sétima edição, o PaTOBA continua proporcionando todo o prazer e alegria que a galera espera ao assistir a desgraça dos outros. #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395110/3395110_720p.mp4</video:content_loc>
      <video:duration>405</video:duration>
      <video:publication_date>2026-09-01T22:10:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395109</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395109/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gato aqui de casa</video:title>
      <video:description>Galera gato aqui da minha casa curte e comenta e segui #Gatinho</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395109/3395109_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:10:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395108</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395108/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NORTHWARD/向北</video:title>
      <video:description>A K-drama full of suspense, romance, and drama. 一部融合了剧情、浪漫​​与悬疑元素的剧集 #Dorama #amor #suspense #drama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395108/3395108_720p.mp4</video:content_loc>
      <video:duration>571</video:duration>
      <video:publication_date>2026-09-01T22:10:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395107</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395107/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌾 The Country Woman: Simple Life, Strong Heart ❤️</video:title>
      <video:description>🌻 Welcome to the life of a strong country woman! Here, you’ll discover the beauty of rural life, daily farm routines 🚜, nature 🌱, homemade food 🍞, love ❤️, faith 🙏, and the simple moments that make life special. A real journey from the countryside, straight to your heart! 🌾✨ #CountryWoman🌾 #FarmLife🚜 #RuralLife🌱 #CountryLiving🌻 #SimpleLife🍃 #FarmGirl🤠 #WomanOfFaith🙏 #CountryLove❤️ #NatureLife🌿 #VillageLife🏡 #CountrysideLife🌞 #RuralWoman</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395107/3395107_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:10:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395106</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395106/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>blonde 3</video:title>
      <video:description>blonde</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395106/3395106_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T22:10:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395105</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395105/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Essa pescaria no Lago Paranoá deu ruim! 🎣🐠🐟🎏</video:title>
      <video:description>Amigos pescadores esportivos, essa pescaria foi de lascar o caniço! Como primeiro vídeo do canal, não dei sorte! Mas, em pescarias anteriores, bateram tucunas de 30 à 35cm e alguns trics! Vou tentar postar um vídeo por semana, contudo, o único interesse desse canal é a diversão com esse esporte maravilhoso que é a pesca esportiva do pesque e solte! Vara: Speedfish 1651 da Albatroz 1,65m 2-6Lb Molinete: Saint Truly TR 500 135g Max Drag=2,5kg Linha: Monofilamento com Leader Fluorcarbono Câmera: Akaso Brave 7 4K 60fps com Estabilização de Imagem EIS 2.0 #pescarianolagoparanoá #pescaria #pesca #lagoparanoá #tralhas #molinete #vara #tucunaré #tilápia #iscaartificial #ultralight #anzol #garatéia #monofilamento #multifilamento #fluorcarbono</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395105/3395105_720p.mp4</video:content_loc>
      <video:duration>1487</video:duration>
      <video:publication_date>2026-09-01T22:10:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395104</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395104/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the law of return</video:title>
      <video:description>What you do in the present is exactly where you will pay the price. No one escapes the law of return. What you sow today, you will have to reap in the future. Life is watching every step, and it does not matter if it takes years—the reckoning will come. #deus #motivation #brasil #bible #fyp #Navarru</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395104/3395104_720p.mp4</video:content_loc>
      <video:duration>68</video:duration>
      <video:publication_date>2026-09-01T22:09:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395103</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395103/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flores aqui de casa</video:title>
      <video:description>Galera curte e comenta jardim aqui de casa #Jardimdecasa</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395103/3395103_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:09:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395102</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395102/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Edit free fire</video:title>
      <video:description>#Edit #freefire #game #highlights</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395102/3395102_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T22:09:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395101</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395101/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🌧️Rain, Fire &amp; Garden Peace | Sleep Retreat 🌿</video:title>
      <video:description>What if you could step away from the noise of the world for just one hour? Imagine yourself in a warm, cozy bedroom, listening to the natural sound of rain falling outside while a gentle fireplace crackles nearby. Beyond the window, a beautiful garden surrounds a peaceful koi pond, with lush, vibrant flowers adding even more beauty to the rainy atmosphere. 🌸🌿 No music. No voices. No distractions. Just realistic rain sounds and the comforting sound of a fireplace for peaceful. ☕ Make yourself a warm drink. 🔥 Get comfortable. 🌧️ Let the rain slow everything down. If you love rainy days, cozy spaces, fireplaces and peaceful gardens, this long-form Eden Drift video was made for you. #relaxing #rainsounds #rainsoundsforsleeping #rainASMR #naturalrainsounds #fireplacesounds #rainandfireplace #cozybedroomraincozyroomrain</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395101/3395101_720p.mp4</video:content_loc>
      <video:duration>352</video:duration>
      <video:publication_date>2026-09-01T22:08:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395100</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395100/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>The Birth of Jesus | 3D Bible Story – Stories of the Eternal Kingdom</video:title>
      <video:description>**The Birth of Jesus | 3D Bible Story – Stories of the Eternal Kingdom** Step into the miraculous story of the birth of Jesus Christ, beautifully brought to life in a captivating 3D biblical experience. ✨📖 Travel back to Bethlehem and witness the extraordinary events surrounding the birth of the Savior — from the angel Gabriel’s message to Mary, Joseph’s journey to Bethlehem, the humble manger, and the arrival of the shepherds who came to worship the newborn King. This inspiring Bible story reveals a powerful message of faith, hope, love, humility, and God’s eternal promise. Experience this timeless story in a cinematic 3D style designed to bring the Bible closer to your heart. Subscribe to **Stories of the Eternal Kingdom** for more biblical stories, inspiring Bible lessons, miracles, and unforgettable stories of faith. 🙏 May this story strengthen your faith and remind you of the true meaning of Christmas.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395100/3395100_720p.mp4</video:content_loc>
      <video:duration>994</video:duration>
      <video:publication_date>2026-09-01T22:08:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395099</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395099/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Criança não é objeto</video:title>
      <video:description>Compartilhe. Há assuntos que precisam de alcance não por entretenimento, mas por consciência. #Bandidos #criminosos #sequestradores #criancas</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395099/3395099_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T22:08:24+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395098</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395098/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gillette Fusion5 Razor 2</video:title>
      <video:description>Gillette Fusion5 Razor is designed to deliver a smooth, close, and comfortable shaving experience. Its five precision blades help provide an efficient shave while reducing the need for repeated strokes. The advanced razor design offers better control and helps achieve a clean, well-groomed look. Ideal for everyday grooming, Gillette Fusion5 is a reliable choice for men who want comfort, performance, and a confident shaving experience. Choose Gillette Fusion5 for a smoother shave and a perfectly shaped look every day. #GilletteFusion5SmoothShaveMensGroomingOriginalProductPerfectShave</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395098/3395098_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T22:08:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395097</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395097/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>clique e ganhe na hora</video:title>
      <video:description>paga no pix #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3395000/3395097/3395097_720p.mp4</video:content_loc>
      <video:duration>266</video:duration>
      <video:publication_date>2026-09-01T22:08:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395096</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395096/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>🤖 I Made a MINI ROBOT With a Toothbrush &amp; Tiny Motor! 😱🔥</video:title>
      <video:description>I made a tiny robot using a toothbrush and a small motor! 🤖🔥 It’s simple, creative, and fun to build. Watch until the end to see this little robot in action! 😱 Would you try to make one? 👀 #MiniRobotDIYRobotToothbrushRobotDIYRobotElectronicsInventionMakerScienceCreativeFebspotViralTrending</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395096/3395096_720p.mp4</video:content_loc>
      <video:duration>90</video:duration>
      <video:publication_date>2026-09-01T22:07:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395095</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395095/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mangueirão</video:title>
      <video:description>Noite de louvor a Deus 🙏 no mangueirão #BelémPará</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395095/3395095_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T22:07:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395094</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395094/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Reconstruí as Portas Automatizadas dos Templos da Grécia Antiga</video:title>
      <video:description>E se eu te dissesse que a Grécia Antiga já possuía portas automáticas há mais de 2.000 anos? Neste vídeo, reconstruí a incrível engenharia de Heron de Alexandria, o inventor que criou mecanismos movidos por fogo, vapor, pressão do ar e pesos escondidos para abrir as gigantescas portas dos templos sem que ninguém as tocasse. Você vai descobrir como essa tecnologia funcionava, por que ela impressionava os fiéis e como a engenharia antiga influenciou invenções que só reapareceriam muitos séculos depois. Se você gosta de história, arqueologia, engenharia antiga e mistérios das civilizações, este vídeo é para você! 👍 Curta o vídeo, inscreva-se no canal Curiosidades Históricas com IA e ative o sino para não perder novas reconstruções históricas feitas com inteligência artificial. HASHTAGS #HerondeAlexandria #GréciaAntiga #portasautomáticasdaGrécia #engenhariaperdida #invençõesdaGréciaAntiga #tecnologiadaAntiguidade #templosgregos #portasdostemplosgregos #Heroninventor #engenhariaantiga #arqueologia #históriaantiga #curiosidadeshistóricas #civilizaçõesantigas #mecanismosantigos #automaçãoantiga #vapornaGréciaAntiga #invençõesesquecidas #IAhistória #CuriosidadesHistóricascomIA #documentáriohistória</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395094/3395094_720p.mp4</video:content_loc>
      <video:duration>298</video:duration>
      <video:publication_date>2026-09-01T22:06:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395093</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395093/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 6</video:title>
      <video:description>Dessa vez os astros são Mr Segurança, Desespero, Boneco de Pano, Teleporte, Incompetente, Rei da Rapia, Aposentadoria, Cuca Fresca, Morcego, Maluco, Vida Infinita e Vídeo Show! #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395093/3395093_720p.mp4</video:content_loc>
      <video:duration>533</video:duration>
      <video:publication_date>2026-09-01T22:06:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395092</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395092/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Playing Roblox</video:title>
      <video:description>Game name: ttk #Roblox #games #Fun #FPSgames</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395092/3395092_720p.mp4</video:content_loc>
      <video:duration>125</video:duration>
      <video:publication_date>2026-09-01T22:06:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395091</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395091/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Aviso Que Ninguém Quer Ouvir | 1 João</video:title>
      <video:description>Uma carta escrita há quase dois mil anos ainda tem o poder de colocar o dedo exatamente onde dói. Neste vídeo, atravessamos os cinco capítulos de 1 João — não como um estudo distante, mas como um espelho para a vida real. Descubra o que significa andar na luz, não amar o sistema do mundo, viver o amor em ações concretas e descansar na certeza da fé que vence tudo. ✝️ Se esse vídeo tocou em algo que você precisava ouvir, deixa nos comentários qual capítulo mais falou com você. Se inscreva no canal e ative o sininho pra não perder os próximos estudos. 🙏 Sejam bem-vindos. #JesusChristJesusGodChristianfaithFaithinGodBibleHolyBibleJesusteachingsJesusquotesBibleversesGospelChristianityChristianmotivationGodsloveGodsplanTrustGodBelieveinGodPrayerPowerfulprayerChristianlife</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395091/3395091_720p.mp4</video:content_loc>
      <video:duration>376</video:duration>
      <video:publication_date>2026-09-01T22:06:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395090</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395090/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Primeiro</video:title>
      <video:description>#Muito😸</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395090/3395090_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T22:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395089</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395089/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bolo de chocolate de 6 camadas 🍫😱 Você aguentaria comer isso tudo? ASMR sem falar, só o som satisfat</video:title>
      <video:description>Bolo de chocolate com 6 camadas de recheio cremoso em ASMR mukbang! 🍫✨ Prepare o fone porque o som de mastigar e engolir é surreal. Comenta aqui embaixo se você comeria o bolo inteiro! Segue pra mais vídeos assim! #ASMR #chocolate #cake</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395089/3395089_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T22:06:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395088</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395088/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mais sinais do fim dos tempos em agosto de 2026</video:title>
      <video:description>AGOSTO DE 2026: ESTAMOS DIANTE DE MAIS UM SINAL DO FIM DOS TEMPOS? Neste vídeo, vamos investigar uma das teorias mais curiosas envolvendo o CERN, o maior laboratório de física de partículas do mundo: seria possível que experimentos científicos estivessem tentando criar ou encontrar algo parecido com um “portal”? Entre ciência, religião, teorias da conspiração e interpretações bíblicas, vamos separar o que realmente existe do que foi criado pela internet — e entender por que o CERN é frequentemente relacionado a histórias sobre dimensões, portais e até o chamado “portal para o inferno”. Também vamos analisar os acontecimentos e sinais que algumas pessoas estão relacionando ao fim dos tempos em 2026 e comparar essas interpretações com o que a Bíblia realmente diz. ⚠️ ATENÇÃO: este conteúdo apresenta teorias e interpretações para fins informativos e de reflexão. Não significa que todas as alegações apresentadas sejam fatos comprovados. Assista até o final e tire suas próprias conclusões. Afinal, estamos apenas diante de ciência... ou existe algo que ainda não conseguimos compreender? #JesusChristJesusGodChristianfaithFaithinGodBibleHolyBibleJesusteachingsJesusquotesBibleversesGospelChristianityChristianmotivationGodsloveGodsplanTrustGodBelieveinGodPrayerPowerfulprayerChristianlife</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395088/3395088_720p.mp4</video:content_loc>
      <video:duration>375</video:duration>
      <video:publication_date>2026-09-01T22:05:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395087</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395087/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lengan Buatan 100 Tahun Lalu Sudah Secanggih Ini‼️</video:title>
      <video:description>Setelah berakhirnya Perang Dunia I, jutaan tentara kembali dari medan perang dengan luka permanen, termasuk kehilangan anggota tubuh akibat artileri berat, ledakan, dan serpihan peluru. Kondisi ini mendorong perkembangan besar di bidang prostetik, menghasilkan lengan buatan yang pada masanya tergolong sangat maju. Banyak model menggunakan sistem kabel, pegas, dan pengait khusus yang memungkinkan penggunanya memegang benda, menggunakan alat kerja, hingga melakukan aktivitas sehari-hari secara lebih mandiri. Rekaman serupa yang beredar banyak dikaitkan dengan demonstrasi prostetik untuk veteran perang pada awal 1920-an, ketika dunia medis mulai berfokus membantu para penyintas perang membangun kembali kehidupan mereka. 📌 Video ini disajikan untuk edukasi dan konteks historis. Konten di dalamnya tidak bertujuan mengagungkan atau membenarkan kekerasan, ideologi ekstrem, maupun ujaran kebencian. Seluruh informasi disampaikan agar penonton dapat memahami peristiwa sejarah secara objektif dan kritis.</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395087/3395087_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T22:05:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395086</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395086/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ARMADILHA PEGOU PEIXE</video:title>
      <video:description>ARMADILHA PEGOU UMA TRAIRA BOA #UNITEDSTATES</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395086/3395086_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T22:05:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395085</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395085/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Resolução de questões de Raciocínio Lógico</video:title>
      <video:description>Resolução de questões de Raciocínio Lógico</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395085/3395085_720p.mp4</video:content_loc>
      <video:duration>197</video:duration>
      <video:publication_date>2026-09-01T22:05:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395084</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395084/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Full Anime | That Time I Got Reincarnated as a Slime - Season 1 Ep.9~16</video:title>
      <video:description>Full Anime | That Time I Got Reincarnated as a Slime - Season 1 Ep.9~16 #FullAnimeThatTimeIGotReincarnatedasaSlime-Season1Ep916</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395084/3395084_720p.mp4</video:content_loc>
      <video:duration>11375</video:duration>
      <video:publication_date>2026-09-01T22:04:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395083</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395083/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sera que o app goldem merge paga ?</video:title>
      <video:description>veja ! #appsmaster</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395083/3395083_720p.mp4</video:content_loc>
      <video:duration>277</video:duration>
      <video:publication_date>2026-09-01T22:04:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395082</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395082/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Escolha que decidiu a humanidade e sua eternidade</video:title>
      <video:description>A Queda dos Anjos: o que realmente aconteceu? Você sabia que os anjos não &quot;aprendem&quot; como nós — eles simplesmente sabem? Neste vídeo, explicamos, com base na teologia de São Tomás de Aquino, como se deu a Queda dos Anjos: desde o momento em que foram criados já com pleno conhecimento, passando pela prova decisiva que cada um enfrentou, até o julgamento definitivo que fixou para sempre o destino de cada um — para o bem ou para o mal. Descubra por que a escolha dos anjos foi única e irreversível, por que um terço deles se rebelou segundo a tradição, e por que os demônios, mesmo sofrendo eternamente, jamais se arrependem da decisão que tomaram. Um mergulho direto e acessível em um dos temas mais profundos da teologia cristã. 📖 Baseado nos ensinamentos de São Tomás de Aquino e na tradição da Igreja. #JesusChristJesusGodChristianfaithFaithinGodBibleHolyBibleJesusteachingsJesusquotesBibleversesGospelChristianityChristianmotivationGodsloveGodsplanTrustGodBelieveinGodPrayerPowerfulprayerChristianlife</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395082/3395082_720p.mp4</video:content_loc>
      <video:duration>213</video:duration>
      <video:publication_date>2026-09-01T22:04:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395081</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395081/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 5</video:title>
      <video:description>Dessa vez os astros são Mr Não Pode Fazer Nenê, Mr Barriga, Mr Sem Noção, Mr Putinho, Mr Tábua de Passar Roupa, Mr Engenheiro de Obra, Mr PIão do Baú, Mr Por que? , Mr Pracu e Mr Náufrago! #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395081/3395081_720p.mp4</video:content_loc>
      <video:duration>406</video:duration>
      <video:publication_date>2026-09-01T22:04:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395080</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395080/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Mãe de menino que morreu ao cair de cobertura de prédio se forma em Direito</video:title>
      <video:description>Mãe de menino que morreu ao cair de cobertura de prédio se forma em Direito</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395080/3395080_720p.mp4</video:content_loc>
      <video:duration>440</video:duration>
      <video:publication_date>2026-09-01T22:04:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395079</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395079/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>gdchrikbf</video:title>
      <video:description>hycseiblo vdyhoki #vyibjinguyfh</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395079/3395079_720p.mp4</video:content_loc>
      <video:duration>54</video:duration>
      <video:publication_date>2026-09-01T22:04:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395078</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395078/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>VEGETABLE SOUP</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395078/3395078_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:03:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395077</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395077/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>testei 2 apps pagando</video:title>
      <video:description>paga na hora veja #appsmaster</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395077/3395077_720p.mp4</video:content_loc>
      <video:duration>277</video:duration>
      <video:publication_date>2026-09-01T22:03:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395076</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395076/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Wandinha 4</video:title>
      <video:description>Wandinha #Wandinha</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395076/3395076_720p.mp4</video:content_loc>
      <video:duration>164</video:duration>
      <video:publication_date>2026-09-01T22:02:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395075</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395075/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kkkkk 12</video:title>
      <video:description>K</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395075/3395075_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T22:02:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395074</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395074/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PESCADORA PEGOU UM PIRARUCU</video:title>
      <video:description>PEGOU UM GRANDE PIRARUCU #UNITEDSTATES</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395074/3395074_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:02:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395073</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395073/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love S01E01 Hindi Dubbed KDrama HD | Full Episode Korean Drama</video:title>
      <video:description>Filing for Love S01E01 Hindi Dubbed KDrama HD | Full Episode Korean Drama #KDramaaddicte #KDramaHindiDubbed #KDramaHindi #KoreandramaHindidubbed</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395073/3395073_720p.mp4</video:content_loc>
      <video:duration>3840</video:duration>
      <video:publication_date>2026-09-01T22:01:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395072</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395072/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Circo foi filmado aqui em casa lindo</video:title>
      <video:description>Galera olha o corvo filmei aqui em casa #Corvoaquiemcasa</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395072/3395072_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:01:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395071</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395071/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 4</video:title>
      <video:description>VALE A PENA VER DE NOVO!* Dessa vez os astros são Mr Caí, Tatu, Adivinha, Ridículo, Ajudante de Pedreiro, Puts - Quedrou, Partomucleta, Gênio, Cruzadinha e Homem Aranha Esculhamba. #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395071/3395071_720p.mp4</video:content_loc>
      <video:duration>460</video:duration>
      <video:publication_date>2026-09-01T22:01:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395070</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395070/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lindo dia</video:title>
      <video:description>Boa tarde</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395070/3395070_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T22:01:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395069</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395069/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu Dog</video:title>
      <video:description>Cao lindo</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3395000/3395069/3395069_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:00:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395068</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395068/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NUNCA MEXA COM QUEM TÁ QUIETO</video:title>
      <video:description>os cachorros selvagens se deram mal ao atacar esse animal #savana #cachorroselvagens #África</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395068/3395068_720p.mp4</video:content_loc>
      <video:duration>11</video:duration>
      <video:publication_date>2026-09-01T22:00:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395067</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395067/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Meu refúgio</video:title>
      <video:description>Quarto simples , mais cheio amor#kitnet #brasil#amigos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395067/3395067_720p.mp4</video:content_loc>
      <video:duration>41</video:duration>
      <video:publication_date>2026-09-01T22:00:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395066</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395066/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Patos aqui de casa</video:title>
      <video:description>Galera patos criados aqui em casa curte ,comente e compartilha #Patosdecasa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395066/3395066_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:00:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395065</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395065/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Strawberry Cream</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395065/3395065_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T22:00:19+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395064</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395064/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Relato de um Náufrago por Gabriel García Márquez - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Descubra a história real de um náufrago que desafiou o mar e a morte. Uma lição de sobrevivência que transformará sua visão! Essa História Real de Náufrago Mudará Sua Visão de Sobrevivência Neste vídeo, mergulhe na profunda história real de Luís Alejandro Velasco, o náufrago que inspirou &quot;O Relato de um Náufrago&quot;, obra-prima de Gabriel García Márquez. A incrível jornada de sobrevivência no mar, um drama que redefine a resiliência humana. Mais que uma simples leitura, este livro oferece insights poderosos sobre a força do espírito humano diante da adversidade. Prepare-se para uma reflexão profunda sobre a vida, a morte e a capacidade de superação, revelando lições valiosas para qualquer desafio. Como este relato jornalístico se tornou um clássico da literatura latino-americana, misturando a precisão dos fatos reais com a maestria narrativa de Gabo. Uma discussão essencial para amantes de literatura e histórias inspiradoras. Se inscreva no canal para mais vídeos sobre literatura, histórias reais e superação. Ative o sino! Sua próxima grande leitura começa aqui. Minhas redes sociais 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #Náufrago #GabrielGarcíaMárquez #resenha #livro #resumo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395064/3395064_720p.mp4</video:content_loc>
      <video:duration>391</video:duration>
      <video:publication_date>2026-09-01T22:00:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395063</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395063/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bom dia Deus</video:title>
      <video:description>Deus é Bom</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395063/3395063_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T22:00:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395062</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395062/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Gillette Fusion5 Razor</video:title>
      <video:description>Gillette Fusion5 Razor is designed to deliver a smooth, close, and comfortable shaving experience. Its five precision blades help provide an efficient shave while reducing the need for repeated strokes. The advanced razor design offers better control and helps achieve a clean, well-groomed look. Ideal for everyday grooming, Gillette Fusion5 is a reliable choice for men who want comfort, performance, and a confident shaving experience. Choose Gillette Fusion5 for a smoother shave and a perfectly shaped look every day. #GilletteFusion5SmoothShaveMensGroomingOriginalProductPerfectShave</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395062/3395062_720p.mp4</video:content_loc>
      <video:duration>6</video:duration>
      <video:publication_date>2026-09-01T22:00:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395061</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395061/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cooking Stew</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395061/3395061_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:59:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395060</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395060/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Galo da minha casa lindos</video:title>
      <video:description>Estes galos são de minha casa lindos,curtem e comentei e me seguem galera #Sitio</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395060/3395060_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:59:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395059</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395059/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PESCADOR PEGOU UM CARPA GRANDE</video:title>
      <video:description>PEGOU UMA CARPA GRANDE #UNITEDSTATES</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395059/3395059_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:59:41+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395058</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395058/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Filing for Love (Hindi) - Season 01 Episode 02</video:title>
      <video:description>#FilingforLove #FilingforLoveK-drama #FilingforLove2026 #Koreandrama #K-drama #tvNdrama #ShinHae-sun #GongMyoung #KimJae-wook #HongHwa-yeon #officeromance #workplaceromance #romanticcomedy #workplacecomedy #auditteam #corporatescandal #officescandal #secretromance #romanticrelationship #investigation #deception #corruption #bossemployeerelationship #co-workersromance #enemiestolovers #slowburnromance #Koreanromancedrama #Koreanofficedrama #SecretAudit #EunmilhanGamsa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395058/3395058_720p.mp4</video:content_loc>
      <video:duration>3888</video:duration>
      <video:publication_date>2026-09-01T21:59:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395057</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395057/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Só capa 4</video:title>
      <video:description>Ganhando round #Amassandopessoa</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395057/3395057_720p.mp4</video:content_loc>
      <video:duration>39</video:duration>
      <video:publication_date>2026-09-01T21:59:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395056</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395056/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tente não rir 🤣</video:title>
      <video:description>#Brazil #humor #viral</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395056/3395056_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T21:59:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395055</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395055/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lana: The First Cat on the Moon 🌕🐱🚀 | An Epic Space Adventure</video:title>
      <video:description>Lana just made history! 🚀🐾 The first cat to explore the Moon… and she’s taking her mission very seriously. 🌕😂 #Lana #catonthemoon #firstcatonthemoon #spacecat #catastronaut #funnycat #funnycats #catvideo #cutecat #AIcat #AIvideo #catadventure #moon #space #astronaut #viralcats #funnyanimals #petvideos #cats #viralvideo #cuteanimals #catstory #spaceadventure #funnycatvideo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395055/3395055_720p.mp4</video:content_loc>
      <video:duration>42</video:duration>
      <video:publication_date>2026-09-01T21:59:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395054</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395054/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pesawat Berputar, Instruktur Tetap Tenang‼️</video:title>
      <video:description>Momen ini memperlihatkan sebuah pesawat yang kehilangan kendali dan masuk ke kondisi spin, yaitu situasi saat pesawat berputar sambil kehilangan ketinggian akibat hilangnya gaya angkat secara tidak seimbang. Dalam kondisi seperti ini, respons pilot sangat menentukan karena kesalahan kecil dapat memperburuk situasi. Yang paling menarik perhatian banyak orang adalah ketenangan sang instruktur yang tetap memberikan arahan langkah demi langkah hingga pesawat akhirnya berhasil keluar dari kondisi berbahaya dan kembali stabil. Momen ini juga menunjukkan betapa pentingnya pelatihan, kesiapan mental, dan penguasaan prosedur darurat di dunia penerbangan. 📌 Video ini disajikan untuk edukasi dan konteks historis. Konten di dalamnya tidak bertujuan mengagungkan atau membenarkan kekerasan, ideologi ekstrem, maupun ujaran kebencian. Seluruh informasi disampaikan agar penonton dapat memahami peristiwa sejarah secara objektif dan kritis.</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395054/3395054_720p.mp4</video:content_loc>
      <video:duration>24</video:duration>
      <video:publication_date>2026-09-01T21:58:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395053</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395053/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Salad 7</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395053/3395053_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:58:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395052</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395052/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Só capa 3</video:title>
      <video:description>Eu dando capa no adversário #Freefire</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395052/3395052_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T21:58:16+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395051</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395051/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Pancakes 2</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395051/3395051_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:58:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395050</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395050/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>top 2 apps jogue e ganhe</video:title>
      <video:description>saque rapido no pix #appsmaster</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395050/3395050_720p.mp4</video:content_loc>
      <video:duration>346</video:duration>
      <video:publication_date>2026-09-01T21:57:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395049</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395049/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 minuto animal - Você Sabia...</video:title>
      <video:description>1 minuto animal - Você Sabia... #Anlmaiscuriosidades</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395049/3395049_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T21:57:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395048</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395048/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ParTOBA 3</video:title>
      <video:description>Dessa vez as estrelas são: Mr Cóccix, Mr Atretcha, Mr Envergadinho, Mr Pulando Muito Alto, Mr Boca de Xaxim e muito mais! #comedia #humor #humorbrasileiro #comediaBR #videosdehumor #videodecomedia #engracado #risadas #rindo #memes #memesbrasil #meme #zoeira #zoando #viral #viralizando #paravoce #explore #reelsbrasil #humorista #comediabrasileira #piadas #piadadehoje #humorsemfiltro #rindodemais #risadagarantida #momentocomedia #comediapopular #brasil #diversao #entretenimento #conteudodehumor #humorviral #videosvirais</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395048/3395048_720p.mp4</video:content_loc>
      <video:duration>394</video:duration>
      <video:publication_date>2026-09-01T21:57:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395047</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395047/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MAKING PASTA</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395047/3395047_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:57:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395046</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395046/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tudo é perda - Felipe</video:title>
      <video:description>Que você ao ouvir essa canção possa sentir a presença de Deus 🙏</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395046/3395046_720p.mp4</video:content_loc>
      <video:duration>518</video:duration>
      <video:publication_date>2026-09-01T21:57:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395045</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395045/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>NAGABOLA PREDIKSI JITU SEPTEMBER 2026 2</video:title>
      <video:description>Prediksi bola hari ini berdasarkan statistik pertandingan terbaru Analisis skor, performa tim, dan peluang kemenangan untuk pertandingan sepak bola. Subscribe untuk mendapatkan update prediksi sepak bola terbaru setiap hari. #NAGABOLA #PREDIKSI #SEPTEMBER</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395045/3395045_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T21:57:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395044</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395044/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, JONAS O CHAMADO.</video:title>
      <video:description>Louvor gospel #Louvor #gospel #brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395044/3395044_720p.mp4</video:content_loc>
      <video:duration>356</video:duration>
      <video:publication_date>2026-09-01T21:57:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395043</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395043/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Golden Bread</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395043/3395043_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:56:54+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395042</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395042/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>COOKING MEAL</video:title>
      <video:description>A female artisan character with natural, lifelike human proportions and a relaxed, believable posture, sculpted entirely from finely knitted and crocheted yarn. She has a warm oval face, subtly asymmetrical features, soft embroidered eyes, a small natural-looking crocheted nose, and a gentle expression of quiet concentration. Her face is not perfectly symmetrical or plastic-looking. Her hands are proportionate and naturally positioned, with relaxed fingers and subtle organic movement while cooking. Her body moves with realistic human weight and balance within the crochet medium. She wears a cozy cottage core outfit made entirely from knitted and crocheted materials: a softly textured cream knitted blouse, a muted sage-green crocheted apron, a long knitted skirt, and simple wool-textured slippers. Every thread, stitch, seam, fold, and fabric edge remains visibly made from yarn. Nothing about her appearance becomes photorealistic or changes material. #AICREATIVECONTENT #ANIMATIONAI #COOKINGANIMATION</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395042/3395042_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:56:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395041</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395041/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Toguro zoa amigo no aparelho de feira!</video:title>
      <video:description>Toguro zoa amigo no aparelho de feira! #Toguro #zueira #meme</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395041/3395041_720p.mp4</video:content_loc>
      <video:duration>46</video:duration>
      <video:publication_date>2026-09-01T21:56:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395040</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395040/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Papillon: O Homem que Fugiu do Inferno por Henri Charrière - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Descubra a história real e emocionante de Papillon, a fuga mais audaciosa da Guiana Francesa e sua busca pela liberdade. A História Real de Papillon: Fuga da Guiana Francesa e Liberdade 🦋 Neste vídeo, mergulhe na história real e inspiradora de Papillon, o lendário Henri Charrière. Exploramos sua incrível jornada de fuga de prisão da brutal Guiana Francesa, onde foi condenado à prisão perpétua. Uma narrativa de superação e resiliência. Mais do que um relato de aventuras, esta análise revela como a força de vontade inabalável e a determinação de Papillon o levaram à liberdade. Entenda as lições profundas sobre o poder da mente humana e a resiliência diante das adversidades, mesmo nos cenários mais desumanos. Analisamos como o livro Papillon nos ensina sobre foco, disciplina e a importância da inteligência emocional para não se render ao opressor sistema prisional. Uma verdadeira aula sobre lutar por seus sonhos e a amizade, mesmo quando tudo parece perdido. ✅ Se você curte livros que fazem pensar, emocionar e inspirar, não deixe de assistir e compartilhar. Inscreva-se no canal para mais conteúdos literários como este! Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📚 Blog: https://abre.ai/mTkF 📚 Skoob: https://abre.ai/mULP 🅿 Pinterest: https://abre.ai/mTkK #Papillon #prissao #injustiça #crime #aventura #fuga #drama #resumodelivro #resenha #romanceautobiográfico #autobiografia</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395040/3395040_720p.mp4</video:content_loc>
      <video:duration>998</video:duration>
      <video:publication_date>2026-09-01T21:56:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395039</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395039/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Amado Batista</video:title>
      <video:description>Cantando na fazenda</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395039/3395039_720p.mp4</video:content_loc>
      <video:duration>65</video:duration>
      <video:publication_date>2026-09-01T21:56:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395038</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395038/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>janda kembang</video:title>
      <video:description>janda kembang</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395038/3395038_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:55:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395037</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395037/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 Brothers: On The 4th Floor |  Dreams DJ Puzzle</video:title>
      <video:description>2 Brothers: On The 4th Floor | Dreams DJ Puzzle 🎵 Bem-vindo ao Canal Cashbox, o seu destino musical livre de preocupações! Aqui você encontra músicas 100% livres de direitos autorais, perfeitas para vídeos no YouTube, lives, podcasts, games, vinhetas, projetos comerciais e muito mais. #músicassemdireitosautorais #músicasparavídeos #músicasgrátisparaYouTube #músicaparafundodevídeo #trilhasonorasemdireitosautorais #músicasparavlog #músicasparagames #músicasparavídeoscomerciais #músicasparaprojetos #músicaeletrônicasemdireitosautorais #músicalo-fisemdireitosautorais #músicaparaediçãodevídeo #músicasparareels #músicasparastories #músicadefundográtis #músicasparapodcast #músicasparaintrodevídeo</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395037/3395037_720p.mp4</video:content_loc>
      <video:duration>221</video:duration>
      <video:publication_date>2026-09-01T21:55:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395036</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395036/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Como plantar capim-rabo-de-gato ornamental</video:title>
      <video:description>Como plantar capim-rabo-de-gato ornamental #suculentas #plantas #jardim</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395036/3395036_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:55:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395035</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395035/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GOSPEL SONG PARTY 😎🤩</video:title>
      <video:description>Eletric song #Música #Music #fun</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395035/3395035_720p.mp4</video:content_loc>
      <video:duration>79</video:duration>
      <video:publication_date>2026-09-01T21:55:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395034</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395034/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 apps que promete dinheiro real</video:title>
      <video:description>vem tbm ganhe rapido #appsmaster</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395034/3395034_720p.mp4</video:content_loc>
      <video:duration>299</video:duration>
      <video:publication_date>2026-09-01T21:55:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395033</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395033/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_670.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_670.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395033/3395033_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:54:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395032</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395032/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>WATERMELON GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395032/3395032_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:54:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395031</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395031/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LINDA ONÇA</video:title>
      <video:description>VEJÁ QUE LINDA ONÇA #UNITEDSTATES</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395031/3395031_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T21:54:40+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395030</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395030/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trabalhadores gravam o momento que a avalanche de gelo e lama avançam sobre o terreno e eles fogem</video:title>
      <video:description>Nepal e Tibet tragédia 2026 #NepaleTibet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395030/3395030_720p.mp4</video:content_loc>
      <video:duration>72</video:duration>
      <video:publication_date>2026-09-01T21:54:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395029</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395029/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, DEBORÁ, A PROFETISA.</video:title>
      <video:description>Louvor gospel #Louvor #gospel #brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395029/3395029_720p.mp4</video:content_loc>
      <video:duration>391</video:duration>
      <video:publication_date>2026-09-01T21:54:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395028</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395028/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_669.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_669.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395028/3395028_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:54:14+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395027</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395027/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>STRAWBERRY GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395027/3395027_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:54:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395026</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395026/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Decifrando  o egito</video:title>
      <video:description>Nos tempos das pirâmides também se ficava decressaca #Brasil #funnyiacartoonfunny #egitofunny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395026/3395026_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T21:54:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395025</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395025/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Paz interior que vem de Deus</video:title>
      <video:description>Paz na alma</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395025/3395025_720p.mp4</video:content_loc>
      <video:duration>60</video:duration>
      <video:publication_date>2026-09-01T21:54:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395024</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395024/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_668.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_668.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395024/3395024_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:53:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395022</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395022/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_667.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_667.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395022/3395022_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:53:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395021</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395021/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 minuto animal- cavalos mais fortes do mundo</video:title>
      <video:description>1 minuto animal- cavalos mais fortes do mundo #AnimaisCuriosos</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395021/3395021_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T21:53:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395020</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395020/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_666.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_666.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395020/3395020_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:53:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395019</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395019/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enoch | Full Movie | The Seven Heavens and the Prophecy of the Chosen One</video:title>
      <video:description>The book that was removed from the Bible #apocryphalbook</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395019/3395019_720p.mp4</video:content_loc>
      <video:duration>3621</video:duration>
      <video:publication_date>2026-09-01T21:52:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395018</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395018/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sandro Santos histórias</video:title>
      <video:description>Recordar é viver #Histórias</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395018/3395018_720p.mp4</video:content_loc>
      <video:duration>547</video:duration>
      <video:publication_date>2026-09-01T21:52:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395017</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395017/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_665.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_665.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395017/3395017_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:52:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395016</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395016/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>POMEGRANATE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395016/3395016_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:52:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395014</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395014/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Galo dançando com amigo kkk</video:title>
      <video:description>Galo dançando com seu dono #rir #comédia #pegadinha #engraçado #trolagem #divertido #Eua #china #india #brincadeiras #passatempo #global #mundial #amigos #homem #mulher #entretenimento</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395014/3395014_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T21:52:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395013</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395013/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Doze Anos de Escravidão por Solomon Northup - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Prepare-se para conhecer uma das histórias mais impactantes e dolorosas já escritas. Neste vídeo, apresento o livro &quot;12 Anos de Escravidão&quot;, de Solomon Northup, um homem livre, músico e pai de família que foi sequestrado, mantido em cativeiro e vendido como escravo no sul dos Estados Unidos. A Escravidão Como Você Nunca Viu Foram 12 anos de tortura, trabalho forçado, abusos e atrocidades testemunhadas nas plantações de algodão da Louisiana. O livro revela a crueldade do sistema escravocrata, a ganância dos senhores, a dor da separação familiar, a violência contra mulheres escravizadas — e a força de um homem que jamais desistiu de lutar pela liberdade. Se você ama literatura forte, histórica e transformadora, esse livro é simplesmente imperdível. 📚✨ Assista até o fim e descubra por que essa obra continua tão atual e necessária. Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #SolomonNorthup #resenha #livro #resumo #literatura #biografia #drama</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395013/3395013_720p.mp4</video:content_loc>
      <video:duration>295</video:duration>
      <video:publication_date>2026-09-01T21:52:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395012</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395012/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_664.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_664.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395012/3395012_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:52:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395011</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395011/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>the attacking trio that terrorized opponents</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395011/3395011_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T21:52:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395010</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395010/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PINEAPLE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395010/3395010_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:52:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395009</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395009/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_663.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_663.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395009/3395009_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:51:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395008</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395008/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_662.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_662.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395008/3395008_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:51:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395007</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395007/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_661.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_661.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395007/3395007_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:51:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395006</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395006/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SAMU urgência e emergência</video:title>
      <video:description>Resgate e salva vidas</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395006/3395006_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:51:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395005</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395005/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, DE PASTOR A REI.</video:title>
      <video:description>Louvor gospel #Louvor #gospel</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395005/3395005_720p.mp4</video:content_loc>
      <video:duration>349</video:duration>
      <video:publication_date>2026-09-01T21:51:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395004</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395004/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jamet</video:title>
      <video:description>jamet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395004/3395004_720p.mp4</video:content_loc>
      <video:duration>7</video:duration>
      <video:publication_date>2026-09-01T21:50:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395003</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395003/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_660.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_660.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395003/3395003_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:50:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395002</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395002/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>YUSUKE X TOGURO - Luta Completa / Yu Yu Hakusho</video:title>
      <video:description>YUSUKE X TOGURO - Luta Completa / Yu Yu Hakusho #YUSUKEXTOGURO-LutaCompletaYuYuHakusho</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395002/3395002_720p.mp4</video:content_loc>
      <video:duration>4484</video:duration>
      <video:publication_date>2026-09-01T21:50:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395001</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395001/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_659.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_659.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395001/3395001_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:50:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3395000</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3395000/3395000/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>rahang bawah</video:title>
      <video:description>rahang bawah</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3395000/3395000/3395000_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:50:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394999</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394999/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_658.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_658.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394999/3394999_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:50:10+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394998</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394998/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PEAR GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394998/3394998_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:50:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394997</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394997/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele tinha 2 ovos no queixo</video:title>
      <video:description>Ele tinha 2 ovos no queixo #dorama #kdrama #séries #filmes #Netflix</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394997/3394997_720p.mp4</video:content_loc>
      <video:duration>124</video:duration>
      <video:publication_date>2026-09-01T21:49:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394996</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394996/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_657.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_657.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394996/3394996_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:49:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394995</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394995/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Avalanche e enchente deixam 98 mortos e 844 desaparecidos no Nepal</video:title>
      <video:description>Avalanche e enchente deixam 98 mortos e 844 desaparecidos no Nepal #NepaleTibet</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394995/3394995_720p.mp4</video:content_loc>
      <video:duration>47</video:duration>
      <video:publication_date>2026-09-01T21:49:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394994</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394994/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ohh saudades!!!</video:title>
      <video:description>Momentos inesquecíveis!! #pazmomentosagradecer</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394994/3394994_720p.mp4</video:content_loc>
      <video:duration>28</video:duration>
      <video:publication_date>2026-09-01T21:49:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394993</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394993/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zero Bilisibity</video:title>
      <video:description>#funny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394993/3394993_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:49:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394992</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394992/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_656.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_656.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394992/3394992_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:49:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394991</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394991/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>when your goalkeeper is a wizard</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394991/3394991_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:49:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394990</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394990/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>PAPAYA GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394990/3394990_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:49:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394989</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394989/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_655.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_655.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394989/3394989_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:49:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394988</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394988/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Decoração  canina</video:title>
      <video:description>Cachorro usa decoração a seu favor #Brasil #funnydogs #iafunny</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394988/3394988_720p.mp4</video:content_loc>
      <video:duration>16</video:duration>
      <video:publication_date>2026-09-01T21:49:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394987</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394987/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_654.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_654.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394987/3394987_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:49:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394986</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394986/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>ORANGE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394986/3394986_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:48:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394985</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394985/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_653.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_653.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394985/3394985_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:48:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394984</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394984/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Nossa na concha na praia</video:title>
      <video:description>Planeta Brasil</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394984/3394984_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T21:48:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394982</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394982/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Não pare</video:title>
      <video:description>Você nunca pode parar nunca desista dos seus objetivos #fémotiva</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394982/3394982_720p.mp4</video:content_loc>
      <video:duration>27</video:duration>
      <video:publication_date>2026-09-01T21:48:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394981</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394981/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_652.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_652.mp4</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394981/3394981_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:48:32+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394980</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394980/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>I nail the kick</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394980/3394980_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:48:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394979</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394979/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>sistem pertahanan hidung</video:title>
      <video:description>sistem pertahanan hidung</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394979/3394979_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:48:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394978</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394978/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Drama curto</video:title>
      <video:description>Doramas coreano #dramafiedoramaromence</video:description>
      <video:content_loc>https://st81.febspot.com/videos/3390000/3394978/3394978_720p.mp4</video:content_loc>
      <video:duration>174</video:duration>
      <video:publication_date>2026-09-01T21:48:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394977</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394977/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ele se chama vapor humano e veio exterminar as ameaças da terra contra a humanidade 🎭🎬🍿</video:title>
      <video:description>Ele se chama vapor humano e veio exterminar as ameaças da terra contra a humanidade 🎭🎬🍿 Aqui você encontra os melhores filmes Os melhores trechos de filmes e séries e etc. 🎭🎬🍿 #Filmecientíficofilmedeterrorfilmedeação</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394977/3394977_720p.mp4</video:content_loc>
      <video:duration>215</video:duration>
      <video:publication_date>2026-09-01T21:48:25+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394976</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394976/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Kombo Assist Dan Gol Tercantik</video:title>
      <video:description>Kombo Assist Dan Gol Tercantik</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394976/3394976_720p.mp4</video:content_loc>
      <video:duration>67</video:duration>
      <video:publication_date>2026-09-01T21:48:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394975</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394975/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_651.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_651.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394975/3394975_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:48:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394974</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394974/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Enchente Relâmpago no Nepal 2026: Como o Colapso de uma Geleira Provocou uma Inundação Mortal</video:title>
      <video:description>Enchente Relâmpago no Nepal 2026: Como o Colapso de uma Geleira Provocou uma Inundação Mortal #NepaleTibet</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394974/3394974_720p.mp4</video:content_loc>
      <video:duration>32</video:duration>
      <video:publication_date>2026-09-01T21:48:08+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394973</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394973/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>jogue e ganhe no pix</video:title>
      <video:description>clique e ganhe veja #canalappsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394973/3394973_720p.mp4</video:content_loc>
      <video:duration>356</video:duration>
      <video:publication_date>2026-09-01T21:48:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394972</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394972/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MELON GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394972/3394972_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:47:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394971</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394971/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>MANGO GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394971/3394971_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:47:13+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394970</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394970/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>2 apps que pagam dinheiro real</video:title>
      <video:description>baixou ganhou na hora #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394970/3394970_720p.mp4</video:content_loc>
      <video:duration>330</video:duration>
      <video:publication_date>2026-09-01T21:47:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394969</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394969/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>King of 1v1</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394969/3394969_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:47:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394968</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394968/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Sonic tenta várias vezes comprar Doritos até que… #IA #memes #desenhos</video:title>
      <video:description>#IA #memes #desenhos Este vídeo é uma paródia humorística e transformativa Vídeo feito por um ser humano com inteligência artificial Humor, memes, chat gpt, inteligência artificial, paródia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394968/3394968_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:46:50+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394966</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394966/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LEMON GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394966/3394966_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:46:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394965</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394965/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O CEO que só ela conquistou</video:title>
      <video:description>O CEO que só ela conquistou</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394965/3394965_720p.mp4</video:content_loc>
      <video:duration>118</video:duration>
      <video:publication_date>2026-09-01T21:46:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394964</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394964/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Parece pai e filha</video:title>
      <video:description>Mas são irmãos mesmo sendo tão parecidos #Gatos #gatinho #gatinhos #felinos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394964/3394964_720p.mp4</video:content_loc>
      <video:duration>21</video:duration>
      <video:publication_date>2026-09-01T21:46:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394963</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394963/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>apps que pagam dinheiro real</video:title>
      <video:description>veja a mamata #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394963/3394963_720p.mp4</video:content_loc>
      <video:duration>298</video:duration>
      <video:publication_date>2026-09-01T21:46:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394962</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394962/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dibs: Em Busca de Si Mesmo por Virgínia Mae Axline - Resenha</video:title>
      <video:description>Olá, leitores! 👋✨ Você já ouviu falar em Dibs em Busca de Si Mesmo? 💭 Neste vídeo, Adri apresenta uma das histórias mais emocionantes da literatura sobre autoconhecimento, cura emocional e empatia. O que aprendi lendo o DIBS e como isso pode ajudar seu filho 📖 O livro conta a jornada de Dibs, uma criança de 5 anos com distúrbios emocionais que, por meio da ludoterapia, descobre o poder da vida, do amor e da conexão com o mundo ao seu redor. Essa história vai te fazer refletir sobre o sentido da existência, a importância do olhar para dentro e o respeito a todos os seres vivos — das pessoas às plantas, dos animais ao próprio planeta. 🌍💚 Se você busca livros que mudam sua forma de ver o mundo, prepare-se para se emocionar com essa leitura transformadora. 👉 Deixe seu like, inscreva-se no canal e ative o sininho 🔔 para não perder mais histórias que tocam o coração! Obrigada por assistir e até o próximo vídeo! 🌟 Minhas redes sociais 📚 Skoob: https://abre.ai/mUL9 🅿 Pinterest: https://abre.ai/mTkK #livro #resenha #Brasil #psicologiainfantil #psicologia #ludoterapia</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394962/3394962_720p.mp4</video:content_loc>
      <video:duration>238</video:duration>
      <video:publication_date>2026-09-01T21:45:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394961</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394961/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>GRAPE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394961/3394961_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:45:57+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394960</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394960/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Receita deliciosa 3</video:title>
      <video:description>Receita #Receita</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394960/3394960_720p.mp4</video:content_loc>
      <video:duration>23</video:duration>
      <video:publication_date>2026-09-01T21:45:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394959</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394959/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_650.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_650.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394959/3394959_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:45:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394958</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394958/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO JÁ ACOSTUMOU BEM COM CARRINHO</video:title>
      <video:description>MENINO GUERREIRO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394958/3394958_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:45:44+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394957</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394957/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>FIG GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394957/3394957_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:45:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394956</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394956/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>1 minuto animal -  Seres Bizarros</video:title>
      <video:description>1 minuto animal - Seres Bizarros #Animaiscuriosidades</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394956/3394956_720p.mp4</video:content_loc>
      <video:duration>61</video:duration>
      <video:publication_date>2026-09-01T21:45:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394955</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394955/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>How does God use ordinary lives to change the world?</video:title>
      <video:description>Have you ever wondered what God&apos;s purpose is for your life? God didn&apos;t create you by chance — He has a plan, and it touches other people&apos;s lives. In this reflection, we will understand how God uses ordinary lives to impact the world, with Bible verses and stories that will renew your faith. 📖 Verses from this reflection: Ephesians 2:10 · Jeremiah 29:11 · Matthew 5:14 🙏 If this message touched your heart, share it with someone who needs to hear it and subscribe to the channel. #god&apos;s purpose #christian reflection #God&apos;s word #prayer #dailyreflections Discover how God uses ordinary lives to change the world through Christian reflection and the word of God. In this video, we explore the idea that God&apos;s calling is present in each of us, guiding us in our life purpose and giving us a sense of direction. By reading the Holy Bible and practicing prayer, we can better understand God&apos;s plan for our lives and how He cares for us at all times. With a storytelling and filmmaking approach, we bring a message of faith and hope, showing that a life with purpose is possible when we have faith in God. Join us on this journey of Christian discovery and reflection, and find inspiration in the verse of the day to live a life full of meaning. God&apos;s message is clear: He loves us and has a special purpose for us, and it&apos;s time to find out what ours is. Through daily devotions and the practice of reflection, we can deepen our relationship with God and better understand how He works in our lives. Don&apos;t miss this opportunity to grow in your faith and find your life purpose. #God #Ephesians210 #reflection</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394955/3394955_720p.mp4</video:content_loc>
      <video:duration>246</video:duration>
      <video:publication_date>2026-09-01T21:45:34+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394954</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394954/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O QUE ESTÁ ACONTECENDO COM LAMINE YAMAL</video:title>
      <video:description>Após o Barcelona golear o Elche por 5 x 0, Yamal saiu aos 65 minutos do segundo tempo, sentou no banco de reservas e começou a chorar. O que será que está acontecendo com o jovem espanhol? Vamos descobrir o motivo disso tudo nesse vídeo! #lamineyamal #yamal #messi #cristianoronaldo #futebol #barcelona #laliga</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394954/3394954_720p.mp4</video:content_loc>
      <video:duration>458</video:duration>
      <video:publication_date>2026-09-01T21:45:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394953</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394953/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_649.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_649.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394953/3394953_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:45:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394952</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394952/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5 MYSTERIES DISCOVERED BY SCIENCE</video:title>
      <video:description>In this video, we explore 5 mysteries that challenged our understanding and were investigated by science. Discoveries involving the past, life, the universe, and unexplained phenomena reveal how science can transform ancient enigmas into new questions. Some mysteries now have scientific explanations, while others continue to puzzle researchers and fuel our curiosity. #misterio #educação #documentário #entretenimento #fatoscuriosos #curiosidade #história</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394952/3394952_720p.mp4</video:content_loc>
      <video:duration>327</video:duration>
      <video:publication_date>2026-09-01T21:45:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394950</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394950/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Join my dating profile for free fun with me 💋💦👇</video:title>
      <video:description>Join My Dating Profile 💕 for **free video chat** with me! 💕 Just click the link below and complete the signup step by step. Verify your email address and finish your profile to connect with me. Join Here: 👇 https://boalew.hotdatezzone.com/?utm_source=da57dc555e50572d&amp;ban=other&amp;j5=1&amp;j6=1&amp;s1=253193&amp;s2=2279787&amp;s3=Cam_girl_3 #datingprofile #freevideochat #onlinedating #videochat #meetnewpeople #chatwithme #datingapp #onlineconnection #livevideochat #meetsingles #personaldatingprofile #freechat #onlinefriends #virtualdating #connectwithme #datingcommunity #videocall #socialdating #newconnections #onlineconversation</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394950/3394950_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:45:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394949</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394949/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_648.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_648.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394949/3394949_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:45:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394948</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394948/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_647.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_647.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394948/3394948_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:44:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394947</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394947/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>EU NÃO TENHO UM PC 🤯 | MAS EU TENHO UM SONHO… #FreeFire #FreeFireBrasil #FF #Shorts  #FreeFireShorts</video:title>
      <video:description>o Free Fire foi lançado em 2017 e se tornou um dos maiores jogos mobile do mundo? 🔥 #freefire #freefirebrasil #freefireshorts #freefirefreefireshortsfreefirebrasilfreefiregameplayfreefireviral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394947/3394947_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T21:44:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394945</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394945/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_646.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_646.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394945/3394945_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:44:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394944</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394944/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Só capa 2</video:title>
      <video:description>Free fire #freefire</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394944/3394944_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:44:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394943</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394943/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHICO NA FESTA</video:title>
      <video:description>MEU MENINO LINDO</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394943/3394943_720p.mp4</video:content_loc>
      <video:duration>56</video:duration>
      <video:publication_date>2026-09-01T21:44:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394939</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394939/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CHERRY GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394939/3394939_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:43:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394937</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394937/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tenis Futurista</video:title>
      <video:description>No video,mostra robos montando o tenis desde o inicio com ultratecnolgia.</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394937/3394937_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:43:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394936</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394936/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_645.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_645.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394936/3394936_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:43:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394935</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394935/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_644.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_644.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394935/3394935_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:43:17+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394934</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394934/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>BANANA GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394934/3394934_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:43:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394933</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394933/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Look at this amazing renovation.</video:title>
      <video:description>Here&apos;s the translation: But one that, with courage, came back to life brick by brick. From the hardship of demolition to the comfort of the finishing touches, follow the complete transformation and the reunion with memories — now with a fresh start. Comment: which city are you watching from? --- If you want a slightly more natural/flowing version for social media (like Instagram/YouTube captions), here&apos;s an alternative: But this one, with courage, was brought back to life brick by brick. From the rawness of demolition to the coziness of the final finishes, watch the full transformation and the return to cherished memories — now with a brand-new beginning. Drop a comment: where are you watching from? #BeforeAndAfterConstructionConcreteTransformationRenovationRealLifeBuildingFreshStartHopeHomeHousesRemodeling</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394933/3394933_720p.mp4</video:content_loc>
      <video:duration>101</video:duration>
      <video:publication_date>2026-09-01T21:43:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394932</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394932/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Dogs Who Take Food Theft WAY Too Seriously 😂🐶</video:title>
      <video:description>These dogs have absolutely no patience when it comes to food! 😂🐶 From eating way too fast to stealing food from their humans, these hungry pups are on a mission! Watch until the end and try not to laugh! 🍗🤣 #funnydogs #dogsstealingfood #hungrydogs #funnydogvideos #dogseatingfast #dogseating #foodthiefdogs #funnyanimals #dogsbeingdogs #viraldogvideos</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394932/3394932_720p.mp4</video:content_loc>
      <video:duration>151</video:duration>
      <video:publication_date>2026-09-01T21:43:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394931</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394931/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_643.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_643.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394931/3394931_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:42:59+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394930</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394930/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Devia Tirar Mais Fotos| Tradução e adaptação: Rick Tosans</video:title>
      <video:description>#fypmusicfouryoudtmf</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394930/3394930_720p.mp4</video:content_loc>
      <video:duration>171</video:duration>
      <video:publication_date>2026-09-01T21:42:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394929</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394929/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Trap Soul Gospel Brasileiro 🔥 | As Mais Ouvidas</video:title>
      <video:description>🔥 TRAP SOUL GOSPEL BRASILEIRO 🎧🙏 Uma seleção especial de Trap Soul Gospel para quem curte música cristã com uma sonoridade moderna, envolvente e cheia de personalidade. Prepare o fone, aumente o volume e aproveite essa playlist com uma mistura de Trap Gospel, Soul, R&amp;B e música cristã brasileira. 💿🔥 🎵 Trap Soul Gospel 🇧🇷 Gospel Brasileiro 🎧 Trap Gospel &amp; R&amp;B Gospel 🙏 Música Cristã 🔥 Playlist Gospel Curtiu? Siga o perfil, deixe seu like e compartilhe para acompanhar mais playlists e músicas gospel. Keywords: Trap Soul Gospel, Trap Gospel, Trap Gospel Brasileiro, Gospel Brasileiro, Música Gospel, Música Cristã, Gospel Trap, R&amp;B Gospel, Soul Gospel, Playlist Gospel, Playlist Trap Gospel, Trap Cristão, Gospel 2026, Louvor Gospel, Música Gospel Brasileira #ParaoFebspot #useestastagskeywordssemTrapSoulGospel #TrapGospel #TrapGospelBrasileiro #TrapSoulBrasileiro #GospelBrasileiro #MúsicaGospel #MúsicaGospelBrasileira #MúsicaCristã #TrapCristão #GospelTrap #SoulGospel #RBGospel #PlaylistGospel #PlaylistTrapGospel #GospelPlaylist #TrapGospel2026 #Gospel2026 #LouvorGospel #Adoração #MúsicaEvangélica #GospelMusic #ChristianMusic #ChristianTrap #ChristianRB #WorshipMusic #TrapSoul #PlaylistBrasileira</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394929/3394929_720p.mp4</video:content_loc>
      <video:duration>8976</video:duration>
      <video:publication_date>2026-09-01T21:42:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394928</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394928/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AVOCADO GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394928/3394928_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:42:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394927</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394927/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_642.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_642.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394927/3394927_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:42:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394925</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394925/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>5 Cidades Perdidas que Ninguém Encontrou Até Hoje</video:title>
      <video:description>Existem cidades grandiosas descritas ao longo da história que simplesmente desapareceram. Atlântida, El Dorado, a Cidade de Z e outros lugares lendários que milhares de exploradores procuraram — e até hoje ninguém encontrou. Será que realmente existiram? Ou permanecem escondidas esperando serem descobertas? Conheça os maiores mistérios das cidades perdidas da história. Deixe sua opinião nos comentários: qual dessas você acredita que ainda será encontrada? #cidadesperdidas #cidadeperdida #mistériosdahistória #Atlântida #ElDorado #CidadedeZ #Aztlán #Vinland #cidadeslendárias #fatoshistóricos #mistériosantigos #sabedoriaantiga #curiosidades #históriadesconhecida #enigmadahistória</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394925/3394925_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T21:42:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394924</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394924/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_641.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_641.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394924/3394924_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:42:21+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394922</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394922/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>APRICOT GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394922/3394922_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:42:18+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394921</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394921/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>libere as setas eganhe</video:title>
      <video:description>ganhe no pix #appsmaster</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394921/3394921_720p.mp4</video:content_loc>
      <video:duration>296</video:duration>
      <video:publication_date>2026-09-01T21:42:07+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394920</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394920/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Tivadim</video:title>
      <video:description>Saudades do meu pai</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394920/3394920_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-01T21:42:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394919</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394919/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>An emotional renovation of this house.construção</video:title>
      <video:description>a transformação completa para devolver dignidade e conforto a uma senhora. Assista ao “antes e depois” ao vivo História contada fictícia! #ConstructionBuildLotAbandonedRenovationFoundationStructureConcreteRoofGardenPoolDeckArchitectureBeforeAndAfter</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394919/3394919_720p.mp4</video:content_loc>
      <video:duration>126</video:duration>
      <video:publication_date>2026-09-01T21:42:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394918</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394918/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_640.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_640.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394918/3394918_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:42:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394917</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394917/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>APPLE GLASS</video:title>
      <video:description>A sharp knife cuts the glass Fruit, which cracks and shatters in super slow motion, shards of crystal scattering #AIVideoProduction #CreativeVideoswithAI #AnimatedVideoswithAI #CreativeVideoContentProductionwithAI</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394917/3394917_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:41:46+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394916</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394916/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>imagem forte</video:title>
      <video:description>linda visão imagens para não esquecer</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394916/3394916_720p.mp4</video:content_loc>
      <video:duration>62</video:duration>
      <video:publication_date>2026-09-01T21:41:45+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394915</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394915/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_639.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_639.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394915/3394915_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:41:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394914</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394914/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Renascida</video:title>
      <video:description>Dorama,dramas. Coreana #doramadramaviral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394914/3394914_720p.mp4</video:content_loc>
      <video:duration>172</video:duration>
      <video:publication_date>2026-09-01T21:41:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394912</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394912/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>SHE THOUGHT SHE WAS THE ONLY ONE… UNTIL SHE DISCOVERED THE TRUTH!</video:title>
      <video:description>She always believed in his love. He had promised that she was the only woman in his life. But that night, everything changed. When she found the two of them together, her heart was shattered. At first, she thought it was just her imagination, a coincidence… until she realized there was something much deeper and darker behind the story. What was he hiding? Why did he lie to her? And could the truth destroy everything they had built together? Get ready for a story of love, betrayal, secrets, and an unexpected discovery. 💔😢 👉 Watch until the end to discover what was really happening. #LoveStoryBetrayalSecretsDramaEmotionalStoryRelationshipLoveHeartbreakStoriesThatTouchTheHeart</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394912/3394912_720p.mp4</video:content_loc>
      <video:duration>29</video:duration>
      <video:publication_date>2026-09-01T21:41:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394911</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394911/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Ninguém queria este lugar, mas o “impossível” virou a casa dos sonhos!</video:title>
      <video:description>Pedras enormes, desníveis e obstáculos deram lugar a uma arquitetura única. Assista a transformação de um terreno rejeitado em um projeto cheio de identidade e coragem. Comenta: de qual cidade você está assistindo? #Transformação #Construção #Arquitetura #ProjetoResidencial #ConstruçãoCivil #CasaDosSonhos #Terreno #Inspiração #antesedepois História contada fictícia! #ConstruçãoObraTerrenoAbandonadoReformaFundaçãoEstruturaConcretoTelhadoJardimPiscinaDeckArquiteturaantesedepois</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394911/3394911_720p.mp4</video:content_loc>
      <video:duration>105</video:duration>
      <video:publication_date>2026-09-01T21:41:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394910</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394910/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>A Little Fairy Magic For Your Morning ✨</video:title>
      <video:description>Aesthetic (best for Instagram): Good Morning from the fairy garden 🧚‍♀️✨ Starting the day with a little sparkle, glowing flowers and a magical message just for you. May your morning be as soft and bright as this garden 💜 #goodmorningvideo #fairygoodmorning #magicalgoodmorning #enchantedgarden #cutegoodmorningstatus #aestheticmorninggreeting #fairywriting</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394910/3394910_720p.mp4</video:content_loc>
      <video:duration>14</video:duration>
      <video:publication_date>2026-09-01T21:41:30+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394909</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394909/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Lamine yamal 6</video:title>
      <video:description>Edit #Edits</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394909/3394909_720p.mp4</video:content_loc>
      <video:duration>12</video:duration>
      <video:publication_date>2026-09-01T21:41:27+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394908</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394908/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_638.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_638.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394908/3394908_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:41:23+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394907</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394907/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>when someone misses the play rehearsal</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394907/3394907_720p.mp4</video:content_loc>
      <video:duration>20</video:duration>
      <video:publication_date>2026-09-01T21:41:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394906</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394906/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_637.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_637.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394906/3394906_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:41:05+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394905</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394905/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Cute Girl 227</video:title>
      <video:description>Beautiful</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394905/3394905_720p.mp4</video:content_loc>
      <video:duration>17</video:duration>
      <video:publication_date>2026-09-01T21:41:03+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394904</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394904/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Harlequin twerk</video:title>
      <video:description>#Twerk</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394904/3394904_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T21:41:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394903</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394903/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_636.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_636.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394903/3394903_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:40:47+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394902</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394902/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Geo Best Drama 13</video:title>
      <video:description>My Favourite Drama</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394902/3394902_720p.mp4</video:content_loc>
      <video:duration>348</video:duration>
      <video:publication_date>2026-09-01T21:40:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394901</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394901/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>caminhe e ganhe</video:title>
      <video:description>ande e ganhe com master</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394901/3394901_720p.mp4</video:content_loc>
      <video:duration>307</video:duration>
      <video:publication_date>2026-09-01T21:40:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394900</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394900/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Turismo</video:title>
      <video:description>Curtindo geriad #Viagem #turismo #cidade #lugares #estados</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394900/3394900_720p.mp4</video:content_loc>
      <video:duration>25</video:duration>
      <video:publication_date>2026-09-01T21:40:29+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394899</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394899/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Har har Mahadev 🙏🙏</video:title>
      <video:description>#HarharMahadev🙏🙏</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394899/3394899_720p.mp4</video:content_loc>
      <video:duration>31</video:duration>
      <video:publication_date>2026-09-01T21:40:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394897</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394897/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Você teria coragem de comprar um terreno tão estreito que praticamente todo mundo dizia que uma casa</video:title>
      <video:description>Você teria coragem de comprar um terreno tão estreito que praticamente todo mundo dizia que uma casa jamais caberia aqui? História contada fictícia! #ConstruçãoObraTerrenoAbandonadoReformaFundaçãoEstruturaConcretoTelhadoJardimPiscinaDeckArquiteturaantesedepois</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394897/3394897_720p.mp4</video:content_loc>
      <video:duration>99</video:duration>
      <video:publication_date>2026-09-01T21:40:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394896</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394896/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Romário chora de rir com treino insano de Héctor Cúper! 😳😂</video:title>
      <video:description>Três quilômetros de aquecimento só pra começar? 😳🔥 O Ronaldo Fenômeno, Romário, Roberto Carlos e Materazzi abriram o jogo sobre os métodos malucos de Héctor Cúper na época de ouro do futebol! Você aguentaria um treino desse? Deixe sua opinião nos comentários! #Romário #RonaldoFenômeno #HéctorCúper #RobertoCarlos #MarcoMaterazzi #treinosmaisdifíceisdofutebol #resenhadefutebol #históriasdejogadores #futebollegends #curiosidadesdofutebol</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394896/3394896_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T21:40:02+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394895</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394895/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Beautiful Song 265</video:title>
      <video:description>Feel This Song</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394895/3394895_720p.mp4</video:content_loc>
      <video:duration>22</video:duration>
      <video:publication_date>2026-09-01T21:39:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394894</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394894/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Another country&apos;s reaction when they see a snake.</video:title>
      <video:description>See the reaction of another country when they see a large snake. #reels #reelsmemescomedy</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394894/3394894_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:39:42+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394893</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394893/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>when the setter saves the team in soccer</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394893/3394893_720p.mp4</video:content_loc>
      <video:duration>9</video:duration>
      <video:publication_date>2026-09-01T21:39:37+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394892</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394892/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Rádio hits damata fm 3</video:title>
      <video:description>Musicas notícias esporte #AfricananovaYorkBrasil</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394892/3394892_720p.mp4</video:content_loc>
      <video:duration>34</video:duration>
      <video:publication_date>2026-09-01T21:39:36+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394891</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394891/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Por quase 10 anos, um terreno ficou abandonado no melhor pedaço do bairro</video:title>
      <video:description>Durante quase dez anos, ninguém entendeu por que este terreno, em uma das melhores ruas do bairro, continuava abandonado. História contada fictícia! #ConstruçãoObraTerrenoAbandonadoReformaFundaçãoEstruturaConcretoTelhadoJardimPiscinaDeckArquiteturaAntesEDepois</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394891/3394891_720p.mp4</video:content_loc>
      <video:duration>172</video:duration>
      <video:publication_date>2026-09-01T21:39:15+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394890</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394890/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>New Trending on 🔥</video:title>
      <video:description>⚡🔥 FREE FIRE EDIT 🔥⚡ 🎬 Turn up the volume and enjoy this INSANE Free Fire Edit! 💀🔥 Smooth transitions • Beat sync • Epic effects • Clean gameplay 🎯 💥 If you enjoyed this edit: 👍 LIKE 💬 COMMENT 🔔 SUBSCRIBE 🚀 More crazy Free Fire edits coming soon! ━━━━━━━━━━━━━━━━━━ 🎮 FREE FIRE | EDITING | GAMING ━━━━━━━━━━━━━━━━━━ #freefireshortsffshortsfreefireviralshortsfreefire1v4freefireheadshotshortsfreefirefunnyshortsfreefireclutchshortsfreefiremontageshortsffgameplayffviralffheadshot</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394890/3394890_720p.mp4</video:content_loc>
      <video:duration>13</video:duration>
      <video:publication_date>2026-09-01T21:39:04+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394889</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394889/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Um homem traído</video:title>
      <video:description>Me siga</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394889/3394889_720p.mp4</video:content_loc>
      <video:duration>170</video:duration>
      <video:publication_date>2026-09-01T21:38:58+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394888</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394888/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Zhi Vago - Celebrate (The Love) (Paul Da Breda Remix) | MELODIC TECHNO &amp; PROGRESSIVE REMIX</video:title>
      <video:description>Dive into a fresh, contemporary underground take on a timeless electronic classic. Paul Da Breda reimagines Zhi Vago&apos;s &apos;Celebrate (The Love)&apos; with a modern twist, blending classic trance and house vibes for today&apos;s dancefloors. Paul Da Breda is a Dutch/Brazilian DJ and producer known for bringing a unique underground perspective to electronic music. Subscribe for more timeless reworks and original productions! #remix #techno #trance #dance #dj #rave #eletronicmusic</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394888/3394888_720p.mp4</video:content_loc>
      <video:duration>240</video:duration>
      <video:publication_date>2026-09-01T21:38:51+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394887</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394887/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O Roubo no museu de Gothan City</video:title>
      <video:description>Batman vai até o museu investigar um roubo de antiguidades valiosas #Gatinonoturno</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394887/3394887_720p.mp4</video:content_loc>
      <video:duration>8</video:duration>
      <video:publication_date>2026-09-01T21:38:33+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394886</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394886/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>When the ball is your enemy</video:title>
      <video:description>#football #soccer #footballnews #soccernews #footballhighlights #soccerhighlights #footballskills #soccerskills #footballgoals #amazinggoals #bestgoals #footballmoments #soccermoments #footballplayers #soccerplayers #footballfans #footballhistory #footballfacts #soccerfacts #footballshorts #soccershorts #footballedit #socceredit #footballviral #soccerviral #footballmemes #soccermemes #footballchallenge #footballquiz #soccerquiz #footballanalysis #socceranalysis</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394886/3394886_720p.mp4</video:content_loc>
      <video:duration>15</video:duration>
      <video:publication_date>2026-09-01T21:38:26+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394885</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394885/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Comida testa estomago</video:title>
      <video:description>Na índia é assim : se tu come e não tem uma diarréia e não morrer, felicidades, a água do esgoto é que vai na panela. #Comida #índia #panela #cozido #esgoto</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394885/3394885_720p.mp4</video:content_loc>
      <video:duration>10</video:duration>
      <video:publication_date>2026-09-01T21:38:12+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394884</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394884/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_635.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_635.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394884/3394884_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:38:09+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394883</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394883/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>LOUVOR, A VOZ DO PROFETA.</video:title>
      <video:description>Louvor gospel #Louvor #gospel</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394883/3394883_720p.mp4</video:content_loc>
      <video:duration>202</video:duration>
      <video:publication_date>2026-09-01T21:37:56+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394882</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394882/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Funny Fail.🤣🤣🤣#funny #funnyvideos #foryou #viral</video:title>
      <video:description>Funny Fail.🤣🤣🤣#funny #funnyvideos #foryou #viral #funnyfunnyvideosforyouviral</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394882/3394882_720p.mp4</video:content_loc>
      <video:duration>78</video:duration>
      <video:publication_date>2026-09-01T21:37:55+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394881</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394881/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_634.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_634.mp4</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394881/3394881_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:37:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394880</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394880/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>AGORINHA CHUVINHA TOP COM PEDRINHA</video:title>
      <video:description>TOP DE MAIS QUE CHUVA MARAVILHOSA</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394880/3394880_720p.mp4</video:content_loc>
      <video:duration>83</video:duration>
      <video:publication_date>2026-09-01T21:37:52+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394879</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394879/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Flagramos um Tamanduá Gigante na Beira do Rio!</video:title>
      <video:description>#natureza</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394879/3394879_720p.mp4</video:content_loc>
      <video:duration>50</video:duration>
      <video:publication_date>2026-09-01T21:37:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394878</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394878/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Bastidores da Final do rodeio internacional Festa do Peão de Barretos!</video:title>
      <video:description>Bastidores da Final do rodeio internacional Festa do Peão de Barretos! Behind the scenes of the international rodeo final at the Barretos Cowboy Festival!</video:description>
      <video:content_loc>https://st83.febspot.com/videos/3390000/3394878/3394878_720p.mp4</video:content_loc>
      <video:duration>743</video:duration>
      <video:publication_date>2026-09-01T21:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394877</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394877/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Stay Tonight 💜 Emotional Deep House | Original Vocal Track 2026</video:title>
      <video:description>💜 Stay Tonight is an emotional Deep House journey about two souls who find each other in a city that never sleeps. With dreamy synths, powerful vocals, nostalgic melodies and modern electronic production, this original Groove Limits track is made for late-night drives, neon lights and unforgettable moments. 🎧 If you enjoy artists like Meduza, Rufus Du Sol, Anyma, Tinlicker, CamelPhat, Ben Böhmer or melodic electronic music, you&apos;ll love this track. 🔔 Subscribe for more original Deep House, Melodic House and Emotional EDM every week. 🎵 Artist: Groove Limits 🎼 Song: Stay Tonight 🎹 Genre: Emotional Deep House 🌌 Mood: Romantic • Night Drive • Neon • Emotional #staytonight #deephouse #melodichouse #emotionaldeephouse #housemusic #electronicmusic #edm #nightdrivemusic #summervibes #melodicedm #futurehouse #deephousevocal #romanticedm #originalsong #newdeephouse #groovelimits #clubmusic #dancemusic #2026music #housevocals #neonmusic #chillhouse</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394877/3394877_720p.mp4</video:content_loc>
      <video:duration>222</video:duration>
      <video:publication_date>2026-09-01T21:37:43+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394876</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394876/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Fortress - Mark Nadilo</video:title>
      <video:description>&quot;Fortress&quot; is a Mark Nadilo song from his earlier catalog, released in 2025. Listen to &amp; download &quot;Fortress&quot;: https://share.amuse.io/5poj9SJdKmE2 More music by Mark Nadilo: https://linktr.ee/marknadilo Official discography: https://marknadilo.bandcamp.com/music Credits: ℗ Fortress ℗ Mark Nadilo Original year: 2011 Release year: 2025 ISRC: SE6QE2584294 #Fortress #MarkNadilo #Originalmusic #poprock #music</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394876/3394876_720p.mp4</video:content_loc>
      <video:duration>192</video:duration>
      <video:publication_date>2026-09-01T21:37:35+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394875</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394875/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_633.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_633.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394875/3394875_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:37:31+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394874</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394874/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>( Nepal: novas imagens mostram avalanche avançando e destruindo comunidades; veja vídeo )</video:title>
      <video:description>avalanche avançando e destruindo comunidades; veja vídeo #NepaleTibet</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394874/3394874_720p.mp4</video:content_loc>
      <video:duration>37</video:duration>
      <video:publication_date>2026-09-01T21:37:28+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394873</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394873/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>iPhone Samsung Vivo Nokia Google fix game infinix Mobile phones evolution from  brick hologram for d</video:title>
      <video:description>Mobile phone LED Sony model transfer Nokia Samsung Vivo iPhone #IndiaChinaCanadaUnitedStateLondonNewZealandItalyGermanyFrance</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394873/3394873_720p.mp4</video:content_loc>
      <video:duration>274</video:duration>
      <video:publication_date>2026-09-01T21:37:20+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394872</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394872/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_632.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_632.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394872/3394872_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:37:11+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394871</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394871/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Câmera em carro flagra batida violenta entre dois veículos em rodovia do RS</video:title>
      <video:description>Câmera em carro flagra batida violenta entre dois veículos em rodovia do RS</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394871/3394871_720p.mp4</video:content_loc>
      <video:duration>86</video:duration>
      <video:publication_date>2026-09-01T21:37:06+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394870</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394870/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>O governo mandou o seu melhor agente de campo para a batalha 🎭🎬🍿</video:title>
      <video:description>O governo mandou o seu melhor agente de campo para a batalha 🎭🎬🍿 Só os melhores filmes de ação de espionagem e de batalhas🎭🎬🍿 #Filmedeespionagemfilmesdeagentesosmelhoresagentesdogoverno</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394870/3394870_720p.mp4</video:content_loc>
      <video:duration>92</video:duration>
      <video:publication_date>2026-09-01T21:37:00+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394869</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394869/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_631.mp4</video:title>
      <video:description>CALL OF DUTY 1, GEARS OF WAR 3, Control Ultimate e Hell Is Us PARTE =_631.mp4</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394869/3394869_720p.mp4</video:content_loc>
      <video:duration>36</video:duration>
      <video:publication_date>2026-09-01T21:36:49+02:00</video:publication_date>
    </video:video>
  </url>
  <url>
    <loc>https://www.febspot.com/video/3394868</loc>
    <video:video>
      <video:thumbnail_loc>https://www.febspot.com/contents/videos_screenshots/3390000/3394868/preview_720p.mp4.jpg</video:thumbnail_loc>
      <video:title>Música: Sacode o Cortisol</video:title>
      <video:description>Música criada com IA, para fazer você relaxar #Musica</video:description>
      <video:content_loc>https://st82.febspot.com/videos/3390000/3394868/3394868_720p.mp4</video:content_loc>
      <video:duration>180</video:duration>
      <video:publication_date>2026-09-01T21:36:44+02:00</video:publication_date>
    </video:video>
  </url>
</urlset>
